Psyllid ID: psy10868
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 649 | 2.2.26 [Sep-21-2011] | |||||||
| Q5U3Q6 | 542 | Cdc42-interacting protein | no | N/A | 0.812 | 0.972 | 0.313 | 4e-83 | |
| Q6DCZ7 | 543 | Formin-binding protein 1- | N/A | N/A | 0.798 | 0.953 | 0.309 | 1e-82 | |
| Q6GUF4 | 550 | Formin-binding protein 1- | no | N/A | 0.793 | 0.936 | 0.310 | 3e-79 | |
| Q5T0N5 | 605 | Formin-binding protein 1- | no | N/A | 0.812 | 0.871 | 0.296 | 2e-72 | |
| Q8K012 | 605 | Formin-binding protein 1- | no | N/A | 0.812 | 0.871 | 0.295 | 5e-72 | |
| Q2HWF0 | 605 | Formin-binding protein 1- | no | N/A | 0.812 | 0.871 | 0.295 | 8e-71 | |
| Q5RCJ1 | 601 | Cdc42-interacting protein | no | N/A | 0.815 | 0.880 | 0.292 | 2e-70 | |
| P97531 | 547 | Cdc42-interacting protein | no | N/A | 0.622 | 0.738 | 0.336 | 6e-63 | |
| Q96RU3 | 617 | Formin-binding protein 1 | no | N/A | 0.687 | 0.722 | 0.300 | 2e-60 | |
| Q8CJ53 | 603 | Cdc42-interacting protein | no | N/A | 0.631 | 0.679 | 0.306 | 6e-60 |
| >sp|Q5U3Q6|CIP4_DANRE Cdc42-interacting protein 4 homolog OS=Danio rerio GN=trip10 PE=2 SV=1 | Back alignment and function desciption |
|---|
Score = 309 bits (792), Expect = 4e-83, Method: Compositional matrix adjust.
Identities = 205/654 (31%), Positives = 326/654 (49%), Gaps = 127/654 (19%)
Query: 2 FQDQYDNLSLHTQKGIDFLEKYGHFIRDRCAIEMEYAGKLRRLVKNYQPK---KEEEDYQ 58
DQYD L HTQ G+D ++KY F+++R IE YA +LR L K Y PK KEE++ +
Sbjct: 7 LWDQYDILDKHTQSGLDLVDKYMKFVKERTDIEQNYAKQLRNLTKKYSPKRGSKEEQECR 66
Query: 59 YSTCKAFKCVLDEVTDLAGQHEVIAENLQVFIIKEVTIFVKDFKEERKKHLQDGARMMNL 118
+S +AF +L+E+ D AGQ E+IAEN+ + I E+ K+LQ+
Sbjct: 67 FSNHQAFLDILNEMNDYAGQRELIAENMMINICVELN-----------KYLQE------- 108
Query: 119 LENQVIALERARKNYDKAYRESDKALEHYKRADADLELSRAEHLQDGDHLMKILRNQVDA 178
L+ R HL + + L
Sbjct: 109 -----------------------------------LKQERKMHLSEAKKSQQSLEAMYKQ 133
Query: 179 LERALKNYEKAFRDADKALEHYKRADADLELSRAEVEKQRINMAIKSQHCEDTKTEYANQ 238
L+ + K +E+ +R+A+KA ++ + D DL ++A+VEK + +++ ED K +YA Q
Sbjct: 134 LDNSKKRFEREWREAEKAAQYADKTDQDLNATKADVEKAKQQAHLRTHIAEDCKNDYAAQ 193
Query: 239 LQRANEMQRQHYTQAMPEVFAQLQELDEKRVRNIRNFMVHSANIEKKVFPIINQCLDGII 298
LQ+ N+ Q Q Y MP++F +LQ++DE+R++ + + A+ E+ V PII +CL+G+
Sbjct: 194 LQKYNKGQSQFYFTDMPQIFNKLQDMDERRIKKMAQGYILFADTERHVMPIIGKCLEGMT 253
Query: 299 KAADQINEKEDSALVIERYKSGFTPPGDIPFEDLSRG-----GESTPIAPAFPHLMGMRP 353
+A +N + DS ++IE++KSGF PGD+ FED S+G +S+ P P + +
Sbjct: 254 RAGTNVNARNDSMVLIEQHKSGFERPGDLDFEDYSQGINRASSDSSLGTPKGPLELLGKN 313
Query: 354 EAATVRGTMSAGRLKRRNNVGGFGSNGKDDFSNLPPSQRKKKLQQRIEEIQHSIQQESAA 413
+ T R + V G F++LPP QR+K+LQQ+I+++ +Q+E
Sbjct: 314 KNKTFRLFNKKSKFTPEKPVDTEG------FTHLPPEQRRKRLQQKIDDMSKELQKEMDQ 367
Query: 414 REGLIKMKGVYEDNPNLGDPHMIEGQLSETDSRLEKLRGELQKYQTYMEESEANSPAGMR 473
E L KMK VYE NP +GDP + Q+ +T +++LRGEL KY++++ E
Sbjct: 368 SEALGKMKDVYEKNPQMGDPASLAPQIGQTAQNMDRLRGELNKYESWLAE---------- 417
Query: 474 KNSGGGGNNNVNSTSGSSGGVNGVQTQQQRVNVNGGSNNNRDERANSAGEEEESLSRSAS 533
+GG G++ ST +N NG N N +
Sbjct: 418 --AGGRGDSIRYST--------------HSINNNGAHNPN------------------SH 443
Query: 534 DSSVHNNNHSKLNSSSTQLPNISLYQREEPDIGTSHTSLPESDPPEYFDLPPLGTAKALY 593
D S + L+ + P+ ++Y + + + P +G ALY
Sbjct: 444 DGSCTLFSPGALSDETD--PSQAIYTEFDDEFEEEELATP------------IGQCTALY 489
Query: 594 PFEATSEGSIPMYDGEELYIIELDQGDGWTRVRRQTDSEEGFVPTSYIQTIALD 647
F +SEG+I M +GE L ++E D+GDGWTRVRR + +EG++PTSY TI L+
Sbjct: 490 NFPGSSEGTISMQEGEVLAVVEEDKGDGWTRVRR-NNGDEGYIPTSYA-TITLN 541
|
Required to coordinate membrane tubulation with reorganization of the actin cytoskeleton during endocytosis. Danio rerio (taxid: 7955) |
| >sp|Q6DCZ7|FBP1L_XENLA Formin-binding protein 1-like OS=Xenopus laevis GN=fnbp1l PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q6GUF4|FBP1L_XENTR Formin-binding protein 1-like OS=Xenopus tropicalis GN=fnbp1l PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q5T0N5|FBP1L_HUMAN Formin-binding protein 1-like OS=Homo sapiens GN=FNBP1L PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q8K012|FBP1L_MOUSE Formin-binding protein 1-like OS=Mus musculus GN=Fnbp1l PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q2HWF0|FBP1L_RAT Formin-binding protein 1-like OS=Rattus norvegicus GN=Fnbp1l PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q5RCJ1|CIP4_PONAB Cdc42-interacting protein 4 OS=Pongo abelii GN=TRIP10 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P97531|CIP4_RAT Cdc42-interacting protein 4 OS=Rattus norvegicus GN=Trip10 PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|Q96RU3|FNBP1_HUMAN Formin-binding protein 1 OS=Homo sapiens GN=FNBP1 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q8CJ53|CIP4_MOUSE Cdc42-interacting protein 4 OS=Mus musculus GN=Trip10 PE=1 SV=2 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 649 | ||||||
| 328718933 | 598 | PREDICTED: cdc42-interacting protein 4-l | 0.855 | 0.928 | 0.531 | 0.0 | |
| 307188194 | 758 | Formin-binding protein 1-like [Camponotu | 0.858 | 0.734 | 0.522 | 1e-170 | |
| 383848582 | 607 | PREDICTED: formin-binding protein 1-like | 0.861 | 0.920 | 0.512 | 1e-169 | |
| 350416239 | 599 | PREDICTED: formin-binding protein 1 homo | 0.861 | 0.933 | 0.515 | 1e-167 | |
| 380030038 | 609 | PREDICTED: cdc42-interacting protein 4-l | 0.861 | 0.917 | 0.509 | 1e-167 | |
| 328777221 | 609 | PREDICTED: cdc42-interacting protein 4-l | 0.861 | 0.917 | 0.509 | 1e-167 | |
| 156544131 | 598 | PREDICTED: cdc42-interacting protein 4-l | 0.862 | 0.936 | 0.524 | 1e-167 | |
| 340711459 | 609 | PREDICTED: LOW QUALITY PROTEIN: formin-b | 0.861 | 0.917 | 0.506 | 1e-166 | |
| 307193709 | 585 | Formin-binding protein 1-like [Harpegnat | 0.825 | 0.916 | 0.501 | 1e-157 | |
| 332031094 | 645 | Formin-binding protein 1-like protein [A | 0.825 | 0.831 | 0.489 | 1e-157 |
| >gi|328718933|ref|XP_001944252.2| PREDICTED: cdc42-interacting protein 4-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 643 bits (1658), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 357/672 (53%), Positives = 438/672 (65%), Gaps = 117/672 (17%)
Query: 2 FQDQYDNLSLHTQKGIDFLEKYGHFIRDRCAIEMEYAGKLRRLVKNYQPKK-EEEDYQYS 60
DQYDNLS HTQKGIDFLE+YGHFIRDRC IEMEYAGKLRRLVKNYQPKK EEE+YQYS
Sbjct: 7 LWDQYDNLSFHTQKGIDFLERYGHFIRDRCLIEMEYAGKLRRLVKNYQPKKKEEEEYQYS 66
Query: 61 TCKAFKCVLDEVTDLAGQHEVIAENLQVFIIKEVTIFVKDFKEERKKHLQDGARMMNLLE 120
TCKAFK +L EV DLAGQHEVIAENLQ +I+E+ VK
Sbjct: 67 TCKAFKAMLCEVNDLAGQHEVIAENLQSDVIREINYLVK--------------------- 105
Query: 121 NQVIALERARKNYDKAYRESDKALEHYKRADADLELSRAEHLQDGDHLMKILRNQVDALE 180
D++ R + LQD + ++ NQV +LE
Sbjct: 106 --------------------------------DIKEERKKLLQDSAKYVAMINNQVASLE 133
Query: 181 RALKNYEKAFRDADKALEHYKRADADLELSRAEVEKQRINMAIKSQHCEDTKTEYANQLQ 240
R+ KNYEKAF++A++AL++++RADADL LSRAEVEKQR+NMAIK+QHCE++K EYANQLQ
Sbjct: 134 RSRKNYEKAFKEAERALDNFQRADADLNLSRAEVEKQRMNMAIKNQHCEESKNEYANQLQ 193
Query: 241 RANEMQRQHYTQAMPEVFAQLQELDEKRVRNIRNFMVHSANIEKKVFPIINQCLDGIIKA 300
+ NE+Q QHY MPEVF QLQELDEKR+RN+R+FM HSA++E+ VFPIIN+CLDGII A
Sbjct: 194 KTNELQSQHYKALMPEVFRQLQELDEKRIRNVRHFMAHSADVERNVFPIINKCLDGIINA 253
Query: 301 ADQINEKEDSALVIERYKSGFTPPGDIPFEDLSRGGESTP-IAPAFPH------LMGMRP 353
A+Q+NEK+D+ LVIERYKSGF PPGD PF+DLSRGGESTP I P + + R
Sbjct: 254 ANQVNEKQDTILVIERYKSGFEPPGDFPFDDLSRGGESTPLILPGSGNTYVSSGVGAHRS 313
Query: 354 EAATVRGTMSAGRLKRRNNVGGFG-----------SNGKDDFSNLPPSQRKKKLQQRIEE 402
E+ TV+GTMSAG+LK+R VG F S KDD+S LPP+QR+KK+ Q+++E
Sbjct: 314 ESMTVKGTMSAGKLKKR--VGLFAIFSSNKNNLSSSGDKDDYSELPPNQRRKKILQKLDE 371
Query: 403 IQHSIQQESAAREGLIKMKGVYEDNPNLGDPHMIEGQLSETDSRLEKLRGELQKYQTYME 462
+Q + QE AA++GL+KMKGVYE NP LGDP EGQL+E R++KL ++ KYQ ++
Sbjct: 372 MQAKLHQEIAAKDGLMKMKGVYESNPALGDPMSTEGQLNECSQRIDKLNSDIAKYQGLLQ 431
Query: 463 ESEAN-SPAGMRKNS----GGGGNNNVNSTSGSSGGVNGVQTQQQRVNVNGGSNNNRDER 517
E E N SPAG RK+ G GN + N+ S + +N T D R
Sbjct: 432 EVECNVSPAGTRKHELTEHNGIGNGSTNNLSNHNNRINTSLT---------------DGR 476
Query: 518 ANSAGEEEESLSRSASDSSVHNNNHSKLNSSSTQLPNISL---YQREEPDIGTSHTSLP- 573
A GE+E ++ SS +P + L Y E +G S SL
Sbjct: 477 A-PLGEDESLSRSAS--------------DSSVSIPAVGLNNRYSGETVSLGASRNSLAN 521
Query: 574 ESDPPEYF---DLPPLGTAKALYPFEATSEGSIPMYDGEELYIIELDQGDGWTRVRRQ-T 629
+ DPP Y+ DLPPLGT ALY FEATSEGSIPM+DGE+L IIE DQGDGWTRVRRQ
Sbjct: 522 DEDPPPYYDIHDLPPLGTCTALYAFEATSEGSIPMFDGEQLLIIEQDQGDGWTRVRRQPP 581
Query: 630 DSEEGFVPTSYI 641
+ EEGFVPTSYI
Sbjct: 582 NVEEGFVPTSYI 593
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|307188194|gb|EFN73026.1| Formin-binding protein 1-like [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|383848582|ref|XP_003699928.1| PREDICTED: formin-binding protein 1-like, partial [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|350416239|ref|XP_003490884.1| PREDICTED: formin-binding protein 1 homolog [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|380030038|ref|XP_003698666.1| PREDICTED: cdc42-interacting protein 4-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|328777221|ref|XP_397251.4| PREDICTED: cdc42-interacting protein 4-like [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|156544131|ref|XP_001605898.1| PREDICTED: cdc42-interacting protein 4-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|340711459|ref|XP_003394293.1| PREDICTED: LOW QUALITY PROTEIN: formin-binding protein 1-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|307193709|gb|EFN76392.1| Formin-binding protein 1-like [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|332031094|gb|EGI70671.1| Formin-binding protein 1-like protein [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 649 | ||||||
| FB|FBgn0035533 | 665 | Cip4 "Cip4" [Drosophila melano | 0.474 | 0.463 | 0.512 | 1.7e-103 | |
| UNIPROTKB|Q96RU3 | 617 | FNBP1 "Formin-binding protein | 0.697 | 0.734 | 0.307 | 3.7e-74 | |
| MGI|MGI:109606 | 616 | Fnbp1 "formin binding protein | 0.704 | 0.741 | 0.304 | 3.7e-72 | |
| UNIPROTKB|F1MQ90 | 647 | FNBP1 "Uncharacterized protein | 0.280 | 0.281 | 0.384 | 2.7e-71 | |
| UNIPROTKB|F1RQE2 | 647 | FNBP1 "Uncharacterized protein | 0.280 | 0.281 | 0.379 | 3.1e-71 | |
| RGD|621350 | 616 | Fnbp1 "formin binding protein | 0.697 | 0.735 | 0.298 | 4.2e-71 | |
| RGD|1305386 | 605 | Fnbp1l "formin binding protein | 0.280 | 0.300 | 0.384 | 7.4e-69 | |
| RGD|621145 | 547 | Trip10 "thyroid hormone recept | 0.471 | 0.559 | 0.371 | 1.8e-68 | |
| MGI|MGI:1925642 | 605 | Fnbp1l "formin binding protein | 0.280 | 0.300 | 0.384 | 1.3e-48 | |
| UNIPROTKB|Q5T0N5 | 605 | FNBP1L "Formin-binding protein | 0.280 | 0.300 | 0.384 | 6.3e-49 |
| FB|FBgn0035533 Cip4 "Cip4" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 798 (286.0 bits), Expect = 1.7e-103, Sum P(2) = 1.7e-103
Identities = 164/320 (51%), Positives = 225/320 (70%)
Query: 154 LELSRAEHLQDGDHLMKILRNQVDALERALKNYEKAFRDADKALEHYKRADADLELSRAE 213
L R + L DG L + L Q+ +L+RA +NYEKA+RD++KA++ YKRAD DL LSRAE
Sbjct: 171 LREERKKCLSDGATLQQNLTTQLSSLDRAKRNYEKAYRDSEKAVDSYKRADMDLNLSRAE 230
Query: 214 VEKQRINMAIKSQHCEDTKTEYANQLQRANEMQRQHYTQAMPEVFAQLQELDEKRVRNIR 273
VE+ + M K Q +D K EYANQLQ+ N +Q+QHY+ +P V +LQELDEKR R R
Sbjct: 231 VERYKNVMTSKIQQSDDAKNEYANQLQKTNNLQQQHYSMLLPSVLNRLQELDEKRTRGFR 290
Query: 274 NFMVHSANIEKKVFPIINQCLDGIIKAADQINEKEDSALVIERYKSGFTPPGDIPFEDLS 333
F+V +A++E V PII +C++GI+KA + INEKED+ VIERY+SGFTPP DIPFEDLS
Sbjct: 291 EFIVGAADVESSVAPIIARCMEGIVKAGESINEKEDTFKVIERYQSGFTPPRDIPFEDLS 350
Query: 334 RGGESTPIAPAFPHLMGMRPEAATVRGTMSAGRLKRRNNVGG-FGSN-------G-KDDF 384
+ P + H T+RGTMSA +LK+R + FGSN G K+DF
Sbjct: 351 K---CDPDSVQDSHYSNSTSNHLTIRGTMSANKLKKRVGIFNIFGSNKNSLTADGQKEDF 407
Query: 385 SNLPPSQRKKKLQQRIEEIQHSIQQESAAREGLIKMKGVYEDNPNLGDPHMIEGQLSETD 444
S+LPP+QR+KKLQ +I E+ +I QE+ AR+GL+KMK VYE N +LG+P +EGQL+E++
Sbjct: 408 SDLPPNQRRKKLQAKIAELTQNIAQETKARDGLMKMKIVYEANSSLGNPMTVEGQLNESE 467
Query: 445 SRLEKLRGELQKYQTYMEES 464
+LEKL+ +L+KYQ ++E++
Sbjct: 468 HKLEKLKVDLKKYQGFLEKA 487
|
|
| UNIPROTKB|Q96RU3 FNBP1 "Formin-binding protein 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:109606 Fnbp1 "formin binding protein 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MQ90 FNBP1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RQE2 FNBP1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| RGD|621350 Fnbp1 "formin binding protein 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| RGD|1305386 Fnbp1l "formin binding protein 1-like" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| RGD|621145 Trip10 "thyroid hormone receptor interactor 10" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1925642 Fnbp1l "formin binding protein 1-like" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5T0N5 FNBP1L "Formin-binding protein 1-like" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 649 | |||
| cd07653 | 251 | cd07653, F-BAR_CIP4-like, The F-BAR (FES-CIP4 Homo | 3e-98 | |
| cd07676 | 253 | cd07676, F-BAR_FBP17, The F-BAR (FES-CIP4 Homology | 1e-59 | |
| cd07675 | 252 | cd07675, F-BAR_FNBP1L, The F-BAR (FES-CIP4 Homolog | 4e-48 | |
| cd11619 | 77 | cd11619, HR1_CIP4-like, Protein kinase C-related k | 2e-26 | |
| cd11911 | 55 | cd11911, SH3_CIP4-like, Src Homology 3 domain of C | 1e-24 | |
| cd11628 | 81 | cd11628, HR1_CIP4_FNBP1L, Protein kinase C-related | 3e-21 | |
| cd12071 | 57 | cd12071, SH3_FBP17, Src Homology 3 domain of Formi | 3e-19 | |
| cd12072 | 57 | cd12072, SH3_FNBP1L, Src Homology 3 domain of Form | 8e-18 | |
| cd07610 | 191 | cd07610, FCH_F-BAR, The Extended FES-CIP4 Homology | 1e-16 | |
| pfam00611 | 91 | pfam00611, FCH, Fes/CIP4, and EFC/F-BAR homology d | 4e-16 | |
| cd11629 | 77 | cd11629, HR1_FBP17, Protein kinase C-related kinas | 5e-16 | |
| cd11912 | 55 | cd11912, SH3_Bzz1_1, First Src Homology 3 domain o | 2e-14 | |
| cd11777 | 55 | cd11777, SH3_CIP4_Bzz1_like, Src Homology 3 domain | 3e-14 | |
| smart00326 | 56 | smart00326, SH3, Src homology 3 domains | 2e-10 | |
| cd11761 | 57 | cd11761, SH3_FCHSD_1, First Src Homology 3 domain | 7e-10 | |
| cd11858 | 55 | cd11858, SH3_Myosin-I_fungi, Src homology 3 domain | 8e-09 | |
| cd00089 | 68 | cd00089, HR1, Protein kinase C-related kinase homo | 2e-08 | |
| smart00055 | 87 | smart00055, FCH, Fes/CIP4 homology domain | 8e-08 | |
| cd07655 | 258 | cd07655, F-BAR_PACSIN, The F-BAR (FES-CIP4 Homolog | 1e-07 | |
| pfam00018 | 47 | pfam00018, SH3_1, SH3 domain | 1e-07 | |
| cd00174 | 51 | cd00174, SH3, Src Homology 3 domain superfamily | 1e-07 | |
| cd11775 | 57 | cd11775, SH3_Sla1p_3, Third Src Homology 3 domain | 2e-06 | |
| cd11849 | 53 | cd11849, SH3_SPIN90, Src homology 3 domain of SH3 | 6e-06 | |
| cd11763 | 55 | cd11763, SH3_SNX9_like, Src Homology 3 domain of S | 7e-06 | |
| cd07647 | 239 | cd07647, F-BAR_PSTPIP, The F-BAR (FES-CIP4 Homolog | 8e-06 | |
| cd11768 | 54 | cd11768, SH3_Tec_like, Src Homology 3 domain of Te | 2e-05 | |
| cd11845 | 52 | cd11845, SH3_Src_like, Src homology 3 domain of Sr | 2e-05 | |
| cd07654 | 264 | cd07654, F-BAR_FCHSD, The F-BAR (FES-CIP4 Homology | 3e-05 | |
| cd11856 | 53 | cd11856, SH3_p47phox_like, Src homology 3 domains | 4e-05 | |
| cd11769 | 57 | cd11769, SH3_CSK, Src Homology 3 domain of C-termi | 4e-05 | |
| cd12009 | 54 | cd12009, SH3_Blk, Src homology 3 domain of Blk Pro | 5e-05 | |
| cd12004 | 56 | cd12004, SH3_Lyn, Src homology 3 domain of Lyn Pro | 8e-05 | |
| cd07649 | 233 | cd07649, F-BAR_GAS7, The F-BAR (FES-CIP4 Homology | 9e-05 | |
| cd07652 | 234 | cd07652, F-BAR_Rgd1, The F-BAR (FES-CIP4 Homology | 1e-04 | |
| cd11824 | 53 | cd11824, SH3_PSTPIP1, Src homology 3 domain of Pro | 2e-04 | |
| cd12006 | 56 | cd12006, SH3_Fyn_Yrk, Src homology 3 domain of Fyn | 3e-04 | |
| cd11773 | 57 | cd11773, SH3_Sla1p_1, First Src Homology 3 domain | 6e-04 | |
| cd11767 | 56 | cd11767, SH3_Nck_3, Third Src Homology 3 domain of | 8e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 8e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.001 | |
| cd07658 | 239 | cd07658, F-BAR_NOSTRIN, The F-BAR (FES-CIP4 Homolo | 0.001 | |
| cd11878 | 54 | cd11878, SH3_Bem1p_1, First Src Homology 3 domain | 0.001 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.002 | |
| cd11778 | 51 | cd11778, SH3_Bzz1_2, Second Src Homology 3 domain | 0.002 | |
| cd07596 | 218 | cd07596, BAR_SNX, The Bin/Amphiphysin/Rvs (BAR) do | 0.002 | |
| cd11850 | 56 | cd11850, SH3_Abl, Src homology 3 domain of the Pro | 0.002 |
| >gnl|CDD|153337 cd07653, F-BAR_CIP4-like, The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Cdc42-Interacting Protein 4 and similar proteins | Back alignment and domain information |
|---|
Score = 300 bits (771), Expect = 3e-98
Identities = 131/301 (43%), Positives = 186/301 (61%), Gaps = 54/301 (17%)
Query: 3 QDQYDNLSLHTQKGIDFLEKYGHFIRDRCAIEMEYAGKLRRLVKNYQPKK-EEEDYQYST 61
DQ+DNL HTQKGIDFLE+YG F+++R AIE EYA KLR+LVK Y PKK EE++Y +S+
Sbjct: 4 WDQFDNLEKHTQKGIDFLERYGKFVKERAAIEQEYAKKLRKLVKKYLPKKKEEDEYSFSS 63
Query: 62 CKAFKCVLDEVTDLAGQHEVIAENLQVFIIKEVTIFVKDFKEERKKHLQDGARMMNLLEN 121
KAF+ +L+EV D+AGQHE+IAENL + KE+ + + ++ERKKHL +G+++ LE+
Sbjct: 64 VKAFRSILNEVNDIAGQHELIAENLNSNVCKELKTLISELRQERKKHLSEGSKLQQKLES 123
Query: 122 QVIALERARKNYDKAYRESDKALEHYKRADADLELSRAEHLQDGDHLMKILRNQVDALER 181
K +K+
Sbjct: 124 S-------IKQLEKSK-------------------------------------------- 132
Query: 182 ALKNYEKAFRDADKALEHYKRADADLELSRAEVEKQRINMAIKSQHCEDTKTEYANQLQR 241
K YEKAF++A+KA + Y++ADAD+ L++A+VEK + N +K+Q E+ K EYA QLQ+
Sbjct: 133 --KAYEKAFKEAEKAKQKYEKADADMNLTKADVEKAKANANLKTQAAEEAKNEYAAQLQK 190
Query: 242 ANEMQRQHYTQAMPEVFAQLQELDEKRVRNIRNFMVHSANIEKKVFPIINQCLDGIIKAA 301
N+ QRQHY+ +P++F +LQELDEKR+ ++ +A IE+KV PII +CLDGI KA
Sbjct: 191 FNKEQRQHYSTDLPQIFDKLQELDEKRINRTVELLLQAAEIERKVIPIIAKCLDGIKKAG 250
Query: 302 D 302
D
Sbjct: 251 D 251
|
F-BAR domains are dimerization modules that bind and bend membranes and are found in proteins involved in membrane dynamics and actin reorganization. This subfamily is composed of Cdc42-Interacting Protein 4 (CIP4), Formin Binding Protein 17 (FBP17), FormiN Binding Protein 1-Like (FNBP1L), and similar proteins. CIP4 and FNBP1L are Cdc42 effectors that bind Wiskott-Aldrich syndrome protein (WASP) and function in endocytosis. CIP4 and FBP17 bind to the Fas ligand and may be implicated in the inflammatory response. CIP4 may also play a role in phagocytosis. Members of this subfamily typically contain an N-terminal F-BAR domain and a C-terminal SH3 domain. In addition, some members such as FNBP1L contain a central Cdc42-binding HR1 domain. F-BAR domains form banana-shaped dimers with a positively-charged concave surface that binds to negatively-charged lipid membranes. They can induce membrane deformation in the form of long tubules. Length = 251 |
| >gnl|CDD|153360 cd07676, F-BAR_FBP17, The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Formin Binding Protein 17 | Back alignment and domain information |
|---|
| >gnl|CDD|153359 cd07675, F-BAR_FNBP1L, The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Formin Binding Protein 1-Like | Back alignment and domain information |
|---|
| >gnl|CDD|212009 cd11619, HR1_CIP4-like, Protein kinase C-related kinase homology region 1 (HR1) Rho-binding domain of Cdc42-Interacting Protein 4 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212844 cd11911, SH3_CIP4-like, Src Homology 3 domain of Cdc42-Interacting Protein 4 | Back alignment and domain information |
|---|
| >gnl|CDD|212018 cd11628, HR1_CIP4_FNBP1L, Protein kinase C-related kinase homology region 1 (HR1) Rho-binding domain of vertebrate Cdc42-Interacting Protein 4 and FormiN Binding Protein 1-Like | Back alignment and domain information |
|---|
| >gnl|CDD|213004 cd12071, SH3_FBP17, Src Homology 3 domain of Formin Binding Protein 17 | Back alignment and domain information |
|---|
| >gnl|CDD|213005 cd12072, SH3_FNBP1L, Src Homology 3 domain of Formin Binding Protein 1-Like | Back alignment and domain information |
|---|
| >gnl|CDD|153294 cd07610, FCH_F-BAR, The Extended FES-CIP4 Homology (FCH) or F-BAR (FCH and Bin/Amphiphysin/Rvs) domain, a dimerization module that binds and bends membranes | Back alignment and domain information |
|---|
| >gnl|CDD|216021 pfam00611, FCH, Fes/CIP4, and EFC/F-BAR homology domain | Back alignment and domain information |
|---|
| >gnl|CDD|212019 cd11629, HR1_FBP17, Protein kinase C-related kinase homology region 1 (HR1) Rho-binding domain of Formin Binding Protein 17 | Back alignment and domain information |
|---|
| >gnl|CDD|212845 cd11912, SH3_Bzz1_1, First Src Homology 3 domain of Bzz1 and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|212711 cd11777, SH3_CIP4_Bzz1_like, Src Homology 3 domain of Cdc42-Interacting Protein 4, Bzz1 and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|214620 smart00326, SH3, Src homology 3 domains | Back alignment and domain information |
|---|
| >gnl|CDD|212695 cd11761, SH3_FCHSD_1, First Src Homology 3 domain of FCH and double SH3 domains proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212792 cd11858, SH3_Myosin-I_fungi, Src homology 3 domain of Type I fungal Myosins | Back alignment and domain information |
|---|
| >gnl|CDD|212008 cd00089, HR1, Protein kinase C-related kinase homology region 1 (HR1) domain that binds Rho family small GTPases | Back alignment and domain information |
|---|
| >gnl|CDD|214492 smart00055, FCH, Fes/CIP4 homology domain | Back alignment and domain information |
|---|
| >gnl|CDD|153339 cd07655, F-BAR_PACSIN, The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Protein kinase C and Casein kinase Substrate in Neurons (PACSIN) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|215659 pfam00018, SH3_1, SH3 domain | Back alignment and domain information |
|---|
| >gnl|CDD|212690 cd00174, SH3, Src Homology 3 domain superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|212709 cd11775, SH3_Sla1p_3, Third Src Homology 3 domain of the fungal endocytic adaptor protein Sla1p | Back alignment and domain information |
|---|
| >gnl|CDD|212783 cd11849, SH3_SPIN90, Src homology 3 domain of SH3 protein interacting with Nck, 90 kDa (SPIN90) | Back alignment and domain information |
|---|
| >gnl|CDD|212697 cd11763, SH3_SNX9_like, Src Homology 3 domain of Sorting Nexin 9 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|153331 cd07647, F-BAR_PSTPIP, The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Proline-Serine-Threonine Phosphatase-Interacting Proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212702 cd11768, SH3_Tec_like, Src Homology 3 domain of Tec-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|212779 cd11845, SH3_Src_like, Src homology 3 domain of Src kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|153338 cd07654, F-BAR_FCHSD, The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of FCH and double SH3 domains proteins (FCHSD) | Back alignment and domain information |
|---|
| >gnl|CDD|212790 cd11856, SH3_p47phox_like, Src homology 3 domains of the p47phox subunit of NADPH oxidase and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|212703 cd11769, SH3_CSK, Src Homology 3 domain of C-terminal Src kinase | Back alignment and domain information |
|---|
| >gnl|CDD|212942 cd12009, SH3_Blk, Src homology 3 domain of Blk Protein Tyrosine Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|212937 cd12004, SH3_Lyn, Src homology 3 domain of Lyn Protein Tyrosine Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|153333 cd07649, F-BAR_GAS7, The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Growth Arrest Specific protein 7 | Back alignment and domain information |
|---|
| >gnl|CDD|153336 cd07652, F-BAR_Rgd1, The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Saccharomyces cerevisiae Rho GTPase activating protein Rgd1 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212758 cd11824, SH3_PSTPIP1, Src homology 3 domain of Proline-Serine-Threonine Phosphatase-Interacting Protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212939 cd12006, SH3_Fyn_Yrk, Src homology 3 domain of Fyn and Yrk Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|212707 cd11773, SH3_Sla1p_1, First Src Homology 3 domain of the fungal endocytic adaptor protein Sla1p | Back alignment and domain information |
|---|
| >gnl|CDD|212701 cd11767, SH3_Nck_3, Third Src Homology 3 domain of Nck adaptor proteins | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|153342 cd07658, F-BAR_NOSTRIN, The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Nitric Oxide Synthase TRaffic INducer (NOSTRIN) | Back alignment and domain information |
|---|
| >gnl|CDD|212811 cd11878, SH3_Bem1p_1, First Src Homology 3 domain of Bud emergence protein 1 and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|212712 cd11778, SH3_Bzz1_2, Second Src Homology 3 domain of Bzz1 and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|153280 cd07596, BAR_SNX, The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexins | Back alignment and domain information |
|---|
| >gnl|CDD|212784 cd11850, SH3_Abl, Src homology 3 domain of the Protein Tyrosine Kinase, Abelson kinase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 649 | |||
| cd07675 | 252 | F-BAR_FNBP1L The F-BAR (FES-CIP4 Homology and Bin/ | 100.0 | |
| cd07676 | 253 | F-BAR_FBP17 The F-BAR (FES-CIP4 Homology and Bin/A | 100.0 | |
| KOG3565|consensus | 640 | 100.0 | ||
| KOG2856|consensus | 472 | 100.0 | ||
| cd07673 | 269 | F-BAR_FCHO2 The F-BAR (FES-CIP4 Homology and Bin/A | 100.0 | |
| cd07653 | 251 | F-BAR_CIP4-like The F-BAR (FES-CIP4 Homology and B | 100.0 | |
| cd07648 | 261 | F-BAR_FCHO The F-BAR (FES-CIP4 Homology and Bin/Am | 100.0 | |
| cd07674 | 261 | F-BAR_FCHO1 The F-BAR (FES-CIP4 Homology and Bin/A | 100.0 | |
| cd07657 | 237 | F-BAR_Fes_Fer The F-BAR (FES-CIP4 Homology and Bin | 100.0 | |
| cd07655 | 258 | F-BAR_PACSIN The F-BAR (FES-CIP4 Homology and Bin/ | 100.0 | |
| cd07680 | 258 | F-BAR_PACSIN1 The F-BAR (FES-CIP4 Homology and Bin | 100.0 | |
| cd07647 | 239 | F-BAR_PSTPIP The F-BAR (FES-CIP4 Homology and Bin/ | 100.0 | |
| cd07651 | 236 | F-BAR_PombeCdc15_like The F-BAR (FES-CIP4 Homology | 100.0 | |
| cd07672 | 240 | F-BAR_PSTPIP2 The F-BAR (FES-CIP4 Homology and Bin | 100.0 | |
| cd07671 | 242 | F-BAR_PSTPIP1 The F-BAR (FES-CIP4 Homology and Bin | 100.0 | |
| cd07686 | 234 | F-BAR_Fer The F-BAR (FES-CIP4 Homology and Bin/Amp | 100.0 | |
| cd07654 | 264 | F-BAR_FCHSD The F-BAR (FES-CIP4 Homology and Bin/A | 100.0 | |
| cd07679 | 258 | F-BAR_PACSIN2 The F-BAR (FES-CIP4 Homology and Bin | 100.0 | |
| cd07681 | 258 | F-BAR_PACSIN3 The F-BAR (FES-CIP4 Homology and Bin | 100.0 | |
| cd07656 | 241 | F-BAR_srGAP The F-BAR (FES-CIP4 Homology and Bin/A | 100.0 | |
| cd07658 | 239 | F-BAR_NOSTRIN The F-BAR (FES-CIP4 Homology and Bin | 100.0 | |
| cd07678 | 263 | F-BAR_FCHSD1 The F-BAR (FES-CIP4 Homology and Bin/ | 100.0 | |
| cd07649 | 233 | F-BAR_GAS7 The F-BAR (FES-CIP4 Homology and Bin/Am | 100.0 | |
| KOG4429|consensus | 421 | 100.0 | ||
| cd07652 | 234 | F-BAR_Rgd1 The F-BAR (FES-CIP4 Homology and Bin/Am | 99.97 | |
| cd07677 | 260 | F-BAR_FCHSD2 The F-BAR (FES-CIP4 Homology and Bin/ | 99.96 | |
| cd07685 | 237 | F-BAR_Fes The F-BAR (FES-CIP4 Homology and Bin/Amp | 99.95 | |
| cd07650 | 228 | F-BAR_Syp1p_like The F-BAR (FES-CIP4 Homology and | 99.94 | |
| cd07610 | 191 | FCH_F-BAR The Extended FES-CIP4 Homology (FCH) or | 99.94 | |
| cd07684 | 253 | F-BAR_srGAP3 The F-BAR (FES-CIP4 Homology and Bin/ | 99.94 | |
| cd07682 | 263 | F-BAR_srGAP2 The F-BAR (FES-CIP4 Homology and Bin/ | 99.93 | |
| cd07683 | 253 | F-BAR_srGAP1 The F-BAR (FES-CIP4 Homology and Bin/ | 99.93 | |
| KOG2398|consensus | 611 | 99.86 | ||
| PF00611 | 91 | FCH: Fes/CIP4, and EFC/F-BAR homology domain; Inte | 99.62 | |
| smart00055 | 87 | FCH Fes/CIP4 homology domain. Alignment extended f | 99.55 | |
| PF14604 | 49 | SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3 | 99.37 | |
| PF00018 | 48 | SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Ho | 99.23 | |
| PF07653 | 55 | SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 | 99.15 | |
| KOG1029|consensus | 1118 | 99.15 | ||
| smart00326 | 58 | SH3 Src homology 3 domains. Src homology 3 (SH3) d | 99.01 | |
| cd00174 | 54 | SH3 Src homology 3 domains; SH3 domains bind to pr | 98.99 | |
| KOG1118|consensus | 366 | 98.98 | ||
| KOG0162|consensus | 1106 | 98.89 | ||
| KOG2199|consensus | 462 | 98.89 | ||
| cd00089 | 72 | HR1 Protein kinase C-related kinase homology regio | 98.77 | |
| KOG4226|consensus | 379 | 98.68 | ||
| KOG1029|consensus | 1118 | 98.64 | ||
| KOG0515|consensus | 752 | 98.63 | ||
| KOG2070|consensus | 661 | 98.61 | ||
| KOG4226|consensus | 379 | 98.53 | ||
| KOG4348|consensus | 627 | 98.52 | ||
| KOG4225|consensus | 489 | 98.49 | ||
| KOG3771|consensus | 460 | 98.48 | ||
| KOG2996|consensus | 865 | 98.45 | ||
| KOG3875|consensus | 362 | 98.32 | ||
| KOG4792|consensus | 293 | 98.27 | ||
| cd07307 | 194 | BAR The Bin/Amphiphysin/Rvs (BAR) domain, a dimeri | 98.24 | |
| KOG1264|consensus | 1267 | 98.14 | ||
| cd07598 | 211 | BAR_FAM92 The Bin/Amphiphysin/Rvs (BAR) domain of | 98.14 | |
| KOG3655|consensus | 484 | 98.04 | ||
| cd07675 | 252 | F-BAR_FNBP1L The F-BAR (FES-CIP4 Homology and Bin/ | 97.99 | |
| KOG4348|consensus | 627 | 97.96 | ||
| cd07602 | 207 | BAR_RhoGAP_OPHN1-like The Bin/Amphiphysin/Rvs (BAR | 97.92 | |
| KOG4278|consensus | 1157 | 97.87 | ||
| PF06730 | 219 | FAM92: FAM92 protein; InterPro: IPR009602 This fam | 97.85 | |
| cd07635 | 207 | BAR_GRAF2 The Bin/Amphiphysin/Rvs (BAR) domain of | 97.79 | |
| KOG4225|consensus | 489 | 97.79 | ||
| KOG1843|consensus | 473 | 97.78 | ||
| KOG3557|consensus | 721 | 97.75 | ||
| KOG2546|consensus | 483 | 97.73 | ||
| PF09325 | 236 | Vps5: Vps5 C terminal like; InterPro: IPR015404 Vp | 97.72 | |
| cd07636 | 207 | BAR_GRAF The Bin/Amphiphysin/Rvs (BAR) domain of G | 97.72 | |
| cd07603 | 200 | BAR_ACAPs The Bin/Amphiphysin/Rvs (BAR) domain of | 97.67 | |
| cd07639 | 200 | BAR_ACAP1 The Bin/Amphiphysin/Rvs (BAR) domain of | 97.67 | |
| cd07634 | 207 | BAR_GAP10-like The Bin/Amphiphysin/Rvs (BAR) domai | 97.66 | |
| cd07606 | 202 | BAR_SFC_plant The Bin/Amphiphysin/Rvs (BAR) domain | 97.61 | |
| KOG1702|consensus | 264 | 97.58 | ||
| cd07596 | 218 | BAR_SNX The Bin/Amphiphysin/Rvs (BAR) domain of So | 97.57 | |
| cd07680 | 258 | F-BAR_PACSIN1 The F-BAR (FES-CIP4 Homology and Bin | 97.55 | |
| cd07657 | 237 | F-BAR_Fes_Fer The F-BAR (FES-CIP4 Homology and Bin | 97.52 | |
| KOG0197|consensus | 468 | 97.51 | ||
| KOG2528|consensus | 490 | 97.5 | ||
| cd07604 | 215 | BAR_ASAPs The Bin/Amphiphysin/Rvs (BAR) domain of | 97.45 | |
| cd07641 | 215 | BAR_ASAP1 The Bin/Amphiphysin/Rvs (BAR) domain of | 97.43 | |
| cd07601 | 215 | BAR_APPL The Bin/Amphiphysin/Rvs (BAR) domain of A | 97.42 | |
| cd07633 | 207 | BAR_OPHN1 The Bin/Amphiphysin/Rvs (BAR) domain of | 97.32 | |
| PF03114 | 229 | BAR: BAR domain; InterPro: IPR004148 Endocytosis a | 97.27 | |
| cd07676 | 253 | F-BAR_FBP17 The F-BAR (FES-CIP4 Homology and Bin/A | 97.25 | |
| KOG3601|consensus | 222 | 97.22 | ||
| cd07638 | 200 | BAR_ACAP2 The Bin/Amphiphysin/Rvs (BAR) domain of | 97.2 | |
| cd07627 | 216 | BAR_Vps5p The Bin/Amphiphysin/Rvs (BAR) domain of | 97.11 | |
| cd07588 | 211 | BAR_Amphiphysin The Bin/Amphiphysin/Rvs (BAR) doma | 97.11 | |
| PF02185 | 70 | HR1: Hr1 repeat; InterPro: IPR000861 The HR1 repea | 97.07 | |
| cd07653 | 251 | F-BAR_CIP4-like The F-BAR (FES-CIP4 Homology and B | 97.01 | |
| cd07625 | 230 | BAR_Vps17p The Bin/Amphiphysin/Rvs (BAR) domain of | 96.93 | |
| KOG3601|consensus | 222 | 96.85 | ||
| KOG3632|consensus | 1335 | 96.75 | ||
| cd07637 | 200 | BAR_ACAP3 The Bin/Amphiphysin/Rvs (BAR) domain of | 96.68 | |
| cd07623 | 224 | BAR_SNX1_2 The Bin/Amphiphysin/Rvs (BAR) domain of | 96.66 | |
| cd07658 | 239 | F-BAR_NOSTRIN The F-BAR (FES-CIP4 Homology and Bin | 96.61 | |
| KOG0996|consensus | 1293 | 96.57 | ||
| cd07686 | 234 | F-BAR_Fer The F-BAR (FES-CIP4 Homology and Bin/Amp | 96.56 | |
| KOG4575|consensus | 874 | 96.48 | ||
| cd07665 | 234 | BAR_SNX1 The Bin/Amphiphysin/Rvs (BAR) domain of S | 96.48 | |
| cd07656 | 241 | F-BAR_srGAP The F-BAR (FES-CIP4 Homology and Bin/A | 96.44 | |
| KOG3725|consensus | 375 | 96.44 | ||
| cd07590 | 225 | BAR_Bin3 The Bin/Amphiphysin/Rvs (BAR) domain of B | 96.4 | |
| cd07678 | 263 | F-BAR_FCHSD1 The F-BAR (FES-CIP4 Homology and Bin/ | 96.38 | |
| smart00721 | 239 | BAR BAR domain. | 96.32 | |
| cd07685 | 237 | F-BAR_Fes The F-BAR (FES-CIP4 Homology and Bin/Amp | 96.31 | |
| cd07664 | 234 | BAR_SNX2 The Bin/Amphiphysin/Rvs (BAR) domain of S | 96.31 | |
| PF08397 | 219 | IMD: IRSp53/MIM homology domain; InterPro: IPR0136 | 96.31 | |
| KOG3523|consensus | 695 | 96.26 | ||
| cd07647 | 239 | F-BAR_PSTPIP The F-BAR (FES-CIP4 Homology and Bin/ | 96.13 | |
| cd07631 | 215 | BAR_APPL1 The Bin/Amphiphysin/Rvs (BAR) domain of | 95.7 | |
| PF08239 | 55 | SH3_3: Bacterial SH3 domain; InterPro: IPR013247 S | 95.5 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 95.45 | |
| cd07681 | 258 | F-BAR_PACSIN3 The F-BAR (FES-CIP4 Homology and Bin | 95.39 | |
| PF14603 | 89 | hSH3: Helically-extended SH3 domain; PDB: 1RI9_A. | 95.31 | |
| KOG0609|consensus | 542 | 95.31 | ||
| cd07597 | 246 | BAR_SNX8 The Bin/Amphiphysin/Rvs (BAR) domain of S | 95.25 | |
| KOG3632|consensus | 1335 | 95.25 | ||
| KOG1451|consensus | 812 | 95.19 | ||
| cd07595 | 244 | BAR_RhoGAP_Rich-like The Bin/Amphiphysin/Rvs (BAR) | 95.12 | |
| KOG2856|consensus | 472 | 95.12 | ||
| cd07612 | 211 | BAR_Bin2 The Bin/Amphiphysin/Rvs (BAR) domain of B | 95.1 | |
| cd07671 | 242 | F-BAR_PSTPIP1 The F-BAR (FES-CIP4 Homology and Bin | 95.07 | |
| cd07616 | 229 | BAR_Endophilin_B1 The Bin/Amphiphysin/Rvs (BAR) do | 95.04 | |
| cd07662 | 218 | BAR_SNX6 The Bin/Amphiphysin/Rvs (BAR) domain of S | 95.01 | |
| KOG1451|consensus | 812 | 94.98 | ||
| cd07632 | 215 | BAR_APPL2 The Bin/Amphiphysin/Rvs (BAR) domain of | 94.91 | |
| cd07611 | 211 | BAR_Amphiphysin_I_II The Bin/Amphiphysin/Rvs (BAR) | 94.88 | |
| PF06456 | 229 | Arfaptin: Arfaptin-like domain; InterPro: IPR01050 | 94.86 | |
| cd07663 | 218 | BAR_SNX5 The Bin/Amphiphysin/Rvs (BAR) domain of S | 94.63 | |
| cd07679 | 258 | F-BAR_PACSIN2 The F-BAR (FES-CIP4 Homology and Bin | 94.59 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 94.59 | |
| PF14389 | 88 | Lzipper-MIP1: Leucine-zipper of ternary complex fa | 94.58 | |
| KOG2222|consensus | 848 | 94.45 | ||
| smart00742 | 57 | Hr1 Rho effector or protein kinase C-related kinas | 94.29 | |
| cd00011 | 203 | BAR_Arfaptin_like The Bin/Amphiphysin/Rvs (BAR) do | 94.27 | |
| cd07674 | 261 | F-BAR_FCHO1 The F-BAR (FES-CIP4 Homology and Bin/A | 94.12 | |
| cd07593 | 215 | BAR_MUG137_fungi The Bin/Amphiphysin/Rvs (BAR) dom | 94.11 | |
| KOG3775|consensus | 482 | 93.83 | ||
| KOG0521|consensus | 785 | 93.82 | ||
| cd07618 | 246 | BAR_Rich1 The Bin/Amphiphysin/Rvs (BAR) domain of | 93.55 | |
| KOG4773|consensus | 386 | 93.16 | ||
| cd07621 | 219 | BAR_SNX5_6 The Bin/Amphiphysin/Rvs (BAR) domain of | 93.13 | |
| cd07620 | 257 | BAR_SH3BP1 The Bin/Amphiphysin/Rvs (BAR) domain of | 93.03 | |
| cd07642 | 215 | BAR_ASAP2 The Bin/Amphiphysin/Rvs (BAR) domain of | 93.03 | |
| smart00287 | 63 | SH3b Bacterial SH3 domain homologues. | 92.93 | |
| cd07630 | 198 | BAR_SNX_like The Bin/Amphiphysin/Rvs (BAR) domain | 92.88 | |
| KOG4792|consensus | 293 | 92.31 | ||
| cd07614 | 223 | BAR_Endophilin_A2 The Bin/Amphiphysin/Rvs (BAR) do | 92.11 | |
| KOG0040|consensus | 2399 | 92.1 | ||
| cd07624 | 200 | BAR_SNX7_30 The Bin/Amphiphysin/Rvs (BAR) domain o | 92.04 | |
| cd07617 | 220 | BAR_Endophilin_B2 The Bin/Amphiphysin/Rvs (BAR) do | 91.88 | |
| cd07592 | 223 | BAR_Endophilin_A The Bin/Amphiphysin/Rvs (BAR) dom | 91.87 | |
| PRK11637 | 428 | AmiB activator; Provisional | 91.37 | |
| cd07307 | 194 | BAR The Bin/Amphiphysin/Rvs (BAR) domain, a dimeri | 91.35 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 91.25 | |
| cd07660 | 201 | BAR_Arfaptin The Bin/Amphiphysin/Rvs (BAR) domain | 91.15 | |
| cd07640 | 213 | BAR_ASAP3 The Bin/Amphiphysin/Rvs (BAR) domain of | 90.98 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 90.86 | |
| cd07655 | 258 | F-BAR_PACSIN The F-BAR (FES-CIP4 Homology and Bin/ | 90.67 | |
| KOG0161|consensus | 1930 | 89.55 | ||
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 89.55 | |
| cd07677 | 260 | F-BAR_FCHSD2 The F-BAR (FES-CIP4 Homology and Bin/ | 89.49 | |
| cd07619 | 248 | BAR_Rich2 The Bin/Amphiphysin/Rvs (BAR) domain of | 88.55 | |
| cd07648 | 261 | F-BAR_FCHO The F-BAR (FES-CIP4 Homology and Bin/Am | 88.29 | |
| PF10368 | 204 | YkyA: Putative cell-wall binding lipoprotein; Inte | 88.23 | |
| cd07591 | 224 | BAR_Rvs161p The Bin/Amphiphysin/Rvs (BAR) domain o | 87.82 | |
| cd07654 | 264 | F-BAR_FCHSD The F-BAR (FES-CIP4 Homology and Bin/A | 87.8 | |
| cd07613 | 223 | BAR_Endophilin_A1 The Bin/Amphiphysin/Rvs (BAR) do | 87.28 | |
| cd07599 | 216 | BAR_Rvs167p The Bin/Amphiphysin/Rvs (BAR) domain o | 87.15 | |
| cd07591 | 224 | BAR_Rvs161p The Bin/Amphiphysin/Rvs (BAR) domain o | 86.89 | |
| PF03114 | 229 | BAR: BAR domain; InterPro: IPR004148 Endocytosis a | 86.86 | |
| cd07594 | 229 | BAR_Endophilin_B The Bin/Amphiphysin/Rvs (BAR) dom | 86.78 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 86.47 | |
| cd07600 | 242 | BAR_Gvp36 The Bin/Amphiphysin/Rvs (BAR) domain of | 86.29 | |
| KOG0199|consensus | 1039 | 85.5 | ||
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 85.36 | |
| KOG0994|consensus | 1758 | 85.34 | ||
| cd07665 | 234 | BAR_SNX1 The Bin/Amphiphysin/Rvs (BAR) domain of S | 85.01 | |
| KOG0994|consensus | 1758 | 84.99 | ||
| KOG0250|consensus | 1074 | 84.44 | ||
| KOG0933|consensus | 1174 | 83.82 | ||
| cd07672 | 240 | F-BAR_PSTPIP2 The F-BAR (FES-CIP4 Homology and Bin | 83.59 | |
| PF06347 | 55 | SH3_4: Bacterial SH3 domain; InterPro: IPR010466 S | 83.32 | |
| COG3103 | 205 | SH3 domain protein [Signal transduction mechanisms | 83.06 | |
| cd07643 | 231 | I-BAR_IMD_MIM Inverse (I)-BAR, also known as the I | 82.6 | |
| cd07615 | 223 | BAR_Endophilin_A3 The Bin/Amphiphysin/Rvs (BAR) do | 81.78 | |
| KOG2996|consensus | 865 | 81.78 | ||
| cd07651 | 236 | F-BAR_PombeCdc15_like The F-BAR (FES-CIP4 Homology | 81.61 | |
| cd07628 | 185 | BAR_Atg24p The Bin/Amphiphysin/Rvs (BAR) domain of | 81.57 | |
| KOG2129|consensus | 552 | 80.85 | ||
| KOG2398|consensus | 611 | 80.57 | ||
| PF08397 | 219 | IMD: IRSp53/MIM homology domain; InterPro: IPR0136 | 80.03 |
| >cd07675 F-BAR_FNBP1L The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Formin Binding Protein 1-Like | Back alignment and domain information |
|---|
Probab=100.00 E-value=9.7e-46 Score=370.57 Aligned_cols=248 Identities=39% Similarity=0.691 Sum_probs=238.3
Q ss_pred CccchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcCCcc--cccccccHHHHHHHHHHHHHHHHHH
Q psy10868 1 VFQDQYDNLSLHTQKGIDFLEKYGHFIRDRCAIEMEYAGKLRRLVKNYQPKKE--EEDYQYSTCKAFKCVLDEVTDLAGQ 78 (649)
Q Consensus 1 ~L~Dgf~~L~~~~~~gi~~~e~l~~f~keRa~iE~eYAk~L~kLakk~~~~~~--~~~~~~t~~~aw~~ll~e~~~~A~~ 78 (649)
.|||||+.|.+|+.+||+||++|..|++||++||.+||++|++|+++|.+++. +..+.+|.+.+|..+|.+++.+|.+
T Consensus 2 eL~Dqf~~~~k~~~~Gi~~l~~~~~F~keRa~IE~eYakkL~~L~Kky~~KK~~~~e~p~~t~~~s~~~~L~~~~~~a~q 81 (252)
T cd07675 2 ELWDQFDNLDKHTQWGIDFLERYAKFVKERLEIEQNYAKQLRNLVKKYCPKRSSKDEEPRFTSCLSFYNILNELNDYAGQ 81 (252)
T ss_pred chHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhccccCCCCCCccccHHHHHHHHHHHHHHHHHH
Confidence 59999999999999999999999999999999999999999999999998863 2223568889999999999999999
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhHhhhh
Q psy10868 79 HEVIAENLQVFIIKEVTIFVKDFKEERKKHLQDGARMMNLLENQVIALERARKNYDKAYRESDKALEHYKRADADLELSR 158 (649)
Q Consensus 79 H~~lae~L~~~v~~~L~~~~~e~~~~rK~~~~~~~kl~~~l~~~~~~l~k~kk~y~~~~~e~~~a~~~~~ka~~~l~~~r 158 (649)
|+.+|+.|..+|+.+|..+..+++..||.++.++.+++
T Consensus 82 ~e~~a~~l~~~v~~~l~~~~~~l~~~rk~~~~~~~klq------------------------------------------ 119 (252)
T cd07675 82 REVVAEEMGHRVYGELMRYSHDLKGERKMHLQEGRKAQ------------------------------------------ 119 (252)
T ss_pred HHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHH------------------------------------------
Confidence 99999999999999999999999999999999999998
Q ss_pred hhhcccchhHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHhhhhhhcCHHHHHHHHHHHHHHHHHHHHhHHHHHHH
Q psy10868 159 AEHLQDGDHLMKILRNQVDALERALKNYEKAFRDADKALEHYKRADADLELSRAEVEKQRINMAIKSQHCEDTKTEYANQ 238 (649)
Q Consensus 159 ~~~~~~~~~~~k~l~~~~~~l~KaKk~Y~~~~re~e~a~~k~~ka~~d~~~sk~eleK~~~k~~~~~~~~~~ak~eY~~~ 238 (649)
+.|...++.|+++|++|+++|+++|.|+.++.+|++|++.++.+++|+++++..+.+.+++++|+|...
T Consensus 120 -----------k~l~~~~~~leksKk~Y~~acke~E~A~~k~~ka~~d~~~tk~~~eK~k~~~~~~~q~~e~aKn~Y~~~ 188 (252)
T cd07675 120 -----------QYLDMCWKQMDNSKKKFERECREAEKAQQSYERLDNDTNATKSDVEKAKQQLNLRTHMADESKNEYAAQ 188 (252)
T ss_pred -----------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcccCcccCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 888889999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHhHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhcchHHHHHHHHHHH
Q psy10868 239 LQRANEMQRQHYTQAMPEVFAQLQELDEKRVRNIRNFMVHSANIEKKVFPIINQCLDGIIKAA 301 (649)
Q Consensus 239 l~~~N~~q~~~y~~~mp~i~~~lQ~lee~Ri~~lk~~l~~y~~~~~~~~~~~~~~~~~l~~~~ 301 (649)
|+.+|..+..||.++||.+|+.||+|++.|+.+|+++|..++.++..+.|++..|+++|..++
T Consensus 189 L~~~N~~q~k~Y~e~mP~vfd~lQ~leE~Ri~~l~e~~~~~~~~E~~v~~~i~~cl~~~~~~~ 251 (252)
T cd07675 189 LQNFNGEQHKHFYIVIPQIYKQLQEMDERRTVKLSECYRGFADSERKVIPIISKCLEGMVLAA 251 (252)
T ss_pred HHHHHHhhHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHhc
Confidence 999999999999999999999999999999999999999999999999999999999998764
|
F-BAR domains are dimerization modules that bind and bend membranes and are found in proteins involved in membrane dynamics and actin reorganization. FormiN Binding Protein 1-Like (FNBP1L), also known as Toca-1 (Transducer of Cdc42-dependent actin assembly), forms a complex with neural Wiskott-Aldrich syndrome protein (N-WASP). The FNBP1L/N-WASP complex induces the formation of filopodia and endocytic vesicles. FNBP1L is required for Cdc42-induced actin assembly and is essential for autophagy of intracellular pathogens. It contains an N-terminal F-BAR domain, a central Cdc42-binding HR1 domain, and a C-terminal SH3 domain. F-BAR domains form banana-shaped dimers with a positively-charged concave surface that binds to negatively-charged lipid membranes. They can induce membrane deformation in the form of long tubules. |
| >cd07676 F-BAR_FBP17 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Formin Binding Protein 17 | Back alignment and domain information |
|---|
| >KOG3565|consensus | Back alignment and domain information |
|---|
| >KOG2856|consensus | Back alignment and domain information |
|---|
| >cd07673 F-BAR_FCHO2 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of FCH domain Only 2 protein | Back alignment and domain information |
|---|
| >cd07653 F-BAR_CIP4-like The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Cdc42-Interacting Protein 4 and similar proteins | Back alignment and domain information |
|---|
| >cd07648 F-BAR_FCHO The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of FCH domain Only proteins | Back alignment and domain information |
|---|
| >cd07674 F-BAR_FCHO1 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of FCH domain Only 1 protein | Back alignment and domain information |
|---|
| >cd07657 F-BAR_Fes_Fer The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Fes (feline sarcoma) and Fer (Fes related) tyrosine kinases | Back alignment and domain information |
|---|
| >cd07655 F-BAR_PACSIN The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Protein kinase C and Casein kinase Substrate in Neurons (PACSIN) proteins | Back alignment and domain information |
|---|
| >cd07680 F-BAR_PACSIN1 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Protein kinase C and Casein kinase Substrate in Neurons 1 (PACSIN1) | Back alignment and domain information |
|---|
| >cd07647 F-BAR_PSTPIP The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Proline-Serine-Threonine Phosphatase-Interacting Proteins | Back alignment and domain information |
|---|
| >cd07651 F-BAR_PombeCdc15_like The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Schizosaccharomyces pombe Cdc15, and similar proteins | Back alignment and domain information |
|---|
| >cd07672 F-BAR_PSTPIP2 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Proline-Serine-Threonine Phosphatase-Interacting Protein 2 | Back alignment and domain information |
|---|
| >cd07671 F-BAR_PSTPIP1 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Proline-Serine-Threonine Phosphatase-Interacting Protein 1 | Back alignment and domain information |
|---|
| >cd07686 F-BAR_Fer The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Fer (Fes related) tyrosine kinase | Back alignment and domain information |
|---|
| >cd07654 F-BAR_FCHSD The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of FCH and double SH3 domains proteins (FCHSD) | Back alignment and domain information |
|---|
| >cd07679 F-BAR_PACSIN2 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Protein kinase C and Casein kinase Substrate in Neurons 2 (PACSIN2) | Back alignment and domain information |
|---|
| >cd07681 F-BAR_PACSIN3 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Protein kinase C and Casein kinase Substrate in Neurons 3 (PACSIN3) | Back alignment and domain information |
|---|
| >cd07656 F-BAR_srGAP The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Slit-Robo GTPase Activating Proteins | Back alignment and domain information |
|---|
| >cd07658 F-BAR_NOSTRIN The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Nitric Oxide Synthase TRaffic INducer (NOSTRIN) | Back alignment and domain information |
|---|
| >cd07678 F-BAR_FCHSD1 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of FCH and double SH3 domains 1 (FCHSD1) | Back alignment and domain information |
|---|
| >cd07649 F-BAR_GAS7 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Growth Arrest Specific protein 7 | Back alignment and domain information |
|---|
| >KOG4429|consensus | Back alignment and domain information |
|---|
| >cd07652 F-BAR_Rgd1 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Saccharomyces cerevisiae Rho GTPase activating protein Rgd1 and similar proteins | Back alignment and domain information |
|---|
| >cd07677 F-BAR_FCHSD2 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of FCH and double SH3 domains 2 (FCHSD2) | Back alignment and domain information |
|---|
| >cd07685 F-BAR_Fes The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Fes (feline sarcoma) tyrosine kinase | Back alignment and domain information |
|---|
| >cd07650 F-BAR_Syp1p_like The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of yeast Syp1 protein | Back alignment and domain information |
|---|
| >cd07610 FCH_F-BAR The Extended FES-CIP4 Homology (FCH) or F-BAR (FCH and Bin/Amphiphysin/Rvs) domain, a dimerization module that binds and bends membranes | Back alignment and domain information |
|---|
| >cd07684 F-BAR_srGAP3 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Slit-Robo GTPase Activating Protein 3 | Back alignment and domain information |
|---|
| >cd07682 F-BAR_srGAP2 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Slit-Robo GTPase Activating Protein 2 | Back alignment and domain information |
|---|
| >cd07683 F-BAR_srGAP1 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Slit-Robo GTPase Activating Protein 1 | Back alignment and domain information |
|---|
| >KOG2398|consensus | Back alignment and domain information |
|---|
| >PF00611 FCH: Fes/CIP4, and EFC/F-BAR homology domain; InterPro: IPR001060 The FCH domain is a short conserved region of around 60 amino acids first described as a region of homology between FER and CIP4 proteins [] | Back alignment and domain information |
|---|
| >smart00055 FCH Fes/CIP4 homology domain | Back alignment and domain information |
|---|
| >PF14604 SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3_A 2DE0_X 2D8H_A 2DA9_A 2X3X_E 2X3W_D 2KRN_A 2ED0_A | Back alignment and domain information |
|---|
| >PF00018 SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] | Back alignment and domain information |
|---|
| >PF07653 SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] | Back alignment and domain information |
|---|
| >KOG1029|consensus | Back alignment and domain information |
|---|
| >smart00326 SH3 Src homology 3 domains | Back alignment and domain information |
|---|
| >cd00174 SH3 Src homology 3 domains; SH3 domains bind to proline-rich ligands with moderate affinity and selectivity, preferentially to PxxP motifs; they play a role in the regulation of enzymes by intramolecular interactions, changing the subcellular localization of signal pathway components and mediate multiprotein complex assemblies | Back alignment and domain information |
|---|
| >KOG1118|consensus | Back alignment and domain information |
|---|
| >KOG0162|consensus | Back alignment and domain information |
|---|
| >KOG2199|consensus | Back alignment and domain information |
|---|
| >cd00089 HR1 Protein kinase C-related kinase homology region 1 domain; also known as the ACC (antiparallel coiled-coil) finger domain or Rho-binding domain | Back alignment and domain information |
|---|
| >KOG4226|consensus | Back alignment and domain information |
|---|
| >KOG1029|consensus | Back alignment and domain information |
|---|
| >KOG0515|consensus | Back alignment and domain information |
|---|
| >KOG2070|consensus | Back alignment and domain information |
|---|
| >KOG4226|consensus | Back alignment and domain information |
|---|
| >KOG4348|consensus | Back alignment and domain information |
|---|
| >KOG4225|consensus | Back alignment and domain information |
|---|
| >KOG3771|consensus | Back alignment and domain information |
|---|
| >KOG2996|consensus | Back alignment and domain information |
|---|
| >KOG3875|consensus | Back alignment and domain information |
|---|
| >KOG4792|consensus | Back alignment and domain information |
|---|
| >cd07307 BAR The Bin/Amphiphysin/Rvs (BAR) domain, a dimerization module that binds membranes and detects membrane curvature | Back alignment and domain information |
|---|
| >KOG1264|consensus | Back alignment and domain information |
|---|
| >cd07598 BAR_FAM92 The Bin/Amphiphysin/Rvs (BAR) domain of Family with sequence similarity 92 (FAM92) | Back alignment and domain information |
|---|
| >KOG3655|consensus | Back alignment and domain information |
|---|
| >cd07675 F-BAR_FNBP1L The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Formin Binding Protein 1-Like | Back alignment and domain information |
|---|
| >KOG4348|consensus | Back alignment and domain information |
|---|
| >cd07602 BAR_RhoGAP_OPHN1-like The Bin/Amphiphysin/Rvs (BAR) domain of Oligophrenin1-like Rho GTPase Activating Proteins | Back alignment and domain information |
|---|
| >KOG4278|consensus | Back alignment and domain information |
|---|
| >PF06730 FAM92: FAM92 protein; InterPro: IPR009602 This family consists of several eukaryotic sequences of around 270 residues in length | Back alignment and domain information |
|---|
| >cd07635 BAR_GRAF2 The Bin/Amphiphysin/Rvs (BAR) domain of GTPase Regulator Associated with Focal adhesion 2 | Back alignment and domain information |
|---|
| >KOG4225|consensus | Back alignment and domain information |
|---|
| >KOG1843|consensus | Back alignment and domain information |
|---|
| >KOG3557|consensus | Back alignment and domain information |
|---|
| >KOG2546|consensus | Back alignment and domain information |
|---|
| >PF09325 Vps5: Vps5 C terminal like; InterPro: IPR015404 Vps5 is a sorting nexin that functions in membrane trafficking | Back alignment and domain information |
|---|
| >cd07636 BAR_GRAF The Bin/Amphiphysin/Rvs (BAR) domain of GTPase Regulator Associated with Focal adhesion kinase | Back alignment and domain information |
|---|
| >cd07603 BAR_ACAPs The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with Coiled-coil, ANK repeat and PH domain containing proteins | Back alignment and domain information |
|---|
| >cd07639 BAR_ACAP1 The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with Coiled-coil, ANK repeat and PH domain containing protein 1 | Back alignment and domain information |
|---|
| >cd07634 BAR_GAP10-like The Bin/Amphiphysin/Rvs (BAR) domain of Rho GTPase activating protein 10-like | Back alignment and domain information |
|---|
| >cd07606 BAR_SFC_plant The Bin/Amphiphysin/Rvs (BAR) domain of the plant protein SCARFACE (SFC) | Back alignment and domain information |
|---|
| >KOG1702|consensus | Back alignment and domain information |
|---|
| >cd07596 BAR_SNX The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexins | Back alignment and domain information |
|---|
| >cd07680 F-BAR_PACSIN1 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Protein kinase C and Casein kinase Substrate in Neurons 1 (PACSIN1) | Back alignment and domain information |
|---|
| >cd07657 F-BAR_Fes_Fer The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Fes (feline sarcoma) and Fer (Fes related) tyrosine kinases | Back alignment and domain information |
|---|
| >KOG0197|consensus | Back alignment and domain information |
|---|
| >KOG2528|consensus | Back alignment and domain information |
|---|
| >cd07604 BAR_ASAPs The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with SH3 domain, ANK repeat and PH domain containing proteins | Back alignment and domain information |
|---|
| >cd07641 BAR_ASAP1 The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with SH3 domain, ANK repeat and PH domain containing protein 1 | Back alignment and domain information |
|---|
| >cd07601 BAR_APPL The Bin/Amphiphysin/Rvs (BAR) domain of Adaptor protein, Phosphotyrosine interaction, PH domain and Leucine zipper containing proteins | Back alignment and domain information |
|---|
| >cd07633 BAR_OPHN1 The Bin/Amphiphysin/Rvs (BAR) domain of Oligophrenin-1 | Back alignment and domain information |
|---|
| >PF03114 BAR: BAR domain; InterPro: IPR004148 Endocytosis and intracellular transport involve several mechanistic steps: (1) for the internalisation of cargo molecules, the membrane needs to bend to form a vesicular structure, which requires membrane curvature and a rearrangement of the cytoskeleton; (2) following its formation, the vesicle has to be pinched off the membrane; (3) the cargo has to be subsequently transported through the cell and the vesicle must fuse with the correct cellular compartment | Back alignment and domain information |
|---|
| >cd07676 F-BAR_FBP17 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Formin Binding Protein 17 | Back alignment and domain information |
|---|
| >KOG3601|consensus | Back alignment and domain information |
|---|
| >cd07638 BAR_ACAP2 The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with Coiled-coil, ANK repeat and PH domain containing protein 2 | Back alignment and domain information |
|---|
| >cd07627 BAR_Vps5p The Bin/Amphiphysin/Rvs (BAR) domain of yeast Sorting Nexin Vps5p | Back alignment and domain information |
|---|
| >cd07588 BAR_Amphiphysin The Bin/Amphiphysin/Rvs (BAR) domain of Amphiphysins | Back alignment and domain information |
|---|
| >PF02185 HR1: Hr1 repeat; InterPro: IPR000861 The HR1 repeat was first described as a three times repeated homology region of the N-terminal non-catalytic part of protein kinase PRK1(PKN) [] | Back alignment and domain information |
|---|
| >cd07653 F-BAR_CIP4-like The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Cdc42-Interacting Protein 4 and similar proteins | Back alignment and domain information |
|---|
| >cd07625 BAR_Vps17p The Bin/Amphiphysin/Rvs (BAR) domain of yeast Sorting Nexin Vps17p | Back alignment and domain information |
|---|
| >KOG3601|consensus | Back alignment and domain information |
|---|
| >KOG3632|consensus | Back alignment and domain information |
|---|
| >cd07637 BAR_ACAP3 The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with Coiled-coil, ANK repeat and PH domain containing protein 3 | Back alignment and domain information |
|---|
| >cd07623 BAR_SNX1_2 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexins 1 and 2 | Back alignment and domain information |
|---|
| >cd07658 F-BAR_NOSTRIN The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Nitric Oxide Synthase TRaffic INducer (NOSTRIN) | Back alignment and domain information |
|---|
| >KOG0996|consensus | Back alignment and domain information |
|---|
| >cd07686 F-BAR_Fer The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Fer (Fes related) tyrosine kinase | Back alignment and domain information |
|---|
| >KOG4575|consensus | Back alignment and domain information |
|---|
| >cd07665 BAR_SNX1 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 1 | Back alignment and domain information |
|---|
| >cd07656 F-BAR_srGAP The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Slit-Robo GTPase Activating Proteins | Back alignment and domain information |
|---|
| >KOG3725|consensus | Back alignment and domain information |
|---|
| >cd07590 BAR_Bin3 The Bin/Amphiphysin/Rvs (BAR) domain of Bridging integrator 3 | Back alignment and domain information |
|---|
| >cd07678 F-BAR_FCHSD1 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of FCH and double SH3 domains 1 (FCHSD1) | Back alignment and domain information |
|---|
| >smart00721 BAR BAR domain | Back alignment and domain information |
|---|
| >cd07685 F-BAR_Fes The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Fes (feline sarcoma) tyrosine kinase | Back alignment and domain information |
|---|
| >cd07664 BAR_SNX2 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 2 | Back alignment and domain information |
|---|
| >PF08397 IMD: IRSp53/MIM homology domain; InterPro: IPR013606 The IMD (IRSp53 and MIM (missing in metastases) homology) domain is a BAR-like domain of approximately 250 amino acids found at the N-terminal in the insulin receptor tyrosine kinase substrate p53 (IRSp53) and in the evolutionarily related IRSp53/MIM family | Back alignment and domain information |
|---|
| >KOG3523|consensus | Back alignment and domain information |
|---|
| >cd07647 F-BAR_PSTPIP The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Proline-Serine-Threonine Phosphatase-Interacting Proteins | Back alignment and domain information |
|---|
| >cd07631 BAR_APPL1 The Bin/Amphiphysin/Rvs (BAR) domain of Adaptor protein, Phosphotyrosine interaction, PH domain and Leucine zipper containing 1 | Back alignment and domain information |
|---|
| >PF08239 SH3_3: Bacterial SH3 domain; InterPro: IPR013247 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >cd07681 F-BAR_PACSIN3 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Protein kinase C and Casein kinase Substrate in Neurons 3 (PACSIN3) | Back alignment and domain information |
|---|
| >PF14603 hSH3: Helically-extended SH3 domain; PDB: 1RI9_A | Back alignment and domain information |
|---|
| >KOG0609|consensus | Back alignment and domain information |
|---|
| >cd07597 BAR_SNX8 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 8 | Back alignment and domain information |
|---|
| >KOG3632|consensus | Back alignment and domain information |
|---|
| >KOG1451|consensus | Back alignment and domain information |
|---|
| >cd07595 BAR_RhoGAP_Rich-like The Bin/Amphiphysin/Rvs (BAR) domain of Rich-like Rho GTPase Activating Proteins | Back alignment and domain information |
|---|
| >KOG2856|consensus | Back alignment and domain information |
|---|
| >cd07612 BAR_Bin2 The Bin/Amphiphysin/Rvs (BAR) domain of Bridging integrator 2 | Back alignment and domain information |
|---|
| >cd07671 F-BAR_PSTPIP1 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Proline-Serine-Threonine Phosphatase-Interacting Protein 1 | Back alignment and domain information |
|---|
| >cd07616 BAR_Endophilin_B1 The Bin/Amphiphysin/Rvs (BAR) domain of Endophilin-B1 | Back alignment and domain information |
|---|
| >cd07662 BAR_SNX6 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 6 | Back alignment and domain information |
|---|
| >KOG1451|consensus | Back alignment and domain information |
|---|
| >cd07632 BAR_APPL2 The Bin/Amphiphysin/Rvs (BAR) domain of Adaptor protein, Phosphotyrosine interaction, PH domain and Leucine zipper containing 2 | Back alignment and domain information |
|---|
| >cd07611 BAR_Amphiphysin_I_II The Bin/Amphiphysin/Rvs (BAR) domain of Amphiphysin I and II | Back alignment and domain information |
|---|
| >PF06456 Arfaptin: Arfaptin-like domain; InterPro: IPR010504 Arfaptin interacts with ARF1, a small GTPase involved in vesicle budding at the Golgi complex and immature secretory granules | Back alignment and domain information |
|---|
| >cd07663 BAR_SNX5 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 5 | Back alignment and domain information |
|---|
| >cd07679 F-BAR_PACSIN2 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Protein kinase C and Casein kinase Substrate in Neurons 2 (PACSIN2) | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF14389 Lzipper-MIP1: Leucine-zipper of ternary complex factor MIP1 | Back alignment and domain information |
|---|
| >KOG2222|consensus | Back alignment and domain information |
|---|
| >smart00742 Hr1 Rho effector or protein kinase C-related kinase homology region 1 homologues | Back alignment and domain information |
|---|
| >cd00011 BAR_Arfaptin_like The Bin/Amphiphysin/Rvs (BAR) domain of Arfaptin-like proteins, a dimerization module that binds and bends membranes | Back alignment and domain information |
|---|
| >cd07674 F-BAR_FCHO1 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of FCH domain Only 1 protein | Back alignment and domain information |
|---|
| >cd07593 BAR_MUG137_fungi The Bin/Amphiphysin/Rvs (BAR) domain of Schizosaccharomyces pombe Meiotically Up-regulated Gene 137 protein and similar proteins | Back alignment and domain information |
|---|
| >KOG3775|consensus | Back alignment and domain information |
|---|
| >KOG0521|consensus | Back alignment and domain information |
|---|
| >cd07618 BAR_Rich1 The Bin/Amphiphysin/Rvs (BAR) domain of RhoGAP interacting with CIP4 homologs protein 1 | Back alignment and domain information |
|---|
| >KOG4773|consensus | Back alignment and domain information |
|---|
| >cd07621 BAR_SNX5_6 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexins 5 and 6 | Back alignment and domain information |
|---|
| >cd07620 BAR_SH3BP1 The Bin/Amphiphysin/Rvs (BAR) domain of SH3-domain Binding Protein 1 | Back alignment and domain information |
|---|
| >cd07642 BAR_ASAP2 The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with SH3 domain, ANK repeat and PH domain containing protein 2 | Back alignment and domain information |
|---|
| >smart00287 SH3b Bacterial SH3 domain homologues | Back alignment and domain information |
|---|
| >cd07630 BAR_SNX_like The Bin/Amphiphysin/Rvs (BAR) domain of uncharacterized Sorting Nexins | Back alignment and domain information |
|---|
| >KOG4792|consensus | Back alignment and domain information |
|---|
| >cd07614 BAR_Endophilin_A2 The Bin/Amphiphysin/Rvs (BAR) domain of Endophilin-A2 | Back alignment and domain information |
|---|
| >KOG0040|consensus | Back alignment and domain information |
|---|
| >cd07624 BAR_SNX7_30 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexins 7 and 30 | Back alignment and domain information |
|---|
| >cd07617 BAR_Endophilin_B2 The Bin/Amphiphysin/Rvs (BAR) domain of Endophilin-B2 | Back alignment and domain information |
|---|
| >cd07592 BAR_Endophilin_A The Bin/Amphiphysin/Rvs (BAR) domain of Endophilin-A | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >cd07307 BAR The Bin/Amphiphysin/Rvs (BAR) domain, a dimerization module that binds membranes and detects membrane curvature | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >cd07660 BAR_Arfaptin The Bin/Amphiphysin/Rvs (BAR) domain of Arfaptin | Back alignment and domain information |
|---|
| >cd07640 BAR_ASAP3 The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with SH3 domain, ANK repeat and PH domain containing protein 3 | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >cd07655 F-BAR_PACSIN The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Protein kinase C and Casein kinase Substrate in Neurons (PACSIN) proteins | Back alignment and domain information |
|---|
| >KOG0161|consensus | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >cd07677 F-BAR_FCHSD2 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of FCH and double SH3 domains 2 (FCHSD2) | Back alignment and domain information |
|---|
| >cd07619 BAR_Rich2 The Bin/Amphiphysin/Rvs (BAR) domain of RhoGAP interacting with CIP4 homologs protein 2 | Back alignment and domain information |
|---|
| >cd07648 F-BAR_FCHO The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of FCH domain Only proteins | Back alignment and domain information |
|---|
| >PF10368 YkyA: Putative cell-wall binding lipoprotein; InterPro: IPR019454 The YkyA family of proteins contain a lipoprotein signal and a hydrolase domain | Back alignment and domain information |
|---|
| >cd07591 BAR_Rvs161p The Bin/Amphiphysin/Rvs (BAR) domain of Saccharomyces cerevisiae Reduced viability upon starvation protein 161 and similar proteins | Back alignment and domain information |
|---|
| >cd07654 F-BAR_FCHSD The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of FCH and double SH3 domains proteins (FCHSD) | Back alignment and domain information |
|---|
| >cd07613 BAR_Endophilin_A1 The Bin/Amphiphysin/Rvs (BAR) domain of Endophilin-A1 | Back alignment and domain information |
|---|
| >cd07599 BAR_Rvs167p The Bin/Amphiphysin/Rvs (BAR) domain of Saccharomyces cerevisiae Reduced viability upon starvation protein 167 and similar proteins | Back alignment and domain information |
|---|
| >cd07591 BAR_Rvs161p The Bin/Amphiphysin/Rvs (BAR) domain of Saccharomyces cerevisiae Reduced viability upon starvation protein 161 and similar proteins | Back alignment and domain information |
|---|
| >PF03114 BAR: BAR domain; InterPro: IPR004148 Endocytosis and intracellular transport involve several mechanistic steps: (1) for the internalisation of cargo molecules, the membrane needs to bend to form a vesicular structure, which requires membrane curvature and a rearrangement of the cytoskeleton; (2) following its formation, the vesicle has to be pinched off the membrane; (3) the cargo has to be subsequently transported through the cell and the vesicle must fuse with the correct cellular compartment | Back alignment and domain information |
|---|
| >cd07594 BAR_Endophilin_B The Bin/Amphiphysin/Rvs (BAR) domain of Endophilin-B | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >cd07600 BAR_Gvp36 The Bin/Amphiphysin/Rvs (BAR) domain of Saccharomyces cerevisiae Golgi vesicle protein of 36 kDa and similar proteins | Back alignment and domain information |
|---|
| >KOG0199|consensus | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >KOG0994|consensus | Back alignment and domain information |
|---|
| >cd07665 BAR_SNX1 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 1 | Back alignment and domain information |
|---|
| >KOG0994|consensus | Back alignment and domain information |
|---|
| >KOG0250|consensus | Back alignment and domain information |
|---|
| >KOG0933|consensus | Back alignment and domain information |
|---|
| >cd07672 F-BAR_PSTPIP2 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Proline-Serine-Threonine Phosphatase-Interacting Protein 2 | Back alignment and domain information |
|---|
| >PF06347 SH3_4: Bacterial SH3 domain; InterPro: IPR010466 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] | Back alignment and domain information |
|---|
| >COG3103 SH3 domain protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd07643 I-BAR_IMD_MIM Inverse (I)-BAR, also known as the IRSp53/MIM homology Domain (IMD), of Missing In Metastasis | Back alignment and domain information |
|---|
| >cd07615 BAR_Endophilin_A3 The Bin/Amphiphysin/Rvs (BAR) domain of Endophilin-A3 | Back alignment and domain information |
|---|
| >KOG2996|consensus | Back alignment and domain information |
|---|
| >cd07651 F-BAR_PombeCdc15_like The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Schizosaccharomyces pombe Cdc15, and similar proteins | Back alignment and domain information |
|---|
| >cd07628 BAR_Atg24p The Bin/Amphiphysin/Rvs (BAR) domain of yeast Sorting Nexin Atg24p | Back alignment and domain information |
|---|
| >KOG2129|consensus | Back alignment and domain information |
|---|
| >KOG2398|consensus | Back alignment and domain information |
|---|
| >PF08397 IMD: IRSp53/MIM homology domain; InterPro: IPR013606 The IMD (IRSp53 and MIM (missing in metastases) homology) domain is a BAR-like domain of approximately 250 amino acids found at the N-terminal in the insulin receptor tyrosine kinase substrate p53 (IRSp53) and in the evolutionarily related IRSp53/MIM family | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 649 | ||||
| 2efl_A | 305 | Crystal Structure Of The Efc Domain Of Formin-bindi | 1e-57 | ||
| 2efk_A | 301 | Crystal Structure Of The Efc Domain Of Cdc42-Intera | 2e-44 | ||
| 2ke4_A | 98 | The Nmr Structure Of The Tc10 And Cdc42 Interacting | 2e-13 | ||
| 2ct4_A | 70 | Solution Strutcure Of The Sh3 Domain Of The Cdc42- | 2e-11 | ||
| 1zuu_A | 58 | Crystal Structure Of The Yeast Bzz1 First Sh3 Domai | 1e-04 | ||
| 3h0h_A | 73 | Human Fyn Sh3 Domain R96i Mutant, Crystal Form I Le | 3e-04 | ||
| 3h0f_A | 73 | Crystal Structure Of The Human Fyn Sh3 R96w Mutant | 5e-04 | ||
| 4d8d_A | 58 | Crystal Structure Of Hiv-1 Nef Fyn-sh3 R96w Variant | 6e-04 | ||
| 3ua6_A | 64 | Crystal Structure Of The Human Fyn Sh3 Domain Lengt | 6e-04 | ||
| 1fyn_A | 62 | Phosphotransferase Length = 62 | 7e-04 | ||
| 2l2p_A | 66 | Folding Intermediate Of The Fyn Sh3 A39vN53PV55L FR | 8e-04 | ||
| 1efn_A | 59 | Hiv-1 Nef Protein In Complex With R96i Mutant Fyn S | 8e-04 | ||
| 1m27_C | 61 | Crystal Structure Of SapFYNSH3SLAM TERNARY COMPLEX | 8e-04 |
| >pdb|2EFL|A Chain A, Crystal Structure Of The Efc Domain Of Formin-binding Protein 17 Length = 305 | Back alignment and structure |
|
| >pdb|2EFK|A Chain A, Crystal Structure Of The Efc Domain Of Cdc42-Interacting Protein 4 Length = 301 | Back alignment and structure |
| >pdb|2KE4|A Chain A, The Nmr Structure Of The Tc10 And Cdc42 Interacting Domain Of Cip4 Length = 98 | Back alignment and structure |
| >pdb|2CT4|A Chain A, Solution Strutcure Of The Sh3 Domain Of The Cdc42- Interacting Protein 4 Length = 70 | Back alignment and structure |
| >pdb|1ZUU|A Chain A, Crystal Structure Of The Yeast Bzz1 First Sh3 Domain At 0.97-A Resolution Length = 58 | Back alignment and structure |
| >pdb|3H0H|A Chain A, Human Fyn Sh3 Domain R96i Mutant, Crystal Form I Length = 73 | Back alignment and structure |
| >pdb|3H0F|A Chain A, Crystal Structure Of The Human Fyn Sh3 R96w Mutant Length = 73 | Back alignment and structure |
| >pdb|4D8D|A Chain A, Crystal Structure Of Hiv-1 Nef Fyn-sh3 R96w Variant Length = 58 | Back alignment and structure |
| >pdb|3UA6|A Chain A, Crystal Structure Of The Human Fyn Sh3 Domain Length = 64 | Back alignment and structure |
| >pdb|1FYN|A Chain A, Phosphotransferase Length = 62 | Back alignment and structure |
| >pdb|2L2P|A Chain A, Folding Intermediate Of The Fyn Sh3 A39vN53PV55L FROM NMR RELAXATION Dispersion Experiments Length = 66 | Back alignment and structure |
| >pdb|1EFN|A Chain A, Hiv-1 Nef Protein In Complex With R96i Mutant Fyn Sh3 Domain Length = 59 | Back alignment and structure |
| >pdb|1M27|C Chain C, Crystal Structure Of SapFYNSH3SLAM TERNARY COMPLEX Length = 61 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >2efl_A Formin-binding protein 1; EFC domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.61A {Homo sapiens} SCOP: a.238.1.4 Length = 305 | Back alignment and structure |
|---|
Score = 198 bits (505), Expect = 1e-58
Identities = 128/342 (37%), Positives = 198/342 (57%), Gaps = 56/342 (16%)
Query: 2 FQDQYDNLSLHTQKGIDFLEKYGHFIRDRCAIEMEYAGKLRRLVKNYQPK---KEEEDYQ 58
DQ+DNL HTQ GID LEKY F+++R IE+ YA +LR L K YQPK KEEE+Y+
Sbjct: 12 LWDQFDNLEKHTQWGIDILEKYIKFVKERTEIELSYAKQLRNLSKKYQPKKNSKEEEEYK 71
Query: 59 YSTCKAFKCVLDEVTDLAGQHEVIAENLQVFIIKEVTIFVKDFKEERKKHLQDGARMMNL 118
Y++CKAF L+E+ D AGQHEVI+EN+ II ++ +V++ K+ERK + DG +
Sbjct: 72 YTSCKAFISNLNEMNDYAGQHEVISENMASQIIVDLARYVQELKQERKSNFHDGRKAQQH 131
Query: 119 LENQVIALERARKNYDKAYRESDKALEHYKRADADLELSRAEHLQDGDHLMKILRNQVDA 178
+E LE +++ +++ +E
Sbjct: 132 IETCWKQLESSKRRFERDCKE--------------------------------------- 152
Query: 179 LERALKNYEKAFRDADKALEHYKRADADLELSRAEVEKQRINMAIKSQHCEDTKTEYANQ 238
AD+A +++++ DAD+ +++A+VEK R I+ Q ED+K +Y++
Sbjct: 153 --------------ADRAQQYFEKMDADINVTKADVEKARQQAQIRHQMAEDSKADYSSI 198
Query: 239 LQRANEMQRQHYTQAMPEVFAQLQELDEKRVRNIRNFMVHSANIEKKVFPIINQCLDGII 298
LQ+ N Q ++Y +P +F ++QE++E+R+ + M A ++++V PII +CLDGI+
Sbjct: 199 LQKFNHEQHEYYHTHIPNIFQKIQEMEERRIVRMGESMKTYAEVDRQVIPIIGKCLDGIV 258
Query: 299 KAADQINEKEDSALVIERYKSGFTPPGDIPFEDLSRGGESTP 340
KAA+ I++K DS LVIE YKSGF PPGDI FED ++ + T
Sbjct: 259 KAAESIDQKNDSQLVIEAYKSGFEPPGDIEFEDYTQPMKRTV 300
|
| >2efk_A CDC42-interacting protein 4; EFC domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.30A {Homo sapiens} SCOP: a.238.1.4 Length = 301 | Back alignment and structure |
|---|
| >4dyl_A Tyrosine-protein kinase FES/FPS; structural genomics, structural genomics consortium, BCR, CR associated substrate, transferase; 2.18A {Homo sapiens} Length = 406 | Back alignment and structure |
|---|
| >3abh_A Pacsin2, protein kinase C and casein kinase substrate in neurons protein 2; helix bundle, coiled-coil, endocytosis; 2.00A {Homo sapiens} PDB: 3q0k_A 3lll_A 3hah_A 3qni_A 3hai_A 3q84_A Length = 312 | Back alignment and structure |
|---|
| >3i2w_A Syndapin, LD46328P; EFC, FBAR, SH3 domain, endocytosis; 2.67A {Drosophila melanogaster} Length = 290 | Back alignment and structure |
|---|
| >3m3w_A Pacsin3, protein kinase C and casein kinase II substrate P; mouse, BAR domain, endocytosis; 2.60A {Mus musculus} PDB: 3qe6_A Length = 320 | Back alignment and structure |
|---|
| >3aco_A Pacsin2, protein kinase C and casein kinase substrate in neurons protein 2; helix bundle, coiled-coil, endocytosis; 2.70A {Homo sapiens} Length = 350 | Back alignment and structure |
|---|
| >2x3v_A Syndapin I, protein kinase C and casein kinase substrate in N protein 1; BAR, N-WAsp, dynamin, pacsin 1, endocytosis; 2.45A {Mus musculus} PDB: 2x3w_A 2x3x_A Length = 337 | Back alignment and structure |
|---|
| >2v0o_A FCHO2, FCH domain only protein 2; lipid-binding protein, EFC domain, vesicle trafficking, membrane curvature, endocytosis, exocytosis, F-BAR domain; 2.30A {Homo sapiens} Length = 276 | Back alignment and structure |
|---|
| >3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} Length = 486 | Back alignment and structure |
|---|
| >3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} Length = 486 | Back alignment and structure |
|---|
| >2ke4_A CDC42-interacting protein 4; CIP4, TC10, coiled-coil, alternative splicing, cell membrane, coiled coil, cytoplasm, cytoskeleton, endocytosis; NMR {Homo sapiens} Length = 98 | Back alignment and structure |
|---|
| >3qwe_A GMIP, GEM-interacting protein; structural genomics consortium, SGC, protein binding; 2.40A {Homo sapiens} Length = 279 | Back alignment and structure |
|---|
| >1zuu_A BZZ1 protein; SH3 domain, unknown function; 0.97A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 58 | Back alignment and structure |
|---|
| >2ct4_A CDC42-interacting protein 4; thyroid receptor interacting protein 10, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2dl5_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >1x6g_A Megakaryocyte-associated tyrosine-protein kinase; MATK, CTK, HYL, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >2enm_A Sorting nexin-9; SH3-like barrel, protein transport, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 77 | Back alignment and structure |
|---|
| >2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A Length = 60 | Back alignment and structure |
|---|
| >2jt4_A Cytoskeleton assembly control protein SLA1; endocytosis, SH3, actin-binding, cytoplasm, cytoskeleton, phosphorylation, SH3 domain, DNA damage, DNA repair, nucleus; NMR {Saccharomyces cerevisiae} Length = 71 | Back alignment and structure |
|---|
| >1csk_A C-SRC SH3 domain; phosphotransferase; 2.50A {Homo sapiens} SCOP: b.34.2.1 Length = 71 | Back alignment and structure |
|---|
| >2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 | Back alignment and structure |
|---|
| >3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} PDB: 3h0i_A 3h0f_A* Length = 73 | Back alignment and structure |
|---|
| >1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A Length = 58 | Back alignment and structure |
|---|
| >2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} Length = 109 | Back alignment and structure |
|---|
| >1ruw_A Myosin-3 isoform, MYO3; SH3 domain, yeast, high-throughput, structural genomics, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2btt_A 1va7_A Length = 69 | Back alignment and structure |
|---|
| >3g9g_A Suppressor of yeast profilin deletion; SYP1, BAR domain, FCH, adaptor, endocytosis, phosphoprotein; 2.40A {Saccharomyces cerevisiae} Length = 287 | Back alignment and structure |
|---|
| >3g9g_A Suppressor of yeast profilin deletion; SYP1, BAR domain, FCH, adaptor, endocytosis, phosphoprotein; 2.40A {Saccharomyces cerevisiae} Length = 287 | Back alignment and structure |
|---|
| >1i07_A Epidermal growth factor receptor kinase substrate EPS8; hormone/growth factor; 1.80A {Mus musculus} SCOP: b.34.2.1 PDB: 1aoj_A 1i0c_A Length = 60 | Back alignment and structure |
|---|
| >1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A Length = 77 | Back alignment and structure |
|---|
| >2cud_A SRC-like-adapter; SH3 domain, negative mitogenesis regulator, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >1wx6_A Cytoplasmic protein NCK2; SH3 domain, structural genomics, signal transduction, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >2jxb_A T-cell surface glycoprotein CD3 epsilon chain, cytoplasmic protein NCK2; T-cell receptor, SH3 domain, immunology, SH2 domain; NMR {Homo sapiens} Length = 86 | Back alignment and structure |
|---|
| >1wxt_A Hypothetical protein FLJ21522; SH3 domain, EPS8-related protein 3, protein-protein interaction, structural genomics; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A Length = 79 | Back alignment and structure |
|---|
| >2jw4_A Cytoplasmic protein NCK1; SH3 domain, phosphorylation, SH2 domain, signaling protein; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2a28_A BZZ1 protein; SH3 domain, signaling protein; 1.07A {Saccharomyces cerevisiae} Length = 54 | Back alignment and structure |
|---|
| >1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 | Back alignment and structure |
|---|
| >2ega_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2oi3_A Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type tyrosine kinase, transferase; NMR {Homo sapiens} PDB: 2oj2_A 4hck_A 5hck_A Length = 86 | Back alignment and structure |
|---|
| >2b86_A Cytoplasmic protein NCK2; NCK SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2js2_A Length = 67 | Back alignment and structure |
|---|
| >1wxb_A Epidermal growth factor receptor pathway substrate 8-like protein; SH3, EPS8, EPS8L2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Length = 193 | Back alignment and structure |
|---|
| >1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Length = 193 | Back alignment and structure |
|---|
| >2kym_A BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE20P PRR, CDC42P-interacting, S signaling protein; NMR {Lodderomyces elongisporus} Length = 120 | Back alignment and structure |
|---|
| >1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 | Back alignment and structure |
|---|
| >2yup_A Vinexin; sorbin and SH3 domain-containing protein 3, SH3-containing adapter molecule 1, SCAM-1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >3eg3_A Proto-oncogene tyrosine-protein kinase ABL1; beta, ATP-binding, cell adhesion, cytoskeleton, LIPO magnesium, manganese, metal-binding, myristate; 1.40A {Homo sapiens} PDB: 3egu_A 3eg0_A 3eg2_A 3eg1_A 1abo_A 1abq_A 1ju5_C* 2o88_A 1bbz_A 1awo_A Length = 63 | Back alignment and structure |
|---|
| >2lcs_A NAP1-binding protein 2; adaptor, transferase, signaling protein; NMR {Saccharomyces cerevisiae} Length = 73 | Back alignment and structure |
|---|
| >1uhc_A KIAA1010 protein; beta barrel, SH3, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 79 | Back alignment and structure |
|---|
| >2kgt_A Tyrosine-protein kinase 6; SH3 domain, SRC kinase, PTK6, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >1u5s_A Cytoplasmic protein NCK2; protein-protein complex, beta barrel, beta sheet, zinc finger, metal binding protein; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2fry_A Length = 71 | Back alignment and structure |
|---|
| >2k2m_A EPS8-like protein 1; alternative splicing, coiled coil, cytoplasm, SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2rol_A Length = 68 | Back alignment and structure |
|---|
| >1yn8_A NBP2, NAP1-binding protein 2; SH3 domain, unknown function; 1.70A {Saccharomyces cerevisiae} Length = 59 | Back alignment and structure |
|---|
| >3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Length = 308 | Back alignment and structure |
|---|
| >1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 | Back alignment and structure |
|---|
| >1x43_A Endophilin B1, SH3 domain GRB2-like protein B1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 81 | Back alignment and structure |
|---|
| >1aww_A ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linked agammaglobulinemia, XLA, BTK, SH3 domain, transferase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 1awx_A 1qly_A Length = 67 | Back alignment and structure |
|---|
| >1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 | Back alignment and structure |
|---|
| >3reb_B Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain binding, signaling, HCK SH3 domain, PR binding; 3.45A {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >4ag1_C Fynomer; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Synthetic construct} PDB: 4afz_C 4ag2_C* 4afq_C* 4afs_C 4afu_C 1azg_B 1nyf_A 1nyg_A 1a0n_B 1fyn_A 1m27_C* 1shf_A 1zbj_A 1efn_A 1avz_C 1nlo_C* 1nlp_C* 1qwe_A 1qwf_A 1prl_C ... Length = 84 | Back alignment and structure |
|---|
| >2iim_A Proto-oncogene tyrosine-protein kinase LCK; beta-barrels, signaling protein; HET: PG4; 1.00A {Homo sapiens} SCOP: b.34.2.1 PDB: 1h92_A 1kik_A Length = 62 | Back alignment and structure |
|---|
| >2oaw_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.90A {Gallus gallus} PDB: 2rot_A 2rmo_A 2kr3_A Length = 65 | Back alignment and structure |
|---|
| >2o9s_A Ponsin; SH3 domain, signaling protein; 0.83A {Homo sapiens} PDB: 2o31_A 2o9v_A 2o2w_A Length = 67 | Back alignment and structure |
|---|
| >2rqv_A BUD emergence protein 1; BEM1P, SH3, CDC42P, cytoplasm, cytoskeleton, SH3 domain, SIG protein; NMR {Saccharomyces cerevisiae} PDB: 2rqw_A Length = 108 | Back alignment and structure |
|---|
| >1bb9_A Amphiphysin 2; transferase, SH3 domain; 2.20A {Rattus norvegicus} SCOP: b.34.2.1 PDB: 1muz_A 1mv0_B Length = 115 | Back alignment and structure |
|---|
| >1s1n_A Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >1neg_A Spectrin alpha chain, brain; SH3-domain fold, five antiparallel beta sheets, structural protein; 2.30A {Gallus gallus} SCOP: b.34.2.1 Length = 83 | Back alignment and structure |
|---|
| >2j05_A RAS GTPase-activating protein 1; GTPase activation, SH3 domain, SH2 domain, SRC homology 3, RAS signaling pathway, proto- oncogene, phosphorylation; 1.5A {Homo sapiens} PDB: 2j06_A Length = 65 | Back alignment and structure |
|---|
| >1x6b_A RHO guanine exchange factor (GEF) 16; SH3 domain, neuroblastoma, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2rqr_A CED-12 homolog, engulfment and cell motility protein 1, linker, D of cytokinesis protein 2; KIAA0209, KIAA0281, apoptosis, membrane, phagocytosis; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 Length = 67 | Back alignment and structure |
|---|
| >2x3w_D Syndapin I, protein kinase C and casein kinase substrate in N protein 1; endocytosis, N-WAsp, dynamin, pacsin I, transferase; 2.64A {Mus musculus} PDB: 2x3x_D Length = 60 | Back alignment and structure |
|---|
| >2i0n_A Class VII unconventional myosin; beta-sheet loop, structural protein; NMR {Dictyostelium discoideum} Length = 80 | Back alignment and structure |
|---|
| >1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 Length = 65 | Back alignment and structure |
|---|
| >1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A Length = 57 | Back alignment and structure |
|---|
| >2v1r_A Peroxisomal membrane protein PAS20; protein transport, translocation, transmembrane, peptide COM structural genomics, peroxisome; 2.1A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 80 | Back alignment and structure |
|---|
| >2d8j_A FYN-related kinase; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 77 | Back alignment and structure |
|---|
| >2egc_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >1spk_A RSGI RUH-010, riken cDNA 1300006M19; structural genomics, SH3 domain, five-stranded barrel, mouse cDNA; NMR {Mus musculus} SCOP: b.34.2.1 Length = 72 | Back alignment and structure |
|---|
| >1jqq_A PEX13P, peroxisomal membrane protein PAS20, PAS20P, roxin-13; compact beta-barrel of five anti-parrallel beta-strands; 2.65A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1n5z_A Length = 92 | Back alignment and structure |
|---|
| >2kxc_A Brain-specific angiogenesis inhibitor 1-associate 2-like protein 1; IRTKS-SH3, espfu, complex structure, protein binding; NMR {Homo sapiens} Length = 67 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Length = 217 | Back alignment and structure |
|---|
| >2dnu_A RUH-061, SH3 multiple domains 1; RSGI, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >3ngp_A Spectrin alpha chain, brain; beta barrel, structural protein; 1.08A {Gallus gallus} PDB: 1e7o_A 1e6g_A 1e6h_A 1uue_A 1h8k_A 2lj3_A 1aey_A 1m8m_A 1shg_A 1u06_A 2nuz_A 2cdt_A 1hd3_A 2f2v_A 2f2w_A 2jm8_A 2jm9_A 2jma_A 3m0r_A 3m0p_A ... Length = 62 | Back alignment and structure |
|---|
| >1nm7_A Peroxisomal membrane protein PAS20; yeast, PEX5P, PEX14P, PEX13P, import machine, SH3 domain, protein transport; NMR {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 69 | Back alignment and structure |
|---|
| >4f14_A Nebulette; SH3 domain, heart muscle, actin-binding protein-peptide COMP; 1.20A {Homo sapiens} PDB: 1ark_A 1neb_A 3i35_A Length = 64 | Back alignment and structure |
|---|
| >3rnj_A Brain-specific angiogenesis inhibitor 1-associate 2; structural genomics, structural genomics consortium, SGC, BE barrel; HET: EDT; 1.50A {Homo sapiens} Length = 67 | Back alignment and structure |
|---|
| >1u3o_A Huntingtin-associated protein-interacting protein; SH3, CIS-proline,, signaling protein; NMR {Rattus norvegicus} Length = 82 | Back alignment and structure |
|---|
| >2ekh_A SH3 and PX domain-containing protein 2A; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >1jo8_A ABP1P, actin binding protein; SH3 domain actin-binding-protein, structural protein; 1.30A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 2k3b_A 2rpn_A Length = 58 | Back alignment and structure |
|---|
| >1udl_A Intersectin 2, KIAA1256; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 98 | Back alignment and structure |
|---|
| >2ed0_A ABL interactor 2; coiled coil, cytoskeleton, nuclear protein, phosphorylation, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >1gbq_A GRB2; complex (signal transduction/peptide), SH3 domain; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 1gbr_A 2gbq_A 3gbq_A 4gbq_A Length = 74 | Back alignment and structure |
|---|
| >1wie_A RIM binding protein 2; beta barrel, KIAA0318 protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 96 | Back alignment and structure |
|---|
| >2ecz_A Sorbin and SH3 domain-containing protein 1; glycoprotein, membrane, nuclear protein, phosphorylation, polymorphism, transport, structural genomics; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >1x2q_A Signal transducing adapter molecule 2; SH3 domain, signal transducing adaptor molecule, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >1z9q_A Neutrophil cytosol factor 4; oxidoreductase activator; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2vkn_A Protein SSU81; membrane, SH3 domain, transmembrane, membrane; 2.05A {Saccharomyces cerevisiae} Length = 70 | Back alignment and structure |
|---|
| >2e5k_A Suppressor of T-cell receptor signaling 1; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 | Back alignment and structure |
|---|
| >3thk_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.70A {Rattus norvegicus} Length = 73 | Back alignment and structure |
|---|
| >1wxu_A Peroxisomal biogenesis factor 13; SH3 domain, PEX13, protein-protein interaction, structural genomics; NMR {Mus musculus} Length = 93 | Back alignment and structure |
|---|
| >2dil_A Proline-serine-threonine phosphatase-interacting protein 1; SH3 domain, PEST phosphatase-interacting protein 1, CD2- binding protein 1; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >3a98_A DOCK2, dedicator of cytokinesis protein 2; protein-protein complex, DOCK2, ELMO1, SH3 domain, PH domain bundle, proline-rich sequence, cytoskeleton; 2.10A {Homo sapiens} Length = 184 | Back alignment and structure |
|---|
| >2csq_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 97 | Back alignment and structure |
|---|
| >2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} Length = 71 | Back alignment and structure |
|---|
| >2jte_A CD2-associated protein; SH3 domain, coiled coil, cytoplasm, phosphorylation, SH3-binding, signaling protein; NMR {Mus musculus} PDB: 2kro_A Length = 64 | Back alignment and structure |
|---|
| >2epd_A RHO GTPase-activating protein 4; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 76 | Back alignment and structure |
|---|
| >3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Length = 174 | Back alignment and structure |
|---|
| >1ue9_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 80 | Back alignment and structure |
|---|
| >2gnc_A SLIT-ROBO RHO GTPase-activating protein 1; beta barrel, signaling protein; 1.80A {Mus musculus} Length = 60 | Back alignment and structure |
|---|
| >2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* Length = 62 | Back alignment and structure |
|---|
| >1ugv_A KIAA0621, olygophrenin-1 like protein; beta barrel, GRAF protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 72 | Back alignment and structure |
|---|
| >2ct3_A Vinexin; SH3 domian, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2ed1_A 130 kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; GTPase activation, membrane, metal-binding, SH3 domain; NMR {Homo sapiens} PDB: 2rqt_A 2rqu_A Length = 76 | Back alignment and structure |
|---|
| >2dm1_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >2dmo_A Neutrophil cytosol factor 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >1uhf_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 69 | Back alignment and structure |
|---|
| >2cre_A HEF-like protein; SH3 domain, SRC homology 3 domain, beta barrel, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >1x2p_A Protein arginine N-methyltransferase 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >2kxd_A 11-MER peptide, SH3 domain of spectrin alpha CHAI; alpha spectrin SH3 domain, SPC-S19P20S circular permutant, S protein; NMR {Synthetic} Length = 73 | Back alignment and structure |
|---|
| >1uff_A Intersectin 2; beta barrel, SH3 domain, endocytosis, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 93 | Back alignment and structure |
|---|
| >2d8h_A SH3YL1 protein; SH3 domain, hypothetical protein SH3YL1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >2ysq_A RHO guanine nucleotide exchange factor 9; SH3 domain, CDC42 guanine nucleotide exchange factor (GEF) 9, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >2gqi_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >3c0c_A Endophilin-A2; endocytosis, SH3, voltage-gated calcium channel, endosome, L binding, membrane, phosphoprotein, proto-oncogene, SH3 DOMA; 1.70A {Rattus norvegicus} Length = 73 | Back alignment and structure |
|---|
| >1x69_A Cortactin isoform A; SH3 domain, CTTN, oncogene EMS1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >1oot_A Hypothetical 40.4 kDa protein in PES4-His2 intergenic region; SH3 domain, sturctural genomics, structural genomics; 1.39A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1ssh_A 2a08_A Length = 60 | Back alignment and structure |
|---|
| >2j6f_A CD2-associated protein; metal-binding, immune response, SH3, SH2 domain, SH3 zinc-finger, SH3- binding, UBL conjugation pathway; 1.7A {Homo sapiens} PDB: 2j6k_A 2j6o_A 2j7i_A 2krm_A Length = 62 | Back alignment and structure |
|---|
| >2da9_A SH3-domain kinase binding protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 70 | Back alignment and structure |
|---|
| >2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} Length = 341 | Back alignment and structure |
|---|
| >2cuc_A SH3 domain containing ring finger 2; structural genomics, ring finger 2 containing protein, NPPSFA; NMR {Mus musculus} Length = 70 | Back alignment and structure |
|---|
| >3o5z_A Phosphatidylinositol 3-kinase regulatory subunit; SRC homology 3 domain, protein binding; 2.01A {Homo sapiens} PDB: 2kt1_A Length = 90 | Back alignment and structure |
|---|
| >4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* Length = 175 | Back alignment and structure |
|---|
| >2dl8_A SLIT-ROBO RHO GTPase-activating protein 2; SH3 domain, formin-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2dlp_A KIAA1783 protein; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >2dl4_A Protein STAC; SH3 domain, STAC protein, SRC homology 3, cysteine-rich domain protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >2xmf_A Myosin 1E SH3; motor protein, SH3 domain; HET: DIA; 1.50A {Mus musculus} Length = 60 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 649 | |||
| 4dyl_A | 406 | Tyrosine-protein kinase FES/FPS; structural genomi | 100.0 | |
| 3haj_A | 486 | Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, | 100.0 | |
| 2efk_A | 301 | CDC42-interacting protein 4; EFC domain, structura | 100.0 | |
| 2efl_A | 305 | Formin-binding protein 1; EFC domain, structural g | 100.0 | |
| 3m3w_A | 320 | Pacsin3, protein kinase C and casein kinase II sub | 100.0 | |
| 2x3v_A | 337 | Syndapin I, protein kinase C and casein kinase sub | 100.0 | |
| 3aco_A | 350 | Pacsin2, protein kinase C and casein kinase substr | 100.0 | |
| 3abh_A | 312 | Pacsin2, protein kinase C and casein kinase substr | 100.0 | |
| 3i2w_A | 290 | Syndapin, LD46328P; EFC, FBAR, SH3 domain, endocyt | 100.0 | |
| 2v0o_A | 276 | FCHO2, FCH domain only protein 2; lipid-binding pr | 100.0 | |
| 2ke4_A | 98 | CDC42-interacting protein 4; CIP4, TC10, coiled-co | 99.92 | |
| 3g9g_A | 287 | Suppressor of yeast profilin deletion; SYP1, BAR d | 99.91 | |
| 3qwe_A | 279 | GMIP, GEM-interacting protein; structural genomics | 99.91 | |
| 2lx7_A | 60 | GAS-7, growth arrest-specific protein 7; structura | 99.57 | |
| 2ct4_A | 70 | CDC42-interacting protein 4; thyroid receptor inte | 99.53 | |
| 2lj0_A | 65 | Sorbin and SH3 domain-containing protein 1; R85FL, | 99.52 | |
| 2a28_A | 54 | BZZ1 protein; SH3 domain, signaling protein; 1.07A | 99.44 | |
| 2b86_A | 67 | Cytoplasmic protein NCK2; NCK SH3 domain, signalin | 99.43 | |
| 1b07_A | 65 | Protein (proto-oncogene CRK (CRK)); SH3 domain, in | 99.43 | |
| 1zuu_A | 58 | BZZ1 protein; SH3 domain, unknown function; 0.97A | 99.43 | |
| 1nm7_A | 69 | Peroxisomal membrane protein PAS20; yeast, PEX5P, | 99.43 | |
| 2o9s_A | 67 | Ponsin; SH3 domain, signaling protein; 0.83A {Homo | 99.42 | |
| 1u5s_A | 71 | Cytoplasmic protein NCK2; protein-protein complex, | 99.42 | |
| 1jo8_A | 58 | ABP1P, actin binding protein; SH3 domain actin-bin | 99.41 | |
| 2x3w_D | 60 | Syndapin I, protein kinase C and casein kinase sub | 99.41 | |
| 1cka_A | 57 | C-CRK N-terminal SH3 domain; complex (oncogene pro | 99.4 | |
| 1csk_A | 71 | C-SRC SH3 domain; phosphotransferase; 2.50A {Homo | 99.4 | |
| 2g6f_X | 59 | RHO guanine nucleotide exchange factor 7; SH3 doma | 99.4 | |
| 1uti_A | 58 | GRB2-related adaptor protein 2; signaling protein | 99.4 | |
| 2jt4_A | 71 | Cytoskeleton assembly control protein SLA1; endocy | 99.4 | |
| 1oot_A | 60 | Hypothetical 40.4 kDa protein in PES4-His2 interge | 99.39 | |
| 2jte_A | 64 | CD2-associated protein; SH3 domain, coiled coil, c | 99.39 | |
| 1gl5_A | 67 | Tyrosine-protein kinase TEC; transferase, ATP-bind | 99.39 | |
| 2v1q_A | 60 | SLA1, cytoskeleton assembly control protein SLA1; | 99.39 | |
| 2bz8_A | 58 | SH3-domain kinase binding protein 1; SH3 domain, C | 99.39 | |
| 1s1n_A | 68 | Nephrocystin 1; beta barrel, cell adhesion; NMR {H | 99.38 | |
| 2lcs_A | 73 | NAP1-binding protein 2; adaptor, transferase, sign | 99.38 | |
| 1yn8_A | 59 | NBP2, NAP1-binding protein 2; SH3 domain, unknown | 99.38 | |
| 1wxt_A | 68 | Hypothetical protein FLJ21522; SH3 domain, EPS8-re | 99.38 | |
| 2ydl_A | 69 | SH3 domain-containing kinase-binding protein 1; si | 99.38 | |
| 1i07_A | 60 | Epidermal growth factor receptor kinase substrate | 99.37 | |
| 1x2k_A | 68 | OSTF1, osteoclast stimulating factor 1; SH3 domain | 99.37 | |
| 2drm_A | 58 | Acanthamoeba myosin IB; SH3 domain, contractIle pr | 99.37 | |
| 2nwm_A | 65 | Vinexin; cell adhesion; NMR {Homo sapiens} | 99.37 | |
| 2k2m_A | 68 | EPS8-like protein 1; alternative splicing, coiled | 99.37 | |
| 4esr_A | 69 | Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domai | 99.37 | |
| 1x6g_A | 81 | Megakaryocyte-associated tyrosine-protein kinase; | 99.37 | |
| 2fei_A | 65 | CD2-associated protein; CMS SH3 domain, structural | 99.37 | |
| 2gnc_A | 60 | SLIT-ROBO RHO GTPase-activating protein 1; beta ba | 99.37 | |
| 2ebp_A | 73 | SAM and SH3 domain-containing protein 1; proline-g | 99.37 | |
| 1tg0_A | 68 | BBC1 protein, myosin tail region-interacting prote | 99.36 | |
| 1k4u_S | 62 | Phagocyte NADPH oxidase subunit P67PHOX; SH3-pepti | 99.36 | |
| 2dl7_A | 73 | KIAA0769 protein; SH3 domain, FCHSD2, structural g | 99.36 | |
| 2xmf_A | 60 | Myosin 1E SH3; motor protein, SH3 domain; HET: DIA | 99.36 | |
| 1zx6_A | 58 | YPR154WP; SH3 domain, protein binding; 1.60A {Sacc | 99.36 | |
| 2i0n_A | 80 | Class VII unconventional myosin; beta-sheet loop, | 99.36 | |
| 2j6f_A | 62 | CD2-associated protein; metal-binding, immune resp | 99.36 | |
| 2dl5_A | 78 | KIAA0769 protein; SH3 domain, FCHSD2, structural g | 99.36 | |
| 1x2p_A | 68 | Protein arginine N-methyltransferase 2; SH3 domain | 99.36 | |
| 2fpe_A | 62 | C-JUN-amino-terminal kinase interacting protein 1; | 99.36 | |
| 2csi_A | 76 | RIM-BP2, RIM binding protein 2; SH3 domain, struct | 99.36 | |
| 2djq_A | 68 | SH3 domain containing ring finger 2; MUS musculus | 99.35 | |
| 1ugv_A | 72 | KIAA0621, olygophrenin-1 like protein; beta barrel | 99.35 | |
| 2dl4_A | 68 | Protein STAC; SH3 domain, STAC protein, SRC homolo | 99.35 | |
| 3cqt_A | 79 | P59-FYN, proto-oncogene tyrosine-protein kinase FY | 99.35 | |
| 2ew3_A | 68 | SH3-containing GRB2-like protein 3; SH3GL3, soluti | 99.35 | |
| 2ecz_A | 70 | Sorbin and SH3 domain-containing protein 1; glycop | 99.35 | |
| 2dmo_A | 68 | Neutrophil cytosol factor 2; SH3 domain, structura | 99.35 | |
| 1zuy_A | 58 | Myosin-5 isoform; SH3 domain, contractIle protein; | 99.35 | |
| 1uj0_A | 62 | Signal transducing adaptor molecule (SH3 domain an | 99.35 | |
| 2da9_A | 70 | SH3-domain kinase binding protein 1; structural ge | 99.35 | |
| 2j05_A | 65 | RAS GTPase-activating protein 1; GTPase activation | 99.35 | |
| 1w70_A | 60 | Neutrophil cytosol factor 4; NADPH oxidase, P40PHO | 99.35 | |
| 2ege_A | 75 | Uncharacterized protein KIAA1666; SH3 domain, KIAA | 99.35 | |
| 2jw4_A | 72 | Cytoplasmic protein NCK1; SH3 domain, phosphorylat | 99.34 | |
| 1wxb_A | 68 | Epidermal growth factor receptor pathway substrate | 99.34 | |
| 2kxc_A | 67 | Brain-specific angiogenesis inhibitor 1-associate | 99.34 | |
| 2enm_A | 77 | Sorting nexin-9; SH3-like barrel, protein transpor | 99.34 | |
| 1ruw_A | 69 | Myosin-3 isoform, MYO3; SH3 domain, yeast, high-th | 99.34 | |
| 2iim_A | 62 | Proto-oncogene tyrosine-protein kinase LCK; beta-b | 99.34 | |
| 3h0h_A | 73 | Proto-oncogene tyrosine-protein kinase FYN; beta b | 99.34 | |
| 1sem_A | 58 | SEM-5; SRC-homology 3 (SH3) domain, peptide-bindin | 99.34 | |
| 2k9g_A | 73 | SH3 domain-containing kinase-binding protein 1; CI | 99.34 | |
| 1w1f_A | 65 | Tyrosine-protein kinase LYN; SH3-domain, SH3 domai | 99.34 | |
| 1wx6_A | 91 | Cytoplasmic protein NCK2; SH3 domain, structural g | 99.34 | |
| 2gqi_A | 71 | RAS GTPase-activating protein 1; GAP, RAS P21 prot | 99.33 | |
| 2dil_A | 69 | Proline-serine-threonine phosphatase-interacting p | 99.33 | |
| 2ed1_A | 76 | 130 kDa phosphatidylinositol 4,5-biphosphate- depe | 99.33 | |
| 2vwf_A | 58 | Growth factor receptor-bound protein 2; polymorphi | 99.33 | |
| 1aww_A | 67 | ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linke | 99.33 | |
| 1x6b_A | 79 | RHO guanine exchange factor (GEF) 16; SH3 domain, | 99.33 | |
| 2rf0_A | 89 | Mitogen-activated protein kinase kinase kinase 10; | 99.33 | |
| 1wyx_A | 69 | CRK-associated substrate; beta sheets, cell adhesi | 99.33 | |
| 1x43_A | 81 | Endophilin B1, SH3 domain GRB2-like protein B1; st | 99.33 | |
| 1i1j_A | 108 | Melanoma derived growth regulatory protein; SH3 su | 99.33 | |
| 4f14_A | 64 | Nebulette; SH3 domain, heart muscle, actin-binding | 99.33 | |
| 1spk_A | 72 | RSGI RUH-010, riken cDNA 1300006M19; structural ge | 99.33 | |
| 2eqi_A | 69 | Phospholipase C, gamma 2; SH3 domain, PLCG2, struc | 99.33 | |
| 2l0a_A | 72 | STAM-1, signal transducing adapter molecule 1; str | 99.33 | |
| 1x2q_A | 88 | Signal transducing adapter molecule 2; SH3 domain, | 99.32 | |
| 1uhc_A | 79 | KIAA1010 protein; beta barrel, SH3, human cDNA, st | 99.32 | |
| 1zlm_A | 58 | Osteoclast stimulating factor 1; beta barrel, sign | 99.32 | |
| 2epd_A | 76 | RHO GTPase-activating protein 4; SH3 domain, struc | 99.32 | |
| 2dl3_A | 68 | Sorbin and SH3 domain-containing protein 1; ponsin | 99.32 | |
| 2ct3_A | 70 | Vinexin; SH3 domian, structural genomics, NPPSFA, | 99.32 | |
| 2cre_A | 71 | HEF-like protein; SH3 domain, SRC homology 3 domai | 99.32 | |
| 2dl8_A | 72 | SLIT-ROBO RHO GTPase-activating protein 2; SH3 dom | 99.32 | |
| 2eyx_A | 67 | V-CRK sarcoma virus CT10 oncogene homolog isoform | 99.32 | |
| 2ak5_A | 64 | RHO guanine nucleotide exchange factor 7; adaptor | 99.32 | |
| 2cud_A | 79 | SRC-like-adapter; SH3 domain, negative mitogenesis | 99.32 | |
| 2v1r_A | 80 | Peroxisomal membrane protein PAS20; protein transp | 99.32 | |
| 1z9q_A | 79 | Neutrophil cytosol factor 4; oxidoreductase activa | 99.31 | |
| 2yup_A | 90 | Vinexin; sorbin and SH3 domain-containing protein | 99.31 | |
| 1gbq_A | 74 | GRB2; complex (signal transduction/peptide), SH3 d | 99.31 | |
| 2ega_A | 70 | SH3 and PX domain-containing protein 2A; SH3 domai | 99.31 | |
| 2fpf_A | 71 | C-JUN-amino-terminal kinase interacting protein 1; | 99.31 | |
| 2dm1_A | 73 | Protein VAV-2; RHO family guanine nucleotide excha | 99.31 | |
| 2d8h_A | 80 | SH3YL1 protein; SH3 domain, hypothetical protein S | 99.31 | |
| 1y0m_A | 61 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 99.31 | |
| 2yuq_A | 85 | Tyrosine-protein kinase ITK/TSK; T-cell-specific k | 99.31 | |
| 3eg3_A | 63 | Proto-oncogene tyrosine-protein kinase ABL1; beta, | 99.31 | |
| 2oi3_A | 86 | Tyrosine-protein kinase HCK; human HCK, SH3, SRC-t | 99.31 | |
| 3rnj_A | 67 | Brain-specific angiogenesis inhibitor 1-associate | 99.31 | |
| 2ed0_A | 78 | ABL interactor 2; coiled coil, cytoskeleton, nucle | 99.31 | |
| 4e6r_A | 58 | Cytoplasmic protein NCK2; SH3 domain, protein bind | 99.31 | |
| 3c0c_A | 73 | Endophilin-A2; endocytosis, SH3, voltage-gated cal | 99.31 | |
| 2oaw_A | 65 | Spectrin alpha chain, brain; SH3 domain, chimera, | 99.3 | |
| 3ulr_B | 65 | SRC substrate cortactin; SH3, protein-protein inte | 99.3 | |
| 2bzy_A | 67 | CRK-like protein, CRKL SH3C; SH3 domain, dimer, nu | 99.3 | |
| 2dnu_A | 71 | RUH-061, SH3 multiple domains 1; RSGI, structural | 99.3 | |
| 2egc_A | 75 | SH3 and PX domain-containing protein 2A; SH3 domai | 99.3 | |
| 2kgt_A | 72 | Tyrosine-protein kinase 6; SH3 domain, SRC kinase, | 99.3 | |
| 3ngp_A | 62 | Spectrin alpha chain, brain; beta barrel, structur | 99.3 | |
| 1uhf_A | 69 | Intersectin 2; beta barrel, SH3 domain, riken stru | 99.3 | |
| 2cuc_A | 70 | SH3 domain containing ring finger 2; structural ge | 99.3 | |
| 1neg_A | 83 | Spectrin alpha chain, brain; SH3-domain fold, five | 99.3 | |
| 2dbm_A | 73 | SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH | 99.3 | |
| 2d8j_A | 77 | FYN-related kinase; SH3 domain, structural genomic | 99.3 | |
| 1wie_A | 96 | RIM binding protein 2; beta barrel, KIAA0318 prote | 99.29 | |
| 1uff_A | 93 | Intersectin 2; beta barrel, SH3 domain, endocytosi | 99.29 | |
| 2ysq_A | 81 | RHO guanine nucleotide exchange factor 9; SH3 doma | 99.29 | |
| 2vkn_A | 70 | Protein SSU81; membrane, SH3 domain, transmembrane | 99.29 | |
| 2yuo_A | 78 | CIP85, RUN and TBC1 domain containing 3; structura | 99.29 | |
| 4glm_A | 72 | Dynamin-binding protein; SH3 domain, DNMBP, struct | 99.29 | |
| 4ag1_C | 84 | Fynomer; hydrolase-de novo protein complex, inhibi | 99.28 | |
| 2pqh_A | 80 | Spectrin alpha chain, brain; SH3 domain, chimera, | 99.28 | |
| 2csq_A | 97 | RIM-BP2, RIM binding protein 2; SH3 domain, struct | 99.28 | |
| 2ekh_A | 80 | SH3 and PX domain-containing protein 2A; SH3 domai | 99.28 | |
| 1wi7_A | 68 | SH3-domain kinase binding protein 1; beta barrel, | 99.28 | |
| 2ke9_A | 83 | Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosp | 99.28 | |
| 1jqq_A | 92 | PEX13P, peroxisomal membrane protein PAS20, PAS20P | 99.28 | |
| 3u23_A | 65 | CD2-associated protein; structural genomics, struc | 99.27 | |
| 1x69_A | 79 | Cortactin isoform A; SH3 domain, CTTN, oncogene EM | 99.27 | |
| 2yun_A | 79 | Nostrin; nitric oxide synthase trafficker, structu | 99.27 | |
| 1j3t_A | 74 | Intersectin 2; beta barrel, SH3 domain, riken stru | 99.26 | |
| 2o2o_A | 92 | SH3-domain kinase-binding protein 1; CIN85, protei | 99.26 | |
| 1ue9_A | 80 | Intersectin 2; beta barrel, SH3 domain, riken stru | 99.26 | |
| 2jxb_A | 86 | T-cell surface glycoprotein CD3 epsilon chain, cyt | 99.25 | |
| 2kxd_A | 73 | 11-MER peptide, SH3 domain of spectrin alpha CHAI; | 99.25 | |
| 2dlp_A | 85 | KIAA1783 protein; SH3 domain, structural genomics, | 99.24 | |
| 2cub_A | 88 | Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor | 99.24 | |
| 3thk_A | 73 | Spectrin alpha chain, brain; SH3 domain, chimera, | 99.24 | |
| 1ujy_A | 76 | RHO guanine nucleotide exchange factor 6; structur | 99.24 | |
| 2dbk_A | 88 | CRK-like protein; structural genomics, NPPSFA, nat | 99.23 | |
| 1u3o_A | 82 | Huntingtin-associated protein-interacting protein; | 99.23 | |
| 3i5r_A | 83 | Phosphatidylinositol 3-kinase regulatory subunit a | 99.22 | |
| 2e5k_A | 94 | Suppressor of T-cell receptor signaling 1; SH3 dom | 99.22 | |
| 2yt6_A | 109 | Adult MALE urinary bladder cDNA, riken FULL- lengt | 99.22 | |
| 1awj_A | 77 | ITK; transferase, regulatory intramolecular comple | 99.22 | |
| 3o5z_A | 90 | Phosphatidylinositol 3-kinase regulatory subunit; | 99.21 | |
| 1udl_A | 98 | Intersectin 2, KIAA1256; beta barrel, SH3 domain, | 99.21 | |
| 2kbt_A | 142 | Chimera of proto-oncogene VAV, linker, immunoglobu | 99.2 | |
| 2m0y_A | 74 | Dedicator of cytokinesis protein 1; apoptosis; NMR | 99.2 | |
| 2kym_A | 120 | BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI | 99.2 | |
| 3reb_B | 90 | Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain | 99.2 | |
| 1wxu_A | 93 | Peroxisomal biogenesis factor 13; SH3 domain, PEX1 | 99.18 | |
| 2rqr_A | 119 | CED-12 homolog, engulfment and cell motility prote | 99.17 | |
| 1bb9_A | 115 | Amphiphysin 2; transferase, SH3 domain; 2.20A {Rat | 99.15 | |
| 1hsq_A | 71 | Phospholipase C-gamma (SH3 domain); phosphoric die | 99.15 | |
| 2rqv_A | 108 | BUD emergence protein 1; BEM1P, SH3, CDC42P, cytop | 99.14 | |
| 1gcq_C | 70 | VAV proto-oncogene; SH3 domain, protein-protein co | 99.1 | |
| 3qwx_X | 174 | Cell death abnormality protein 2; cell engulfment, | 99.08 | |
| 1v1c_A | 71 | Obscurin; muscle, sarcomere, adapter, myogenesis, | 99.07 | |
| 1k1z_A | 78 | VAV; SH3, proto-oncogene, signaling protein; NMR { | 99.07 | |
| 1mv3_A | 213 | MYC box dependent interacting protein 1; tumor sup | 99.06 | |
| 3a98_A | 184 | DOCK2, dedicator of cytokinesis protein 2; protein | 98.97 | |
| 2gtj_A | 96 | FYN-binding protein; SH3, redox, signaling protein | 98.97 | |
| 1ri9_A | 102 | FYN-binding protein; SH3-like, helically extended, | 98.96 | |
| 4d8k_A | 175 | Tyrosine-protein kinase LCK; protein kinases, SH2 | 98.94 | |
| 1gri_A | 217 | Growth factor bound protein 2; SH2, SH3, signal tr | 98.91 | |
| 3jv3_A | 283 | Intersectin-1; SH3 domain, DH domain, guanine nucl | 98.9 | |
| 2dvj_A | 230 | V-CRK sarcoma virus CT10 oncogene homolog, isoform | 98.9 | |
| 1ng2_A | 193 | Neutrophil cytosolic factor 1; P47PHOX, autoinhibi | 98.89 | |
| 1ng2_A | 193 | Neutrophil cytosolic factor 1; P47PHOX, autoinhibi | 98.88 | |
| 1gri_A | 217 | Growth factor bound protein 2; SH2, SH3, signal tr | 98.85 | |
| 1k9a_A | 450 | Carboxyl-terminal SRC kinase; COOH-terminal SRC ki | 98.85 | |
| 2eyz_A | 304 | V-CRK sarcoma virus CT10 oncogene homolog isoform | 98.82 | |
| 3qwy_A | 308 | Cell death abnormality protein 2; cell engulfment, | 98.79 | |
| 1fmk_A | 452 | C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros | 98.75 | |
| 2h8h_A | 535 | Proto-oncogene tyrosine-protein kinase SRC; SRC ki | 98.75 | |
| 2dyb_A | 341 | Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid | 98.75 | |
| 2pz1_A | 466 | RHO guanine nucleotide exchange factor 4; helical | 98.73 | |
| 2lqn_A | 303 | CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT | 98.15 | |
| 2de0_X | 526 | Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltran | 98.69 | |
| 1tuc_A | 63 | Alpha-spectrin; capping protein, calcium-binding, | 98.69 | |
| 1g2b_A | 62 | Spectrin alpha chain; capping protein, calcium-bin | 98.67 | |
| 2eyz_A | 304 | V-CRK sarcoma virus CT10 oncogene homolog isoform | 98.66 | |
| 1qcf_A | 454 | Haematopoetic cell kinase (HCK); tyrosine kinase-i | 98.66 | |
| 1opk_A | 495 | P150, C-ABL, proto-oncogene tyrosine-protein kinas | 98.64 | |
| 2jmc_A | 77 | Spectrin alpha chain, brain and P41 peptide chimer | 98.62 | |
| 1kjw_A | 295 | Postsynaptic density protein 95; protein-protein i | 98.53 | |
| 2lqn_A | 303 | CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT | 97.92 | |
| 1ug1_A | 92 | KIAA1010 protein; structural genomics, SH3 domain, | 98.47 | |
| 3pe0_A | 283 | Plectin; cytoskeleton, plakin, spectrin repeat, SH | 98.38 | |
| 3qwy_A | 308 | Cell death abnormality protein 2; cell engulfment, | 98.36 | |
| 4dey_A | 337 | Voltage-dependent L-type calcium channel subunit; | 98.3 | |
| 3pvl_A | 655 | Myosin VIIA isoform 1; protein complex, novel fold | 98.11 | |
| 3kfv_A | 308 | Tight junction protein ZO-3; structural genomics c | 98.09 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 98.02 | |
| 3tsz_A | 391 | Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol | 97.99 | |
| 3r6n_A | 450 | Desmoplakin; spectrin repeat, SH3 domain, cell adh | 97.98 | |
| 3shw_A | 468 | Tight junction protein ZO-1; PDZ-SH3-GUK supramodu | 97.91 | |
| 2xkx_A | 721 | Disks large homolog 4; structural protein, scaffol | 97.87 | |
| 2q12_A | 265 | DIP13 alpha, DCC-interacting protein 13 alpha; APP | 97.75 | |
| 3tvt_A | 292 | Disks large 1 tumor suppressor protein; DLG, SRC-h | 97.71 | |
| 2q13_A | 385 | DCC-interacting protein 13 alpha; APPL1, BAR domai | 97.66 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 97.39 | |
| 4h8s_A | 407 | DCC-interacting protein 13-beta; BAR domain, pleck | 97.38 | |
| 4dyl_A | 406 | Tyrosine-protein kinase FES/FPS; structural genomi | 97.25 | |
| 2fic_A | 251 | Bridging integrator 1; BAR domain, homodimer, coil | 97.18 | |
| 2efl_A | 305 | Formin-binding protein 1; EFC domain, structural g | 97.11 | |
| 2efk_A | 301 | CDC42-interacting protein 4; EFC domain, structura | 97.1 | |
| 1uru_A | 244 | Amphiphysin; endocytosis, coiled-coil, membrane cu | 96.78 | |
| 3haj_A | 486 | Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, | 96.57 | |
| 1zww_A | 256 | SH3-containing GRB2-like protein 2; coiled coil, t | 95.8 | |
| 2z0v_A | 240 | SH3-containing GRB2-like protein 3; helix bundle, | 95.75 | |
| 2dyb_A | 341 | Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid | 95.67 | |
| 4a3a_A | 243 | Amphiphysin; structural genomics, invagination, kn | 95.35 | |
| 4avm_A | 237 | Bridging integrator 2; protein binding, plasma mem | 95.05 | |
| 1i4d_A | 224 | Arfaptin 2, partner of RAC1; coiled coil, G-protei | 94.98 | |
| 1urf_A | 81 | Protein kinase C-like 1; transferase, G-protein, H | 94.6 | |
| 2kt8_A | 76 | Probable surface protein; SH3 family, structural g | 94.53 | |
| 4akv_A | 386 | Sorting nexin-33; transport protein, organelle bio | 94.51 | |
| 2krs_A | 74 | Probable enterotoxin; all beta, SH3, ENTD, CPF_058 | 93.85 | |
| 3dyt_A | 366 | Sorting nexin-9; 3-helix bundle, BAR domain, PX do | 93.82 | |
| 2v0o_A | 276 | FCHO2, FCH domain only protein 2; lipid-binding pr | 93.79 | |
| 3aco_A | 350 | Pacsin2, protein kinase C and casein kinase substr | 93.27 | |
| 3qwe_A | 279 | GMIP, GEM-interacting protein; structural genomics | 93.22 | |
| 2kq8_A | 70 | Cell WALL hydrolase; GFT protein structure, NESG, | 93.21 | |
| 1cxz_B | 86 | Protein (PKN); protein-protein complex, antiparall | 91.05 | |
| 1wfw_A | 74 | Kalirin-9A; SH3 domain, neuron-specific GDP/GTP ex | 86.64 | |
| 2jmc_A | 77 | Spectrin alpha chain, brain and P41 peptide chimer | 85.71 | |
| 2x3v_A | 337 | Syndapin I, protein kinase C and casein kinase sub | 84.45 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 83.91 | |
| 2ykt_A | 253 | Brain-specific angiogenesis inhibitor 1-associate | 83.28 | |
| 3i2w_A | 290 | Syndapin, LD46328P; EFC, FBAR, SH3 domain, endocyt | 82.8 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 82.43 |
| >4dyl_A Tyrosine-protein kinase FES/FPS; structural genomics, structural genomics consortium, BCR, CR associated substrate, transferase; 2.18A {Homo sapiens} | Back alignment and structure |
|---|
Probab=100.00 E-value=1e-50 Score=441.40 Aligned_cols=374 Identities=14% Similarity=0.172 Sum_probs=315.6
Q ss_pred Cccc--hHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcCCc-ccccccccHHHHHHHHHHHHHHHHH
Q psy10868 1 VFQD--QYDNLSLHTQKGIDFLEKYGHFIRDRCAIEMEYAGKLRRLVKNYQPKK-EEEDYQYSTCKAFKCVLDEVTDLAG 77 (649)
Q Consensus 1 ~L~D--gf~~L~~~~~~gi~~~e~l~~f~keRa~iE~eYAk~L~kLakk~~~~~-~~~~~~~t~~~aw~~ll~e~~~~A~ 77 (649)
+||| ||+.|.+|+++|+++|++|.+||++||+||++||++|.+||++|.+++ .+.++++|+..+|..++.+++.+|.
T Consensus 7 ~lw~~~gf~~L~kr~~~g~~lledl~~F~reRA~IE~eYAk~L~kLakk~~~k~~~~~~~~~tl~~aW~~ll~ete~~a~ 86 (406)
T 4dyl_A 7 ELCSPQGHGVLQQMQEAELRLLEGMRKWMAQRVKSDREYAGLLHHMSLQDSGGQSRAISPDSPISQSWAEITSQTEGLSR 86 (406)
T ss_dssp HSCSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC------------CCSHHHHHHHHHHHHHHHHHH
T ss_pred hhcCccchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcccccCCCCCChHHHHHHHHHHHHHHHHH
Confidence 4898 899999999999999999999999999999999999999999998764 2345667999999999999999999
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhHhhh
Q psy10868 78 QHEVIAENLQVFIIKEVTIFVKDFKEERKKHLQDGARMMNLLENQVIALERARKNYDKAYRESDKALEHYKRADADLELS 157 (649)
Q Consensus 78 ~H~~lae~L~~~v~~~L~~~~~e~~~~rK~~~~~~~kl~~~l~~~~~~l~k~kk~y~~~~~e~~~a~~~~~ka~~~l~~~ 157 (649)
.|..+|+.|.++++.+|..+.++.++.||++.+.+.+++
T Consensus 87 ~H~~lae~L~~~v~~~l~~~~ke~~~~rK~~~~~~~klq----------------------------------------- 125 (406)
T 4dyl_A 87 LLRQHAEDLNSGPLSKLSLLIRERQQLRKTYSEQWQQLQ----------------------------------------- 125 (406)
T ss_dssp HHHHHHHHHHHTHHHHHHHHHHHHHHHHHHHHHHHHHHH-----------------------------------------
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-----------------------------------------
Confidence 999999999999999999999999999999999999888
Q ss_pred hhhhcccchhHHHHHHHHH-HHHHHHHHHHHHHHhhHHHHHHHHHHhhhhhhcCHHHHHHHHHHHHHHHHHHHHhHHHHH
Q psy10868 158 RAEHLQDGDHLMKILRNQV-DALERALKNYEKAFRDADKALEHYKRADADLELSRAEVEKQRINMAIKSQHCEDTKTEYA 236 (649)
Q Consensus 158 r~~~~~~~~~~~k~l~~~~-~~l~KaKk~Y~~~~re~e~a~~k~~ka~~d~~~sk~eleK~~~k~~~~~~~~~~ak~eY~ 236 (649)
+.|...+ +.|+|+|++|+..|++++.|+.+++++..+ ++++|++.++.++...+.+++|+|.
T Consensus 126 ------------k~~~k~~~~~lekaKk~Y~~~cke~e~A~~k~~~~~k~-----ke~eK~~~k~~k~~~~~~~a~neY~ 188 (406)
T 4dyl_A 126 ------------QELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKD-----KDRDKAKDKYVRSLWKLFAHHNRYV 188 (406)
T ss_dssp ------------HHHHHHHTHHHHHHHHHHHHHHHHHHHHHHCC--------------CHHHHHHHHHHHHHHHHHHHHH
T ss_pred ------------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcccC-----chHHHHHHHHHHHHHHHHHHHHHHH
Confidence 7777778 788999999999999999999888776432 6889999999999999999999999
Q ss_pred HHHHHHHHHhHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhcchHHHHHHHHHHHHhhChHhHHHHHHHH
Q psy10868 237 NQLQRANEMQRQHYTQAMPEVFAQLQELDEKRVRNIRNFMVHSANIEKKVFPIINQCLDGIIKAADQINEKEDSALVIER 316 (649)
Q Consensus 237 ~~l~~~N~~q~~~y~~~mp~i~~~lQ~lee~Ri~~lk~~l~~y~~~~~~~~~~~~~~~~~l~~~~~~Id~~~D~~~fi~~ 316 (649)
.+|..+|..+..||.++||.+|+.||+||++|+.+|+++|+.|+.++..+.+.+.+|++.|..+++.|||..|++.||+.
T Consensus 189 ~~l~~~N~~~~~yy~~~lp~~~d~lQ~lEe~Ri~~lk~~L~~~~~~~~~~~~~~~~~~~~l~~~i~~id~~~D~~~Fi~~ 268 (406)
T 4dyl_A 189 LGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAAAAARIQPEAEYQGFLRQ 268 (406)
T ss_dssp HHHHHHHHHHHHHHHTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCSSSHHHHHHHHHHHHHHHHCCGGGTTHHHHHH
T ss_pred HHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHcCcHHHHHHHHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred hcCCCCCCCCcccccCCCCCCCCCCCCCCCCCCCCCccccccccccccccccccCCccCCCCCCCCCCCCCCchHHHHHH
Q psy10868 317 YKSGFTPPGDIPFEDLSRGGESTPIAPAFPHLMGMRPEAATVRGTMSAGRLKRRNNVGGFGSNGKDDFSNLPPSQRKKKL 396 (649)
Q Consensus 317 ~~s~~~~P~~~~FE~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ed~~~lp~eqr~~~l 396 (649)
|++|+.+|++|.|+|+..++.. .. .|+.+.++. ++. .|+ ..|+.++
T Consensus 269 ~~tg~~~P~~~~Fep~~~~d~~-~l----------~~~~~~~~e-~~~----------~~l------------q~~L~~~ 314 (406)
T 4dyl_A 269 YGSAPDVPPCVTFDESLLEEGE-PL----------EPGELQLNE-LTV----------ESV------------QHTLTSV 314 (406)
T ss_dssp HCCCCCCCCCCCCCTTCCC-----------------TTCCCCST-TTH----------HHH------------HHHHHHH
T ss_pred cCCCCCCCCCCccccCcccccc-cC----------CccchhhhH-HHH----------HHH------------HHHHHHH
Confidence 9999999999999999766521 01 112222221 221 333 4579999
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHhhCCCCCChhhhhh---hHHHHHHHHHHHHHHHHHHHHHHHHhhh
Q psy10868 397 QQRIEEIQHSIQQESAAREGLIKMKGVYEDNPNLGDPHMIEG---QLSETDSRLEKLRGELQKYQTYMEESEA 466 (649)
Q Consensus 397 ~~kl~el~~~i~k~~~~~~gl~km~~~y~~np~~gd~~~~~~---~l~e~~~~l~~l~~~~~kl~~~l~e~~~ 466 (649)
+..|.++++++.+++++++||.+.++.+.++-.-++...+.. -|.|..+.+..|+.+..||++..+.+..
T Consensus 315 ~~~l~~~~~~~~~k~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~~~~~~~~~~~q~~~~~~ 387 (406)
T 4dyl_A 315 TDELAVATEMVFRRQEMVTQLQQELRNEEENTHPRERVQLLGKRQVLQEALQGLQVALCSQAKLQAQQELLQT 387 (406)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSCTTCGGGGHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcCCcchHHHHHhHHhhHHHHHHHHHHHHhHHHHHHHHHHHHHH
Confidence 999999999999999999999999999988766565544433 3468999999999999999988777665
|
| >3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} | Back alignment and structure |
|---|
| >2efk_A CDC42-interacting protein 4; EFC domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.30A {Homo sapiens} SCOP: a.238.1.4 | Back alignment and structure |
|---|
| >2efl_A Formin-binding protein 1; EFC domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.61A {Homo sapiens} SCOP: a.238.1.4 | Back alignment and structure |
|---|
| >3m3w_A Pacsin3, protein kinase C and casein kinase II substrate P; mouse, BAR domain, endocytosis; 2.60A {Mus musculus} PDB: 3syv_A 3qe6_A | Back alignment and structure |
|---|
| >2x3v_A Syndapin I, protein kinase C and casein kinase substrate in N protein 1; BAR, N-WAsp, dynamin, pacsin 1, endocytosis; 2.45A {Mus musculus} PDB: 2x3w_A 2x3x_A | Back alignment and structure |
|---|
| >3aco_A Pacsin2, protein kinase C and casein kinase substrate in neurons protein 2; helix bundle, coiled-coil, endocytosis; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3abh_A Pacsin2, protein kinase C and casein kinase substrate in neurons protein 2; helix bundle, coiled-coil, endocytosis; 2.00A {Homo sapiens} PDB: 3q0k_A 3lll_A 3hah_A 3qni_A 3hai_A 3q84_A | Back alignment and structure |
|---|
| >3i2w_A Syndapin, LD46328P; EFC, FBAR, SH3 domain, endocytosis; 2.67A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2v0o_A FCHO2, FCH domain only protein 2; lipid-binding protein, EFC domain, vesicle trafficking, membrane curvature, endocytosis, exocytosis, F-BAR domain; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2ke4_A CDC42-interacting protein 4; CIP4, TC10, coiled-coil, alternative splicing, cell membrane, coiled coil, cytoplasm, cytoskeleton, endocytosis; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3g9g_A Suppressor of yeast profilin deletion; SYP1, BAR domain, FCH, adaptor, endocytosis, phosphoprotein; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3qwe_A GMIP, GEM-interacting protein; structural genomics consortium, SGC, protein binding; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2lx7_A GAS-7, growth arrest-specific protein 7; structural genomics, northeast structural genomics consortiu target HR8574A, PSI-biology; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ct4_A CDC42-interacting protein 4; thyroid receptor interacting protein 10, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lj0_A Sorbin and SH3 domain-containing protein 1; R85FL, ponsin, CAP, signaling protein; NMR {Homo sapiens} PDB: 2lj1_A | Back alignment and structure |
|---|
| >2a28_A BZZ1 protein; SH3 domain, signaling protein; 1.07A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2b86_A Cytoplasmic protein NCK2; NCK SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2js2_A | Back alignment and structure |
|---|
| >1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1zuu_A BZZ1 protein; SH3 domain, unknown function; 0.97A {Saccharomyces cerevisiae} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1nm7_A Peroxisomal membrane protein PAS20; yeast, PEX5P, PEX14P, PEX13P, import machine, SH3 domain, protein transport; NMR {Saccharomyces cerevisiae} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2o9s_A Ponsin; SH3 domain, signaling protein; 0.83A {Homo sapiens} PDB: 2o31_A 2o9v_A 2o2w_A | Back alignment and structure |
|---|
| >1u5s_A Cytoplasmic protein NCK2; protein-protein complex, beta barrel, beta sheet, zinc finger, metal binding protein; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2fry_A | Back alignment and structure |
|---|
| >1jo8_A ABP1P, actin binding protein; SH3 domain actin-binding-protein, structural protein; 1.30A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 2k3b_A 2rpn_A | Back alignment and structure |
|---|
| >2x3w_D Syndapin I, protein kinase C and casein kinase substrate in N protein 1; endocytosis, N-WAsp, dynamin, pacsin I, transferase; 2.64A {Mus musculus} PDB: 2x3x_D | Back alignment and structure |
|---|
| >1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A | Back alignment and structure |
|---|
| >1csk_A C-SRC SH3 domain; phosphotransferase; 2.50A {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2g6f_X RHO guanine nucleotide exchange factor 7; SH3 domain, peptide interaction, signaling protein; HET: NCO; 0.92A {Rattus norvegicus} PDB: 2df6_A* 2p4r_A 2esw_A | Back alignment and structure |
|---|
| >1uti_A GRB2-related adaptor protein 2; signaling protein regulator, SH3 domain/complex, adaptor protein (MONA); 1.5A {Mus musculus} SCOP: b.34.2.1 PDB: 1h3h_A 1oeb_A 2w10_A 2d0n_A | Back alignment and structure |
|---|
| >2jt4_A Cytoskeleton assembly control protein SLA1; endocytosis, SH3, actin-binding, cytoplasm, cytoskeleton, phosphorylation, SH3 domain, DNA damage, DNA repair, nucleus; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1oot_A Hypothetical 40.4 kDa protein in PES4-His2 intergenic region; SH3 domain, sturctural genomics, structural genomics; 1.39A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1ssh_A 2a08_A | Back alignment and structure |
|---|
| >2jte_A CD2-associated protein; SH3 domain, coiled coil, cytoplasm, phosphorylation, SH3-binding, signaling protein; NMR {Mus musculus} PDB: 2kro_A | Back alignment and structure |
|---|
| >1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A | Back alignment and structure |
|---|
| >2bz8_A SH3-domain kinase binding protein 1; SH3 domain, CIN85 adaptor protein, CBL ubiquitin ligase; 2.0A {Homo sapiens} | Back alignment and structure |
|---|
| >1s1n_A Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lcs_A NAP1-binding protein 2; adaptor, transferase, signaling protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1yn8_A NBP2, NAP1-binding protein 2; SH3 domain, unknown function; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1wxt_A Hypothetical protein FLJ21522; SH3 domain, EPS8-related protein 3, protein-protein interaction, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ydl_A SH3 domain-containing kinase-binding protein 1; signaling protein; 2.05A {Homo sapiens} PDB: 2k6d_A | Back alignment and structure |
|---|
| >1i07_A Epidermal growth factor receptor kinase substrate EPS8; hormone/growth factor; 1.80A {Mus musculus} SCOP: b.34.2.1 PDB: 1aoj_A 1i0c_A | Back alignment and structure |
|---|
| >1x2k_A OSTF1, osteoclast stimulating factor 1; SH3 domain, human osteoclast stimulating factor 1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2drm_A Acanthamoeba myosin IB; SH3 domain, contractIle protein; 1.35A {Acanthamoeba} PDB: 2drk_A | Back alignment and structure |
|---|
| >2nwm_A Vinexin; cell adhesion; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2k2m_A EPS8-like protein 1; alternative splicing, coiled coil, cytoplasm, SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2rol_A | Back alignment and structure |
|---|
| >4esr_A Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domain, dynamin-2, protei binding, chronic myeloid leukemia; 1.53A {Homo sapiens} | Back alignment and structure |
|---|
| >1x6g_A Megakaryocyte-associated tyrosine-protein kinase; MATK, CTK, HYL, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2fei_A CD2-associated protein; CMS SH3 domain, structural protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2gnc_A SLIT-ROBO RHO GTPase-activating protein 1; beta barrel, signaling protein; 1.80A {Mus musculus} | Back alignment and structure |
|---|
| >2ebp_A SAM and SH3 domain-containing protein 1; proline-glutamate repeat-containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2kea_A | Back alignment and structure |
|---|
| >1tg0_A BBC1 protein, myosin tail region-interacting protein MTI1; yeast, SH3 domain, structural genomics, contractIle protein; 0.97A {Saccharomyces cerevisiae} PDB: 1zuk_A 1wdx_A | Back alignment and structure |
|---|
| >1k4u_S Phagocyte NADPH oxidase subunit P67PHOX; SH3-peptide complex, helix-turn-helix, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2dl7_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xmf_A Myosin 1E SH3; motor protein, SH3 domain; HET: DIA; 1.50A {Mus musculus} | Back alignment and structure |
|---|
| >1zx6_A YPR154WP; SH3 domain, protein binding; 1.60A {Saccharomyces cerevisiae} PDB: 1ynz_A | Back alignment and structure |
|---|
| >2i0n_A Class VII unconventional myosin; beta-sheet loop, structural protein; NMR {Dictyostelium discoideum} | Back alignment and structure |
|---|
| >2j6f_A CD2-associated protein; metal-binding, immune response, SH3, SH2 domain, SH3 zinc-finger, SH3- binding, UBL conjugation pathway; 1.7A {Homo sapiens} PDB: 2j6k_A 2j6o_A 2j7i_A 2krm_A | Back alignment and structure |
|---|
| >2dl5_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x2p_A Protein arginine N-methyltransferase 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* | Back alignment and structure |
|---|
| >2csi_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2djq_A SH3 domain containing ring finger 2; MUS musculus 0 DAY neonate head cDNA, riken FULL-length enriched library, clone:4831401O22, structural genomics; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1ugv_A KIAA0621, olygophrenin-1 like protein; beta barrel, GRAF protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2dl4_A Protein STAC; SH3 domain, STAC protein, SRC homology 3, cysteine-rich domain protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A | Back alignment and structure |
|---|
| >2ew3_A SH3-containing GRB2-like protein 3; SH3GL3, solution structure, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecz_A Sorbin and SH3 domain-containing protein 1; glycoprotein, membrane, nuclear protein, phosphorylation, polymorphism, transport, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dmo_A Neutrophil cytosol factor 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A | Back alignment and structure |
|---|
| >1uj0_A Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2; STAM, SH3, GRB2, GADS, PXXP, HRS, endocytosis, early endosome, signaling protein/signaling protein complex; 1.70A {Mus musculus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2da9_A SH3-domain kinase binding protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2j05_A RAS GTPase-activating protein 1; GTPase activation, SH3 domain, SH2 domain, SRC homology 3, RAS signaling pathway, proto- oncogene, phosphorylation; 1.5A {Homo sapiens} PDB: 2j06_A | Back alignment and structure |
|---|
| >1w70_A Neutrophil cytosol factor 4; NADPH oxidase, P40PHOX, P47PHOX, SH3 domain, polyproline; 1.46A {Homo sapiens} PDB: 1w6x_A | Back alignment and structure |
|---|
| >2ege_A Uncharacterized protein KIAA1666; SH3 domain, KIAA1666 protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jw4_A Cytoplasmic protein NCK1; SH3 domain, phosphorylation, SH2 domain, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wxb_A Epidermal growth factor receptor pathway substrate 8-like protein; SH3, EPS8, EPS8L2, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kxc_A Brain-specific angiogenesis inhibitor 1-associate 2-like protein 1; IRTKS-SH3, espfu, complex structure, protein binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2enm_A Sorting nexin-9; SH3-like barrel, protein transport, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1ruw_A Myosin-3 isoform, MYO3; SH3 domain, yeast, high-throughput, structural genomics, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2btt_A 1va7_A | Back alignment and structure |
|---|
| >2iim_A Proto-oncogene tyrosine-protein kinase LCK; beta-barrels, signaling protein; HET: PG4; 1.00A {Homo sapiens} SCOP: b.34.2.1 PDB: 1h92_A 1kik_A | Back alignment and structure |
|---|
| >3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} SCOP: b.34.2.1 PDB: 3h0i_A 3h0f_A* | Back alignment and structure |
|---|
| >1sem_A SEM-5; SRC-homology 3 (SH3) domain, peptide-binding protein; 2.00A {Caenorhabditis elegans} SCOP: b.34.2.1 PDB: 2sem_A 3sem_A 1k76_A 1kfz_A | Back alignment and structure |
|---|
| >2k9g_A SH3 domain-containing kinase-binding protein 1; CIN85, adaptor protein, downregulation, CBL, apoptosis, junction, cytoplasmic vesicle, cytoskeleton; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wx6_A Cytoplasmic protein NCK2; SH3 domain, structural genomics, signal transduction, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2gqi_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dil_A Proline-serine-threonine phosphatase-interacting protein 1; SH3 domain, PEST phosphatase-interacting protein 1, CD2- binding protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ed1_A 130 kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; GTPase activation, membrane, metal-binding, SH3 domain; NMR {Homo sapiens} PDB: 2rqt_A 2rqu_A | Back alignment and structure |
|---|
| >2vwf_A Growth factor receptor-bound protein 2; polymorphism, phosphoprotein, golgi apparatus, alternative splicing, HOST-virus interaction, SH3C, signaling; 1.58A {Homo sapiens} PDB: 2w0z_A 1gcq_A 1gfc_A 1gfd_A 1io6_A 2vvk_A | Back alignment and structure |
|---|
| >1aww_A ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linked agammaglobulinemia, XLA, BTK, SH3 domain, transferase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 1awx_A 1qly_A | Back alignment and structure |
|---|
| >1x6b_A RHO guanine exchange factor (GEF) 16; SH3 domain, neuroblastoma, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2rf0_A Mitogen-activated protein kinase kinase kinase 10; MAP3K10, MLK2, SH3 domain, TKL kinase, MKN28, structural GEN structural genomics consortium, SGC; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1wyx_A CRK-associated substrate; beta sheets, cell adhesion; 1.14A {Homo sapiens} | Back alignment and structure |
|---|
| >1x43_A Endophilin B1, SH3 domain GRB2-like protein B1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1i1j_A Melanoma derived growth regulatory protein; SH3 subdomain, hormone/growth factor complex; 1.39A {Homo sapiens} SCOP: b.34.2.1 PDB: 1k0x_A 1hjd_A | Back alignment and structure |
|---|
| >4f14_A Nebulette; SH3 domain, heart muscle, actin-binding protein-peptide COMP; 1.20A {Homo sapiens} PDB: 1ark_A 1neb_A 3i35_A | Back alignment and structure |
|---|
| >1spk_A RSGI RUH-010, riken cDNA 1300006M19; structural genomics, SH3 domain, five-stranded barrel, mouse cDNA; NMR {Mus musculus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2eqi_A Phospholipase C, gamma 2; SH3 domain, PLCG2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2l0a_A STAM-1, signal transducing adapter molecule 1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x2q_A Signal transducing adapter molecule 2; SH3 domain, signal transducing adaptor molecule, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1uhc_A KIAA1010 protein; beta barrel, SH3, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1zlm_A Osteoclast stimulating factor 1; beta barrel, signaling protein; 1.07A {Homo sapiens} | Back alignment and structure |
|---|
| >2epd_A RHO GTPase-activating protein 4; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dl3_A Sorbin and SH3 domain-containing protein 1; ponsin, C-CBL-associated protein, CAP, SH3 domain protein 5 SH3P12, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dlm_A | Back alignment and structure |
|---|
| >2ct3_A Vinexin; SH3 domian, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cre_A HEF-like protein; SH3 domain, SRC homology 3 domain, beta barrel, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dl8_A SLIT-ROBO RHO GTPase-activating protein 2; SH3 domain, formin-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eyx_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH3, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ak5_A RHO guanine nucleotide exchange factor 7; adaptor proteins, CIN85, PIX/COOL, protein-protein interaction, X-RAY, endocytosis; 1.85A {Rattus norvegicus} PDB: 1zsg_A | Back alignment and structure |
|---|
| >2cud_A SRC-like-adapter; SH3 domain, negative mitogenesis regulator, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2v1r_A Peroxisomal membrane protein PAS20; protein transport, translocation, transmembrane, peptide COM structural genomics, peroxisome; 2.1A {Saccharomyces cerevisiae} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1z9q_A Neutrophil cytosol factor 4; oxidoreductase activator; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yup_A Vinexin; sorbin and SH3 domain-containing protein 3, SH3-containing adapter molecule 1, SCAM-1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1gbq_A GRB2; complex (signal transduction/peptide), SH3 domain; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 1gbr_A 2gbq_A 3gbq_A 4gbq_A | Back alignment and structure |
|---|
| >2ega_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2dm1_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8h_A SH3YL1 protein; SH3 domain, hypothetical protein SH3YL1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1y0m_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; SH3 domain, hydrolase; 1.20A {Rattus norvegicus} PDB: 1ywp_A 1ywo_A | Back alignment and structure |
|---|
| >2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3eg3_A Proto-oncogene tyrosine-protein kinase ABL1; beta, ATP-binding, cell adhesion, cytoskeleton, LIPO magnesium, manganese, metal-binding, myristate; 1.40A {Homo sapiens} PDB: 3egu_A 3eg0_A 3eg2_A 3eg1_A 1abo_A 1abq_A 1ju5_C* 2o88_A 1bbz_A 1awo_A | Back alignment and structure |
|---|
| >2oi3_A Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type tyrosine kinase, transferase; NMR {Homo sapiens} PDB: 2oj2_A 4hck_A 5hck_A | Back alignment and structure |
|---|
| >3rnj_A Brain-specific angiogenesis inhibitor 1-associate 2; structural genomics, structural genomics consortium, SGC, BE barrel; HET: EDT; 1.50A {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2ed0_A ABL interactor 2; coiled coil, cytoskeleton, nuclear protein, phosphorylation, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4e6r_A Cytoplasmic protein NCK2; SH3 domain, protein binding, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MLY; 2.20A {Homo sapiens} PDB: 2frw_A 2js0_A | Back alignment and structure |
|---|
| >3c0c_A Endophilin-A2; endocytosis, SH3, voltage-gated calcium channel, endosome, L binding, membrane, phosphoprotein, proto-oncogene, SH3 DOMA; 1.70A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2oaw_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.90A {Gallus gallus} PDB: 2rot_A 2rmo_A 2kr3_A | Back alignment and structure |
|---|
| >3ulr_B SRC substrate cortactin; SH3, protein-protein interaction, hydrolase, protein binding; 1.65A {Mus musculus} SCOP: b.34.2.0 PDB: 2d1x_A | Back alignment and structure |
|---|
| >2bzy_A CRK-like protein, CRKL SH3C; SH3 domain, dimer, nuclear export; 2.5A {Homo sapiens} PDB: 2bzx_A | Back alignment and structure |
|---|
| >2dnu_A RUH-061, SH3 multiple domains 1; RSGI, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2egc_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kgt_A Tyrosine-protein kinase 6; SH3 domain, SRC kinase, PTK6, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ngp_A Spectrin alpha chain, brain; beta barrel, structural protein; 1.08A {Gallus gallus} PDB: 1e7o_A 1e6g_A 1e6h_A 1uue_A 1h8k_A 2lj3_A 1aey_A 1m8m_A 1shg_A 1u06_A 2nuz_A 2cdt_A 1hd3_A 2f2v_A 2f2w_A 2jm8_A 2jm9_A 2jma_A 3m0r_A 3m0p_A ... | Back alignment and structure |
|---|
| >1uhf_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2cuc_A SH3 domain containing ring finger 2; structural genomics, ring finger 2 containing protein, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1neg_A Spectrin alpha chain, brain; SH3-domain fold, five antiparallel beta sheets, structural protein; 2.30A {Gallus gallus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2dbm_A SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH3 domain protein 2A, endophilin 1, EEN-B1, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2knb_B 3iql_A | Back alignment and structure |
|---|
| >2d8j_A FYN-related kinase; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1wie_A RIM binding protein 2; beta barrel, KIAA0318 protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1uff_A Intersectin 2; beta barrel, SH3 domain, endocytosis, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2ysq_A RHO guanine nucleotide exchange factor 9; SH3 domain, CDC42 guanine nucleotide exchange factor (GEF) 9, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vkn_A Protein SSU81; membrane, SH3 domain, transmembrane, membrane; 2.05A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2yuo_A CIP85, RUN and TBC1 domain containing 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >4glm_A Dynamin-binding protein; SH3 domain, DNMBP, structural genomics, structural genomics consortium, SGC, SRC homology 3 domains, cell junctions; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >4ag1_C Fynomer; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Synthetic construct} PDB: 4afz_C 4ag2_C* 4afq_C* 4afs_C 4afu_C 1azg_B 1nyf_A 1nyg_A 1a0n_B 3ua7_A 3ua6_A 1fyn_A 1m27_C* 1shf_A 1zbj_A 1efn_A 1avz_C 1nlo_C* 1nlp_C* 1qwe_A ... | Back alignment and structure |
|---|
| >2csq_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ekh_A SH3 and PX domain-containing protein 2A; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wi7_A SH3-domain kinase binding protein 1; beta barrel, SH3KBP1, RUK, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ke9_A Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosphoprotein, protein binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jqq_A PEX13P, peroxisomal membrane protein PAS20, PAS20P, roxin-13; compact beta-barrel of five anti-parrallel beta-strands; 2.65A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1n5z_A | Back alignment and structure |
|---|
| >3u23_A CD2-associated protein; structural genomics, structural genomics consortium, SGC, BE barrel, adaptor protein, protein binding; 1.11A {Homo sapiens} PDB: 2krn_A | Back alignment and structure |
|---|
| >1x69_A Cortactin isoform A; SH3 domain, CTTN, oncogene EMS1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yun_A Nostrin; nitric oxide synthase trafficker, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1j3t_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2o2o_A SH3-domain kinase-binding protein 1; CIN85, protein binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ue9_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2jxb_A T-cell surface glycoprotein CD3 epsilon chain, cytoplasmic protein NCK2; T-cell receptor, SH3 domain, immunology, SH2 domain; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kxd_A 11-MER peptide, SH3 domain of spectrin alpha CHAI; alpha spectrin SH3 domain, SPC-S19P20S circular permutant, S protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >2dlp_A KIAA1783 protein; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cub_A Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor, tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3thk_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.70A {Rattus norvegicus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1ujy_A RHO guanine nucleotide exchange factor 6; structural genomics, SH3 domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2dbk_A CRK-like protein; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1u3o_A Huntingtin-associated protein-interacting protein; SH3, CIS-proline,, signaling protein; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >3i5r_A Phosphatidylinositol 3-kinase regulatory subunit alpha; SH3 domain, peptide complex, alternative splicing, disease mutation, HOST-virus interaction, phosphoprotein, polymorphism; 1.70A {Homo sapiens} SCOP: b.34.2.1 PDB: 3i5s_A 1pht_A 1pnj_A 2pni_A 1pks_A 1pkt_A | Back alignment and structure |
|---|
| >2e5k_A Suppressor of T-cell receptor signaling 1; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A | Back alignment and structure |
|---|
| >3o5z_A Phosphatidylinositol 3-kinase regulatory subunit; SRC homology 3 domain, protein binding; 2.01A {Homo sapiens} SCOP: b.34.2.0 PDB: 2kt1_A | Back alignment and structure |
|---|
| >1udl_A Intersectin 2, KIAA1256; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2kbt_A Chimera of proto-oncogene VAV, linker, immunoglobulin G-binding protein G; sortase, protein ligation, intein, inset, solubility enhancement; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2m0y_A Dedicator of cytokinesis protein 1; apoptosis; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2kym_A BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE20P PRR, CDC42P-interacting, S signaling protein; NMR {Lodderomyces elongisporus} | Back alignment and structure |
|---|
| >3reb_B Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain binding, signaling, HCK SH3 domain, PR binding; 3.45A {Homo sapiens} | Back alignment and structure |
|---|
| >1wxu_A Peroxisomal biogenesis factor 13; SH3 domain, PEX13, protein-protein interaction, structural genomics; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2rqr_A CED-12 homolog, engulfment and cell motility protein 1, linker, D of cytokinesis protein 2; KIAA0209, KIAA0281, apoptosis, membrane, phagocytosis; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bb9_A Amphiphysin 2; transferase, SH3 domain; 2.20A {Rattus norvegicus} SCOP: b.34.2.1 PDB: 1muz_A 1mv0_B | Back alignment and structure |
|---|
| >1hsq_A Phospholipase C-gamma (SH3 domain); phosphoric diester hydrolase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2hsp_A | Back alignment and structure |
|---|
| >2rqv_A BUD emergence protein 1; BEM1P, SH3, CDC42P, cytoplasm, cytoskeleton, SH3 domain, SIG protein; NMR {Saccharomyces cerevisiae} PDB: 2rqw_A | Back alignment and structure |
|---|
| >1gcq_C VAV proto-oncogene; SH3 domain, protein-protein complex, GRB2,VAV, signaling protein/signaling protein complex; 1.68A {Mus musculus} SCOP: b.34.2.1 PDB: 1gcp_A | Back alignment and structure |
|---|
| >3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1k1z_A VAV; SH3, proto-oncogene, signaling protein; NMR {Mus musculus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1mv3_A MYC box dependent interacting protein 1; tumor suppressor, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >3a98_A DOCK2, dedicator of cytokinesis protein 2; protein-protein complex, DOCK2, ELMO1, SH3 domain, PH domain bundle, proline-rich sequence, cytoskeleton; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2gtj_A FYN-binding protein; SH3, redox, signaling protein; NMR {Homo sapiens} PDB: 2gto_A | Back alignment and structure |
|---|
| >1ri9_A FYN-binding protein; SH3-like, helically extended, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* | Back alignment and structure |
|---|
| >1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A | Back alignment and structure |
|---|
| >3jv3_A Intersectin-1; SH3 domain, DH domain, guanine nucleotide exchange factor, autoinhibition, domain-swapped, cell junction, cell project endocytosis; 2.40A {Mus musculus} PDB: 3gf9_A | Back alignment and structure |
|---|
| >2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A | Back alignment and structure |
|---|
| >1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B | Back alignment and structure |
|---|
| >1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B | Back alignment and structure |
|---|
| >1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A | Back alignment and structure |
|---|
| >1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A | Back alignment and structure |
|---|
| >2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A | Back alignment and structure |
|---|
| >3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... | Back alignment and structure |
|---|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 | Back alignment and structure |
|---|
| >2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} | Back alignment and structure |
|---|
| >2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D | Back alignment and structure |
|---|
| >2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* | Back alignment and structure |
|---|
| >2de0_X Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltransferase, N-glycan, COR SH3 domain; 2.61A {Homo sapiens} | Back alignment and structure |
|---|
| >1tuc_A Alpha-spectrin; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton; 2.02A {Gallus gallus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1g2b_A Spectrin alpha chain; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton, metal binding protein; 1.12A {Gallus gallus} SCOP: b.34.2.1 PDB: 1tud_A | Back alignment and structure |
|---|
| >2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A | Back alignment and structure |
|---|
| >1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B | Back alignment and structure |
|---|
| >1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A | Back alignment and structure |
|---|
| >2jmc_A Spectrin alpha chain, brain and P41 peptide chimera; SPC-SH3, signaling protein; NMR {Gallus gallus} | Back alignment and structure |
|---|
| >1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A | Back alignment and structure |
|---|
| >2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* | Back alignment and structure |
|---|
| >1ug1_A KIAA1010 protein; structural genomics, SH3 domain, hypothetical protein BAA76854.1, riken structural genomics/proteomics initiative RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens} | Back alignment and structure |
|---|
| >3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >4dey_A Voltage-dependent L-type calcium channel subunit; maguk, voltage dependent calcium channel, transport protein; 1.95A {Oryctolagus cuniculus} PDB: 4dex_A 1t3l_A 1t3s_A 1vyv_A 1vyu_A 1vyt_A 1t0h_B 1t0j_B 1t0h_A 1t0j_A | Back alignment and structure |
|---|
| >3pvl_A Myosin VIIA isoform 1; protein complex, novel folding, protein cargo binding, cargo proteins, motor protein-protein transport complex; 2.80A {Mus musculus} | Back alignment and structure |
|---|
| >3kfv_A Tight junction protein ZO-3; structural genomics consortium, SGC, cell junction, cell membrane, membrane, SH3 domain; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B | Back alignment and structure |
|---|
| >3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A | Back alignment and structure |
|---|
| >3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens} | Back alignment and structure |
|---|
| >3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2q12_A DIP13 alpha, DCC-interacting protein 13 alpha; APPL1, BAR domain, protein transport; 1.79A {Homo sapiens} PDB: 2z0n_A | Back alignment and structure |
|---|
| >3tvt_A Disks large 1 tumor suppressor protein; DLG, SRC-homology-3, guanylate kinase, phosphorylation-depen cell membrane; 1.60A {Drosophila melanogaster} PDB: 3uat_A* | Back alignment and structure |
|---|
| >2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A | Back alignment and structure |
|---|
| >4h8s_A DCC-interacting protein 13-beta; BAR domain, pleckstrin homology domain, adaptor protein, RAB signaling protein; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >4dyl_A Tyrosine-protein kinase FES/FPS; structural genomics, structural genomics consortium, BCR, CR associated substrate, transferase; 2.18A {Homo sapiens} | Back alignment and structure |
|---|
| >2fic_A Bridging integrator 1; BAR domain, homodimer, coiled-coils, endocytosis/exocytosis, protein complex, endocytosis-exocytosis; 1.99A {Homo sapiens} PDB: 2rmy_A 2rnd_A | Back alignment and structure |
|---|
| >2efl_A Formin-binding protein 1; EFC domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.61A {Homo sapiens} SCOP: a.238.1.4 | Back alignment and structure |
|---|
| >2efk_A CDC42-interacting protein 4; EFC domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.30A {Homo sapiens} SCOP: a.238.1.4 | Back alignment and structure |
|---|
| >1uru_A Amphiphysin; endocytosis, coiled-coil, membrane curvature; 2.6A {Drosophila melanogaster} SCOP: a.238.1.1 | Back alignment and structure |
|---|
| >3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} | Back alignment and structure |
|---|
| >1zww_A SH3-containing GRB2-like protein 2; coiled coil, transferase; 2.30A {Mus musculus} SCOP: a.238.1.1 PDB: 1x03_A 2d4c_A 1x04_A 2c08_A | Back alignment and structure |
|---|
| >2z0v_A SH3-containing GRB2-like protein 3; helix bundle, alternative splicing, coiled coil, SH3 domain, endocytosis, structural genomics, NPPSFA; 2.49A {Homo sapiens} | Back alignment and structure |
|---|
| >2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} | Back alignment and structure |
|---|
| >4avm_A Bridging integrator 2; protein binding, plasma membrane, BAR adaptor; 1.91A {Homo sapiens} | Back alignment and structure |
|---|
| >1i4d_A Arfaptin 2, partner of RAC1; coiled coil, G-protein, complex, signaling protein; HET: GDP; 2.50A {Homo sapiens} SCOP: a.238.1.2 PDB: 1i49_A* 1i4l_A* 1i4t_A* | Back alignment and structure |
|---|
| >1urf_A Protein kinase C-like 1; transferase, G-protein, HR1 domain, helical, coiled coil, ATP-binding, serine/threonine-protein kinase, phosphorylation; NMR {Homo sapiens} SCOP: a.2.6.1 PDB: 2rmk_B* | Back alignment and structure |
|---|
| >2kt8_A Probable surface protein; SH3 family, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; NMR {Clostridium perfringens} PDB: 2kyb_A | Back alignment and structure |
|---|
| >4akv_A Sorting nexin-33; transport protein, organelle biogenesis; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2krs_A Probable enterotoxin; all beta, SH3, ENTD, CPF_0587, CPE0606, structural genomics, PSI-2, protein structure initiative; NMR {Clostridium perfringens} | Back alignment and structure |
|---|
| >3dyt_A Sorting nexin-9; 3-helix bundle, BAR domain, PX domain, phosphoprotein, protein transport, SH3 domain, transport, transport protein; 2.08A {Homo sapiens} PDB: 3dyu_A 2raj_A 2rai_A 2rak_A* | Back alignment and structure |
|---|
| >2v0o_A FCHO2, FCH domain only protein 2; lipid-binding protein, EFC domain, vesicle trafficking, membrane curvature, endocytosis, exocytosis, F-BAR domain; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3aco_A Pacsin2, protein kinase C and casein kinase substrate in neurons protein 2; helix bundle, coiled-coil, endocytosis; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3qwe_A GMIP, GEM-interacting protein; structural genomics consortium, SGC, protein binding; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2kq8_A Cell WALL hydrolase; GFT protein structure, NESG, PSI, SH3 domain, structural genomics, protein structure initiative; NMR {Bacillus thuringiensis serovarkonkukian} | Back alignment and structure |
|---|
| >1cxz_B Protein (PKN); protein-protein complex, antiparallel coiled-coil, signaling protein; HET: GSP; 2.20A {Homo sapiens} SCOP: a.2.6.1 | Back alignment and structure |
|---|
| >1wfw_A Kalirin-9A; SH3 domain, neuron-specific GDP/GTP exchange factor, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2jmc_A Spectrin alpha chain, brain and P41 peptide chimera; SPC-SH3, signaling protein; NMR {Gallus gallus} | Back alignment and structure |
|---|
| >2x3v_A Syndapin I, protein kinase C and casein kinase substrate in N protein 1; BAR, N-WAsp, dynamin, pacsin 1, endocytosis; 2.45A {Mus musculus} PDB: 2x3w_A 2x3x_A | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2ykt_A Brain-specific angiogenesis inhibitor 1-associate protein 2; signaling protein, NPY motif, binding pocket; 2.11A {Homo sapiens} PDB: 1y2o_A 1wdz_A | Back alignment and structure |
|---|
| >3i2w_A Syndapin, LD46328P; EFC, FBAR, SH3 domain, endocytosis; 2.67A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 649 | ||||
| d2efla1 | 288 | a.238.1.4 (A:1-288) Formin-binding protein 1, FNBP | 3e-51 | |
| d2efka1 | 279 | a.238.1.4 (A:10-288) CDC42-interacting protein 4, | 1e-50 | |
| d1jo8a_ | 58 | b.34.2.1 (A:) Actin binding protein ABP1 {Baker's | 6e-11 | |
| d1u5sa1 | 71 | b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [Tax | 5e-10 | |
| d1gria1 | 56 | b.34.2.1 (A:1-56) Growth factor receptor-bound pro | 7e-10 | |
| d1k9aa1 | 71 | b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (cs | 9e-10 | |
| d1efna_ | 57 | b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, | 1e-09 | |
| d1ugva_ | 72 | b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA062 | 1e-09 | |
| d1arka_ | 60 | b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo | 1e-09 | |
| d1oota_ | 58 | b.34.2.1 (A:) Hypothetical protein YFR024c {Baker' | 1e-09 | |
| d1fmka1 | 64 | b.34.2.1 (A:82-145) c-src protein tyrosine kinase | 1e-09 | |
| d1zuua1 | 56 | b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyc | 2e-09 | |
| d2iima1 | 62 | b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 d | 5e-09 | |
| d1gcqa_ | 56 | b.34.2.1 (A:) Growth factor receptor-bound protein | 5e-09 | |
| d1bb9a_ | 83 | b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicu | 6e-09 | |
| d1qcfa1 | 65 | b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Hu | 7e-09 | |
| d1utia_ | 57 | b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona | 7e-09 | |
| d1opka1 | 57 | b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domai | 8e-09 | |
| d1awwa_ | 67 | b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Hom | 1e-08 | |
| d2hspa_ | 71 | b.34.2.1 (A:) Phospholipase C, SH3 domain {Human ( | 2e-08 | |
| d1uhca_ | 79 | b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIA | 2e-08 | |
| d1u06a1 | 55 | b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chic | 2e-08 | |
| d1ycsb2 | 63 | b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [ | 3e-08 | |
| d1udla_ | 98 | b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom | 3e-08 | |
| d1j3ta_ | 74 | b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom | 3e-08 | |
| d1uj0a_ | 58 | b.34.2.1 (A:) Signal transducing adaptor molecule | 5e-08 | |
| d1sema_ | 58 | b.34.2.1 (A:) Growth factor receptor-bound protein | 9e-08 | |
| d1ckaa_ | 57 | b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse | 1e-07 | |
| d1gl5a_ | 67 | b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musc | 1e-07 | |
| d2d4ca1 | 237 | a.238.1.1 (A:11-247) Endophilin-1 {Human (Homo sap | 1e-07 | |
| d1k4us_ | 62 | b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId | 1e-07 | |
| d1ujya_ | 76 | b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens | 2e-07 | |
| d1i07a_ | 59 | b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus | 2e-07 | |
| d2v1ra1 | 67 | b.34.2.1 (A:10-76) Peroxisomal membrane protein Pe | 2e-07 | |
| d1uhfa_ | 69 | b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom | 2e-07 | |
| d1ue9a_ | 80 | b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom | 3e-07 | |
| d1spka_ | 72 | b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RI | 4e-07 | |
| d1uffa_ | 93 | b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom | 9e-07 | |
| d2rn8a1 | 53 | b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus | 1e-06 | |
| d1gcqc_ | 69 | b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mu | 4e-06 | |
| d1ng2a1 | 58 | b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic | 6e-06 | |
| d1phta_ | 83 | b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-a | 2e-05 | |
| d1i1ja_ | 106 | b.34.2.1 (A:) Melanoma inhibitory activity protein | 2e-05 | |
| d1wfwa_ | 74 | b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [Ta | 7e-05 | |
| d1ng2a2 | 118 | b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic | 1e-04 | |
| d1wlpb1 | 53 | b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic | 4e-04 | |
| d1cxzb_ | 86 | a.2.6.1 (B:) Protein kinase c-like 1, pkn/prk1 {Hu | 7e-04 | |
| d1urfa_ | 81 | a.2.6.1 (A:) Protein kinase c-like 1, pkn/prk1 {Hu | 0.001 | |
| d1ug1a_ | 92 | b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIA | 0.002 |
| >d2efla1 a.238.1.4 (A:1-288) Formin-binding protein 1, FNBP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: BAR/IMD domain-like superfamily: BAR/IMD domain-like family: FCH domain domain: Formin-binding protein 1, FNBP1 species: Human (Homo sapiens) [TaxId: 9606]
Score = 176 bits (448), Expect = 3e-51
Identities = 126/335 (37%), Positives = 194/335 (57%), Gaps = 56/335 (16%)
Query: 2 FQDQYDNLSLHTQKGIDFLEKYGHFIRDRCAIEMEYAGKLRRLVKNYQPKK---EEEDYQ 58
DQ+DNL HTQ GID LEKY F+++R IE+ YA +LR L K YQPKK EEE+Y+
Sbjct: 7 LWDQFDNLEKHTQWGIDILEKYIKFVKERTEIELSYAKQLRNLSKKYQPKKNSKEEEEYK 66
Query: 59 YSTCKAFKCVLDEVTDLAGQHEVIAENLQVFIIKEVTIFVKDFKEERKKHLQDGARMMNL 118
Y++CKAF L+E+ D AGQHEVI+EN+ II ++ +V++ K+ERK + DG +
Sbjct: 67 YTSCKAFISNLNEMNDYAGQHEVISENMASQIIVDLARYVQELKQERKSNFHDGRK---- 122
Query: 119 LENQVIALERARKNYDKAYRESDKALEHYKRADADLELSRAEHLQDGDHLMKILRNQVDA 178
+ +
Sbjct: 123 -------------------------------------------------AQQHIETCWKQ 133
Query: 179 LERALKNYEKAFRDADKALEHYKRADADLELSRAEVEKQRINMAIKSQHCEDTKTEYANQ 238
LE + + +E+ ++AD+A +++++ DAD+ +++A+VEK R I+ Q ED+K +Y++
Sbjct: 134 LESSKRRFERDCKEADRAQQYFEKMDADINVTKADVEKARQQAQIRHQMAEDSKADYSSI 193
Query: 239 LQRANEMQRQHYTQAMPEVFAQLQELDEKRVRNIRNFMVHSANIEKKVFPIINQCLDGII 298
LQ+ N Q ++Y +P +F ++QE++E+R+ + M A ++++V PII +CLDGI+
Sbjct: 194 LQKFNHEQHEYYHTHIPNIFQKIQEMEERRIVRMGESMKTYAEVDRQVIPIIGKCLDGIV 253
Query: 299 KAADQINEKEDSALVIERYKSGFTPPGDIPFEDLS 333
KAA+ I++K DS LVIE YKSGF PPGDI FED +
Sbjct: 254 KAAESIDQKNDSQLVIEAYKSGFEPPGDIEFEDYT 288
|
| >d2efka1 a.238.1.4 (A:10-288) CDC42-interacting protein 4, CIP4 {Human (Homo sapiens) [TaxId: 9606]} Length = 279 | Back information, alignment and structure |
|---|
| >d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 58 | Back information, alignment and structure |
|---|
| >d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 | Back information, alignment and structure |
|---|
| >d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} Length = 72 | Back information, alignment and structure |
|---|
| >d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} Length = 60 | Back information, alignment and structure |
|---|
| >d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 58 | Back information, alignment and structure |
|---|
| >d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 64 | Back information, alignment and structure |
|---|
| >d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 | Back information, alignment and structure |
|---|
| >d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 62 | Back information, alignment and structure |
|---|
| >d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 83 | Back information, alignment and structure |
|---|
| >d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 | Back information, alignment and structure |
|---|
| >d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 | Back information, alignment and structure |
|---|
| >d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 67 | Back information, alignment and structure |
|---|
| >d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 55 | Back information, alignment and structure |
|---|
| >d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 | Back information, alignment and structure |
|---|
| >d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 | Back information, alignment and structure |
|---|
| >d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} Length = 58 | Back information, alignment and structure |
|---|
| >d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 | Back information, alignment and structure |
|---|
| >d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 | Back information, alignment and structure |
|---|
| >d2d4ca1 a.238.1.1 (A:11-247) Endophilin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 237 | Back information, alignment and structure |
|---|
| >d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} Length = 62 | Back information, alignment and structure |
|---|
| >d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 | Back information, alignment and structure |
|---|
| >d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 | Back information, alignment and structure |
|---|
| >d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 67 | Back information, alignment and structure |
|---|
| >d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 69 | Back information, alignment and structure |
|---|
| >d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 80 | Back information, alignment and structure |
|---|
| >d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 | Back information, alignment and structure |
|---|
| >d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} Length = 53 | Back information, alignment and structure |
|---|
| >d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 69 | Back information, alignment and structure |
|---|
| >d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 58 | Back information, alignment and structure |
|---|
| >d1phta_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 83 | Back information, alignment and structure |
|---|
| >d1i1ja_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} Length = 74 | Back information, alignment and structure |
|---|
| >d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 | Back information, alignment and structure |
|---|
| >d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 53 | Back information, alignment and structure |
|---|
| >d1cxzb_ a.2.6.1 (B:) Protein kinase c-like 1, pkn/prk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 86 | Back information, alignment and structure |
|---|
| >d1urfa_ a.2.6.1 (A:) Protein kinase c-like 1, pkn/prk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 81 | Back information, alignment and structure |
|---|
| >d1ug1a_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Length = 92 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 649 | |||
| d2efla1 | 288 | Formin-binding protein 1, FNBP1 {Human (Homo sapie | 100.0 | |
| d2efka1 | 279 | CDC42-interacting protein 4, CIP4 {Human (Homo sap | 100.0 | |
| d1k9aa1 | 71 | Carboxyl-terminal src kinase (csk) {Human (Homo sa | 99.55 | |
| d1jo8a_ | 58 | Actin binding protein ABP1 {Baker's yeast (Sacchar | 99.53 | |
| d1gria1 | 56 | Growth factor receptor-bound protein 2 (GRB2), N- | 99.52 | |
| d1i07a_ | 59 | EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 1009 | 99.51 | |
| d1u5sa1 | 71 | Nck-2 {Human (Homo sapiens) [TaxId: 9606]} | 99.51 | |
| d1utia_ | 57 | Grb2-related adaptor protein 2 (Mona/Gads) {Mouse | 99.5 | |
| d1ycsb2 | 63 | 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | 99.5 | |
| d2rn8a1 | 53 | Bruton's tyrosine kinase {Mus musculus [TaxId: 100 | 99.49 | |
| d1zuua1 | 56 | BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 99.49 | |
| d1ckaa_ | 57 | C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) | 99.48 | |
| d2v1ra1 | 67 | Peroxisomal membrane protein Pex13p {Baker's yeast | 99.48 | |
| d1uj0a_ | 58 | Signal transducing adaptor molecule Stam2 {Mouse ( | 99.48 | |
| d1ugva_ | 72 | Olygophrenin-1 like protein (KIAA0621) {Human (Hom | 99.47 | |
| d1gcqa_ | 56 | Growth factor receptor-bound protein 2 (GRB2), N- | 99.46 | |
| d1sema_ | 58 | Growth factor receptor-bound protein 2 (GRB2), N- | 99.46 | |
| d1oota_ | 58 | Hypothetical protein YFR024c {Baker's yeast (Sacch | 99.46 | |
| d1efna_ | 57 | Fyn proto-oncogene tyrosine kinase, SH3 domain {Hu | 99.46 | |
| d1ng2a1 | 58 | p47pox (neutrophil cytosolic factor 1) {Human (Hom | 99.45 | |
| d1opka1 | 57 | Abl tyrosine kinase, SH3 domain {Mouse (Mus muscul | 99.45 | |
| d1u06a1 | 55 | alpha-Spectrin, SH3 domain {Chicken (Gallus gallus | 99.45 | |
| d1fmka1 | 64 | c-src protein tyrosine kinase {Human (Homo sapiens | 99.45 | |
| d1awwa_ | 67 | Bruton's tyrosine kinase {Human (Homo sapiens) [Ta | 99.45 | |
| d1arka_ | 60 | SH3 domain from nebulin {Human (Homo sapiens) [Tax | 99.44 | |
| d1gl5a_ | 67 | tyrosine kinase tec {Mouse (Mus musculus) [TaxId: | 99.44 | |
| d1k4us_ | 62 | p67phox {Human (Homo sapiens) [TaxId: 9606]} | 99.43 | |
| d1udla_ | 98 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 99.43 | |
| d1spka_ | 72 | BAI1-associated protein 2-like 1 (RIKEN cDNA 13000 | 99.42 | |
| d1wiea_ | 96 | RIM binding protein 2, RIMBP2 {Human (Homo sapiens | 99.42 | |
| d1wlpb1 | 53 | p47pox (neutrophil cytosolic factor 1) {Human (Hom | 99.41 | |
| d1wfwa_ | 74 | Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} | 99.39 | |
| d2hspa_ | 71 | Phospholipase C, SH3 domain {Human (Homo sapiens) | 99.39 | |
| d1ug1a_ | 92 | Hypothetical protein Baa76854.1 (KIAA1010) {Human | 99.38 | |
| d1ng2a2 | 118 | p47pox (neutrophil cytosolic factor 1) {Human (Hom | 99.37 | |
| d1j3ta_ | 74 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 99.37 | |
| d2iima1 | 62 | p56-lck tyrosine kinase, SH3 domain {Human (Homo s | 99.37 | |
| d1qcfa1 | 65 | Hemapoetic cell kinase Hck {Human (Homo sapiens) [ | 99.37 | |
| d1uhfa_ | 69 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 99.35 | |
| d1ujya_ | 76 | Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606 | 99.34 | |
| d1ue9a_ | 80 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 99.33 | |
| d1uhca_ | 79 | Hypothetical protein Baa76854.1 (KIAA1010) {Human | 99.32 | |
| d1phta_ | 83 | Phosphatidylinositol 3-kinase (p85-alpha subunit, | 99.31 | |
| d1uffa_ | 93 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 99.27 | |
| d1i1ja_ | 106 | Melanoma inhibitory activity protein {Human (Homo | 99.25 | |
| d1bb9a_ | 83 | Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 101 | 99.24 | |
| d1gcqc_ | 69 | Vav N-terminal SH3 domain {Mouse (Mus musculus) [T | 99.23 | |
| d1t0ha_ | 96 | SH3-like domain of the L-type calcium channel {Rab | 99.19 | |
| d1kjwa1 | 96 | Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} | 99.11 | |
| d1vyva1 | 145 | SH3-like domain of the L-type calcium channel {Rat | 98.91 | |
| d1vyua1 | 136 | SH3-like domain of the L-type calcium channel {Rat | 98.75 | |
| d2elba1 | 268 | DCC-interacting protein 13-alpha, APPL1 {Human (Ho | 98.2 | |
| d1y2oa1 | 248 | BAP2/IRSp53 N-terminal domain {Human (Homo sapiens | 97.7 | |
| d2d4ca1 | 237 | Endophilin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.61 | |
| d1urua_ | 217 | Amphiphysin {Fruit fly (Drosophila melanogaster) [ | 97.42 | |
| d2efla1 | 288 | Formin-binding protein 1, FNBP1 {Human (Homo sapie | 96.74 | |
| d1ri9a_ | 77 | Fyn-binding protein (T-cell adapter protein adap) | 96.66 | |
| d1i4da_ | 200 | Arfaptin, Rac-binding fragment {Human (Homo sapien | 96.66 | |
| d2efka1 | 279 | CDC42-interacting protein 4, CIP4 {Human (Homo sap | 96.53 | |
| d1urfa_ | 81 | Protein kinase c-like 1, pkn/prk1 {Human (Homo sap | 96.45 | |
| d1cxzb_ | 86 | Protein kinase c-like 1, pkn/prk1 {Human (Homo sap | 93.98 | |
| d1i4da_ | 200 | Arfaptin, Rac-binding fragment {Human (Homo sapien | 90.28 |
| >d2efla1 a.238.1.4 (A:1-288) Formin-binding protein 1, FNBP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: BAR/IMD domain-like superfamily: BAR/IMD domain-like family: FCH domain domain: Formin-binding protein 1, FNBP1 species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=2.7e-43 Score=362.52 Aligned_cols=279 Identities=45% Similarity=0.801 Sum_probs=262.8
Q ss_pred ccchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcCCcc---cccccccHHHHHHHHHHHHHHHHHH
Q psy10868 2 FQDQYDNLSLHTQKGIDFLEKYGHFIRDRCAIEMEYAGKLRRLVKNYQPKKE---EEDYQYSTCKAFKCVLDEVTDLAGQ 78 (649)
Q Consensus 2 L~Dgf~~L~~~~~~gi~~~e~l~~f~keRa~iE~eYAk~L~kLakk~~~~~~---~~~~~~t~~~aw~~ll~e~~~~A~~ 78 (649)
|||||+.|.+|+++|+.+|++|..||++||+||.+||++|.+|+++|..+.. .....+|+..+|..++.++..+|..
T Consensus 7 l~d~~~~l~~~~~~~~~~~~~~~~~~~eRa~iE~eYak~L~kl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~ 86 (288)
T d2efla1 7 LWDQFDNLEKHTQWGIDILEKYIKFVKERTEIELSYAKQLRNLSKKYQPKKNSKEEEEYKYTSCKAFISNLNEMNDYAGQ 86 (288)
T ss_dssp TTTCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTSCC-------CTTSHHHHHHHHHHHHHHHHHHH
T ss_pred hHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhccccccccccCcHHHHHHHHHHHHHHHHHH
Confidence 8999999999999999999999999999999999999999999999987642 2234568999999999999999999
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhHhhhh
Q psy10868 79 HEVIAENLQVFIIKEVTIFVKDFKEERKKHLQDGARMMNLLENQVIALERARKNYDKAYRESDKALEHYKRADADLELSR 158 (649)
Q Consensus 79 H~~lae~L~~~v~~~L~~~~~e~~~~rK~~~~~~~kl~~~l~~~~~~l~k~kk~y~~~~~e~~~a~~~~~ka~~~l~~~r 158 (649)
|..+|+.|..+|++||..+.+++++.||++..++.+++
T Consensus 87 h~~~a~~l~~~i~~~l~~~~~~~~~~~K~~~~~~~k~~------------------------------------------ 124 (288)
T d2efla1 87 HEVISENMASQIIVDLARYVQELKQERKSNFHDGRKAQ------------------------------------------ 124 (288)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH------------------------------------------
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH------------------------------------------
Confidence 99999999999999999999999999999999998887
Q ss_pred hhhcccchhHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHhhhhhhcCHHHHHHHHHHHHHHHHHHHHhHHHHHHH
Q psy10868 159 AEHLQDGDHLMKILRNQVDALERALKNYEKAFRDADKALEHYKRADADLELSRAEVEKQRINMAIKSQHCEDTKTEYANQ 238 (649)
Q Consensus 159 ~~~~~~~~~~~k~l~~~~~~l~KaKk~Y~~~~re~e~a~~k~~ka~~d~~~sk~eleK~~~k~~~~~~~~~~ak~eY~~~ 238 (649)
+.+......+.++++.|...|++++.++..++++..+...++.+++|+..++..+...+.+|+++|..+
T Consensus 125 -----------k~~~~~~~~l~k~k~~Y~~~~~e~e~~~~~~~~~~~~~~~~~~~~~K~~~k~~~~~~~~~~a~~~Y~~~ 193 (288)
T d2efla1 125 -----------QHIETCWKQLESSKRRFERDCKEADRAQQYFEKMDADINVTKADVEKARQQAQIRHQMAEDSKADYSSI 193 (288)
T ss_dssp -----------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCTTSCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred -----------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhccccccchHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 556666777888888899999999999999999988889999999999999999999999999999999
Q ss_pred HHHHHHHhHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhcchHHHHHHHHHHHHhhChHhHHHHHHHHhc
Q psy10868 239 LQRANEMQRQHYTQAMPEVFAQLQELDEKRVRNIRNFMVHSANIEKKVFPIINQCLDGIIKAADQINEKEDSALVIERYK 318 (649)
Q Consensus 239 l~~~N~~q~~~y~~~mp~i~~~lQ~lee~Ri~~lk~~l~~y~~~~~~~~~~~~~~~~~l~~~~~~Id~~~D~~~fi~~~~ 318 (649)
|..+|..+..||.++||.+++.||.+|++|+..|+++|..|+.++..+++.+..+++.|...++.|||..|++.||+.++
T Consensus 194 v~~~n~~~~~~~~~~~~~~~~~~q~~e~~r~~~~k~~l~~~~~~~~~~~~~~~~~~~~l~~~~~~id~~~D~~~fi~~~~ 273 (288)
T d2efla1 194 LQKFNHEQHEYYHTHIPNIFQKIQEMEERRIVRMGESMKTYAEVDRQVIPIIGKCLDGIVKAAESIDQKNDSQLVIEAYK 273 (288)
T ss_dssp HHHHHHHHHHHHHTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTHHHHHHHHHHHHHHHHHTCCHHHHHHHHHHHHC
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHCCHHHHHHHHHHHcC
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCCCCCCCcccccCC
Q psy10868 319 SGFTPPGDIPFEDLS 333 (649)
Q Consensus 319 s~~~~P~~~~FE~~~ 333 (649)
+|+++|++|+||||+
T Consensus 274 t~~~~p~~~~fe~y~ 288 (288)
T d2efla1 274 SGFEPPGDIEFEDYT 288 (288)
T ss_dssp CCCCCCCCCCCCCCC
T ss_pred CCCCCCCCCCCcCCC
Confidence 999999999999985
|
| >d2efka1 a.238.1.4 (A:10-288) CDC42-interacting protein 4, CIP4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wiea_ b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ug1a_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1phta_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i1ja_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1vyva1 b.34.2.1 (A:71-215) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1vyua1 b.34.2.1 (A:39-174) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2elba1 a.238.1.1 (A:6-273) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y2oa1 a.238.1.3 (A:1-248) BAP2/IRSp53 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d4ca1 a.238.1.1 (A:11-247) Endophilin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1urua_ a.238.1.1 (A:) Amphiphysin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2efla1 a.238.1.4 (A:1-288) Formin-binding protein 1, FNBP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ri9a_ b.34.2.1 (A:) Fyn-binding protein (T-cell adapter protein adap) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i4da_ a.238.1.2 (A:) Arfaptin, Rac-binding fragment {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2efka1 a.238.1.4 (A:10-288) CDC42-interacting protein 4, CIP4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1urfa_ a.2.6.1 (A:) Protein kinase c-like 1, pkn/prk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cxzb_ a.2.6.1 (B:) Protein kinase c-like 1, pkn/prk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i4da_ a.238.1.2 (A:) Arfaptin, Rac-binding fragment {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|