Psyllid ID: psy10959

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130--

MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

cccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccHHHHHccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEcHHHHHHHHHHHcccc

cccccHcHcccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccccEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEcHHHHHHHHHHccccc

martkqtarkstggkaprkQLATKAarksapstggvkkphrTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

martkqtarkstggkaprkqlatkaarksapstggvkkphrtvalREIRRYQKstellirklpfqRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIhakrvtimpkdiqlarrirgera

MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

******************************************VALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLA********

MART*********************************KPHRTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGE**

****************************************RTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

**************************************PHRTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIR****

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		132	2.2.26 [Sep-21-2011]
Q6P823		136	Histone H3.3 OS=Xenopus t	yes	N/A	1.0	0.970	0.970	6e-69
Q6PI79		136	Histone H3.3 OS=Xenopus l	N/A	N/A	1.0	0.970	0.970	6e-69
P84248		136	Histone H3.3 OS=Spisula s	N/A	N/A	1.0	0.970	0.970	6e-69
P84245		136	Histone H3.3 OS=Rattus no	yes	N/A	1.0	0.970	0.970	6e-69
P84246		136	Histone H3.3 OS=Oryctolag	yes	N/A	1.0	0.970	0.970	6e-69
Q71LE2		136	Histone H3.3 OS=Sus scrof	yes	N/A	1.0	0.970	0.970	6e-69
P84244		136	Histone H3.3 OS=Mus muscu	yes	N/A	1.0	0.970	0.970	6e-69
P84243		136	Histone H3.3 OS=Homo sapi	yes	N/A	1.0	0.970	0.970	6e-69
P84249		136	Histone H3.3 OS=Drosophil	yes	N/A	1.0	0.970	0.970	6e-69
P84250		136	Histone H3.3 OS=Drosophil	N/A	N/A	1.0	0.970	0.970	6e-69

>sp\|Q6P823\|H33_XENTR Histone H3.3 OS=Xenopus tropicalis GN=TGas113e22.1 PE=1 SV=3	Back alignment and function desciption

 Score =  258 bits (660), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 132/136 (97%), Gaps = 4/136 (2%)

Query: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHR----TVALREIRRYQKSTE 56
           MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHR    TVALREIRRYQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE 60

Query: 57  LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI 116
           LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI 120

Query: 117 MPKDIQLARRIRGERA 132
           MPKDIQLARRIRGERA
Sbjct: 121 MPKDIQLARRIRGERA 136

Variant histone H3 which replaces conventional H3 in a wide range of nucleosomes in active genes. Constitutes the predominant form of histone H3 in non-dividing cells and is incorporated into chromatin independently of DNA synthesis. Deposited at sites of nucleosomal displacement throughout transcribed genes, suggesting that it represents an epigenetic imprint of transcriptionally active chromatin. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
Xenopus tropicalis (taxid: 8364)

>sp\|Q6PI79\|H33_XENLA Histone H3.3 OS=Xenopus laevis PE=1 SV=3	Back alignment and function description

>sp\|P84248\|H33_SPISO Histone H3.3 OS=Spisula solidissima PE=1 SV=2	Back alignment and function description

>sp\|P84245\|H33_RAT Histone H3.3 OS=Rattus norvegicus GN=H3f3b PE=1 SV=2	Back alignment and function description

>sp\|P84246\|H33_RABIT Histone H3.3 OS=Oryctolagus cuniculus GN=H3F3A PE=2 SV=2	Back alignment and function description

>sp\|Q71LE2\|H33_PIG Histone H3.3 OS=Sus scrofa GN=H3F3A PE=2 SV=3	Back alignment and function description

>sp\|P84244\|H33_MOUSE Histone H3.3 OS=Mus musculus GN=H3f3a PE=1 SV=2	Back alignment and function description

>sp\|P84243\|H33_HUMAN Histone H3.3 OS=Homo sapiens GN=H3F3A PE=1 SV=2	Back alignment and function description

>sp\|P84249\|H33_DROME Histone H3.3 OS=Drosophila melanogaster GN=His3.3A PE=1 SV=2	Back alignment and function description

>sp\|P84250\|H33_DROHY Histone H3.3 OS=Drosophila hydei GN=His3.3A PE=3 SV=2	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		132
4504279		136	histone H3.3 [Homo sapiens] gi\|4885385\|r	1.0	0.970	0.970	5e-67
334359125		139	Chain A, The Human Nucleosome Structure	1.0	0.949	0.970	6e-67
225703532		136	Histone H3.3 [Oncorhynchus mykiss]	1.0	0.970	0.963	7e-67
256086246		136	histone H3 [Schistosoma mansoni] gi\|5675	1.0	0.970	0.963	7e-67
307204446		205	Histone H3.3 [Harpegnathos saltator]	1.0	0.643	0.970	8e-67
225704818		136	Histone H3.3 [Oncorhynchus mykiss]	1.0	0.970	0.963	9e-67
45384744		136	histone H3.3B [Chinchilla lanigera]	1.0	0.970	0.963	1e-66
221221048		136	Histone H3.3 [Salmo salar]	1.0	0.970	0.963	1e-66
126697402		136	histone H3 [Haliotis discus discus] gi\|2	1.0	0.970	0.963	1e-66
189053462		136	unnamed protein product [Homo sapiens]	1.0	0.970	0.963	1e-66

>gi|4504279|ref|NP_002098.1| histone H3.3 [Homo sapiens] gi|4885385|ref|NP_005315.1| histone H3.3 [Homo sapiens] gi|6680159|ref|NP_032236.1| histone H3.3 [Mus musculus] gi|6680161|ref|NP_032237.1| histone H3.3 [Mus musculus] gi|16758888|ref|NP_446437.1| histone H3.3 [Rattus norvegicus] gi|17530867|ref|NP_511095.1| histone H3.3B, isoform A [Drosophila melanogaster] gi|17647507|ref|NP_523479.1| histone H3.3A, isoform A [Drosophila melanogaster] gi|24640743|ref|NP_727314.1| histone H3.3B, isoform B [Drosophila melanogaster] gi|28571378|ref|NP_788892.1| histone H3.3B, isoform C [Drosophila melanogaster] gi|41053381|ref|NP_956297.1| H3 histone, family 3C [Danio rerio] gi|41055417|ref|NP_957395.1| H3 histone, family 3D [Danio rerio] gi|45360705|ref|NP_989026.1| histone H3.3 [Xenopus (Silurana) tropicalis] gi|46048708|ref|NP_990627.1| histone H3.3 [Gallus gallus] gi|47522626|ref|NP_999095.1| histone H3.3 [Sus scrofa] gi|52346112|ref|NP_001005101.1| H3 histone, family 3A [Xenopus (Silurana) tropicalis] gi|62177168|ref|NP_001014411.1| histone H3.3 [Bos taurus] gi|62955167|ref|NP_001017599.1| histone H3.3 [Danio rerio] gi|147906226|ref|NP_001080065.1| H3 histone, family 3B (H3.3B) [Xenopus laevis] gi|148231893|ref|NP_001086074.1| histone cluster 2, H3d [Xenopus laevis] gi|148233109|ref|NP_001085048.1| H3 histone, family 3B (H3.3B) [Xenopus laevis] gi|148236021|ref|NP_001079375.1| histone H3.3 [Xenopus laevis] gi|148298806|ref|NP_001091756.1| h3 histone family 3a [Bombyx mori] gi|148539598|ref|NP_001091902.1| H3 histone, family 3A [Xenopus laevis] gi|148727266|ref|NP_001092038.1| histone cluster 1, H3a [Pan troglodytes] gi|281182698|ref|NP_001162389.1| histone H3.1 [Papio anubis] gi|283806664|ref|NP_001164583.1| histone H3.3 [Oryctolagus cuniculus] gi|308818211|ref|NP_001184227.1| H3 histone, family 3A member [Taeniopygia guttata] gi|308818224|ref|NP_001184233.1| H3 histone, family 3A member [Taeniopygia guttata] gi|325197159|ref|NP_001191424.1| histone 3 [Aplysia californica] gi|336020387|ref|NP_001229500.1| H3 histone, family 3B [Bos taurus] gi|442615645|ref|NP_001259374.1| histone H3.3B, isoform D [Drosophila melanogaster] gi|442626113|ref|NP_001260082.1| histone H3.3A, isoform C [Drosophila melanogaster] gi|442626115|ref|NP_723056.2| histone H3.3A, isoform D [Drosophila melanogaster] gi|31241623|ref|XP_321242.1| AGAP001813-PA [Anopheles gambiae str. PEST] gi|57089073|ref|XP_537232.1| PREDICTED: histone H3.3 isoform 1 [Canis lupus familiaris] gi|66565026|ref|XP_624499.1| PREDICTED: histone H3.3-like isoform 2 [Apis mellifera] gi|73964884|ref|XP_858804.1| PREDICTED: histone H3.3 isoform 4 [Canis lupus familiaris] gi|91089509|ref|XP_975889.1| PREDICTED: similar to Histone H3.3B CG8989-PA isoform 2 [Tribolium castaneum] gi|109018064|ref|XP_001091581.1| PREDICTED: histone H3.3-like isoform 1 [Macaca mulatta] gi|109018066|ref|XP_001091695.1| PREDICTED: histone H3.3-like isoform 2 [Macaca mulatta] gi|109018068|ref|XP_001091816.1| PREDICTED: histone H3.3-like isoform 3 [Macaca mulatta] gi|109018072|ref|XP_001092054.1| PREDICTED: histone H3.3-like isoform 5 [Macaca mulatta] gi|109019307|ref|XP_001083683.1| PREDICTED: histone H3.3-like [Macaca mulatta] gi|109118262|ref|XP_001099829.1| PREDICTED: histone H3.3-like isoform 1 [Macaca mulatta] gi|109118272|ref|XP_001100109.1| PREDICTED: histone H3.3-like isoform 2 [Macaca mulatta] gi|110765924|ref|XP_001120696.1| PREDICTED: histone H3.3-like isoform 1 [Apis mellifera] gi|125984400|ref|XP_001355964.1| GA19158 [Drosophila pseudoobscura pseudoobscura] gi|126306915|ref|XP_001368225.1| PREDICTED: histone H3.3-like [Monodelphis domestica] gi|126308438|ref|XP_001369359.1| PREDICTED: histone H3.3-like isoform 1 [Monodelphis domestica] gi|126308440|ref|XP_001369390.1| PREDICTED: histone H3.3-like isoform 2 [Monodelphis domestica] gi|149641481|ref|XP_001514538.1| PREDICTED: histone H3.3-like [Ornithorhynchus anatinus] gi|149723295|ref|XP_001495110.1| PREDICTED: histone H3.3-like isoform 1 [Equus caballus] gi|149748720|ref|XP_001489292.1| PREDICTED: histone H3.3-like [Equus caballus] gi|156548619|ref|XP_001608166.1| PREDICTED: histone H3.3-like isoform 2 [Nasonia vitripennis] gi|156548623|ref|XP_001608174.1| PREDICTED: histone H3.3-like [Nasonia vitripennis] gi|157112482|ref|XP_001657554.1| histone H3.3 [Aedes aegypti] gi|170063956|ref|XP_001867328.1| histone H3.3 type 2 [Culex quinquefasciatus] gi|170585288|ref|XP_001897416.1| Histone H3.3 [Brugia malayi] gi|170589399|ref|XP_001899461.1| Histone H3.3 [Brugia malayi] gi|193688275|ref|XP_001949472.1| PREDICTED: histone H3.3-like [Acyrthosiphon pisum] gi|194761556|ref|XP_001962995.1| GF15720 [Drosophila ananassae] gi|194769246|ref|XP_001966717.1| GF19171 [Drosophila ananassae] gi|194856509|ref|XP_001968765.1| GG25048 [Drosophila erecta] gi|194890669|ref|XP_001977366.1| GG19000 [Drosophila erecta] gi|195035003|ref|XP_001989021.1| GH11489 [Drosophila grimshawi] gi|195047686|ref|XP_001992391.1| GH24723 [Drosophila grimshawi] gi|195114260|ref|XP_002001685.1| GI16984 [Drosophila mojavensis] gi|195131317|ref|XP_002010097.1| GI14879 [Drosophila mojavensis] gi|195161310|ref|XP_002021511.1| GL26550 [Drosophila persimilis] gi|195168426|ref|XP_002025032.1| GL26831 [Drosophila persimilis] gi|195342652|ref|XP_002037914.1| GM18523 [Drosophila sechellia] gi|195355011|ref|XP_002043987.1| GM13676 [Drosophila sechellia] gi|195386334|ref|XP_002051859.1| GJ17231 [Drosophila virilis] gi|195400691|ref|XP_002058949.1| GJ15308 [Drosophila virilis] gi|195432994|ref|XP_002064500.1| GK23881 [Drosophila willistoni] gi|195447814|ref|XP_002071382.1| GK25162 [Drosophila willistoni] gi|195472777|ref|XP_002088675.1| His3.3A [Drosophila yakuba] gi|195479904|ref|XP_002101068.1| GE17412 [Drosophila yakuba] gi|195576680|ref|XP_002078203.1| GD23319 [Drosophila simulans] gi|198414843|ref|XP_002119783.1| PREDICTED: similar to Histone H3.3B CG8989-PA [Ciona intestinalis] gi|198469150|ref|XP_002134231.1| GA22698 [Drosophila pseudoobscura pseudoobscura] gi|241112266|ref|XP_002399568.1| Core histone H2A/H2B/H3/H4 [Ixodes scapularis] gi|242020435|ref|XP_002430660.1| histone H3.3 [Pediculus humanus corporis] gi|260788404|ref|XP_002589240.1| hypothetical protein BRAFLDRAFT_120760 [Branchiostoma floridae] gi|260801479|ref|XP_002595623.1| hypothetical protein BRAFLDRAFT_117519 [Branchiostoma floridae] gi|291224914|ref|XP_002732446.1| PREDICTED: histone H3.3B-like isoform 1 [Saccoglossus kowalevskii] gi|291224916|ref|XP_002732447.1| PREDICTED: histone H3.3B-like isoform 2 [Saccoglossus kowalevskii] gi|291225982|ref|XP_002732967.1| PREDICTED: histone H3.3B-like [Saccoglossus kowalevskii] gi|291402310|ref|XP_002717527.1| PREDICTED: H3 histone, family 3A [Oryctolagus cuniculus] gi|292621873|ref|XP_002664801.1| PREDICTED: histone H3.3-like isoform 2 [Danio rerio] gi|293352901|ref|XP_002728089.1| PREDICTED: histone H3.3-like [Rattus norvegicus] gi|296196732|ref|XP_002745967.1| PREDICTED: histone H3.3-like isoform 2 [Callithrix jacchus] gi|296203207|ref|XP_002748789.1| PREDICTED: histone H3.3-like isoform 1 [Callithrix jacchus] gi|296214908|ref|XP_002753910.1| PREDICTED: histone H3.3-like isoform 2 [Callithrix jacchus] gi|296228940|ref|XP_002760051.1| PREDICTED: histone H3.3-like isoform 1 [Callithrix jacchus] gi|296230284|ref|XP_002760633.1| PREDICTED: histone H3.3-like isoform 2 [Callithrix jacchus] gi|296230286|ref|XP_002760634.1| PREDICTED: histone H3.3-like isoform 3 [Callithrix jacchus] gi|297273629|ref|XP_002800646.1| PREDICTED: histone H3.3-like [Macaca mulatta] gi|297273631|ref|XP_002800647.1| PREDICTED: histone H3.3-like [Macaca mulatta] gi|297280664|ref|XP_002801958.1| PREDICTED: histone H3.3-like [Macaca mulatta] gi|297280666|ref|XP_002801959.1| PREDICTED: histone H3.3-like [Macaca mulatta] gi|297281559|ref|XP_002802116.1| PREDICTED: histone H3.3-like isoform 2 [Macaca mulatta] gi|297661840|ref|XP_002809431.1| PREDICTED: histone H3.3-like isoform 1 [Pongo abelii] gi|297661844|ref|XP_002809433.1| PREDICTED: histone H3.3-like isoform 3 [Pongo abelii] gi|297661848|ref|XP_002809435.1| PREDICTED: histone H3.3-like isoform 5 [Pongo abelii] gi|297661850|ref|XP_002809436.1| PREDICTED: histone H3.3-like isoform 6 [Pongo abelii] gi|301621375|ref|XP_002940033.1| PREDICTED: histone H3.3 [Xenopus (Silurana) tropicalis] gi|301768993|ref|XP_002919897.1| PREDICTED: histone H3.3-like [Ailuropoda melanoleuca] gi|301782657|ref|XP_002926741.1| PREDICTED: histone H3.3-like [Ailuropoda melanoleuca] gi|311266778|ref|XP_003131242.1| PREDICTED: histone H3.3-like [Sus scrofa] gi|312076177|ref|XP_003140744.1| H3 histone, family 3A [Loa loa] gi|312101016|ref|XP_003149523.1| histone H3 [Loa loa] gi|326930728|ref|XP_003211494.1| PREDICTED: histone H3.3-like [Meleagris gallopavo] gi|327262611|ref|XP_003216117.1| PREDICTED: histone H3.3-like [Anolis carolinensis] gi|327264913|ref|XP_003217253.1| PREDICTED: histone H3.3-like [Anolis carolinensis] gi|327276295|ref|XP_003222905.1| PREDICTED: histone H3.3-like [Anolis carolinensis] gi|328726781|ref|XP_003249043.1| PREDICTED: histone H3.3-like [Acyrthosiphon pisum] gi|328782845|ref|XP_003250201.1| PREDICTED: histone H3.3-like isoform 1 [Apis mellifera] gi|328782848|ref|XP_003250202.1| PREDICTED: histone H3.3-like isoform 2 [Apis mellifera] gi|332228487|ref|XP_003263420.1| PREDICTED: histone H3.3-like isoform 1 [Nomascus leucogenys] gi|332251999|ref|XP_003275139.1| PREDICTED: histone H3.3 isoform 1 [Nomascus leucogenys] gi|332252001|ref|XP_003275140.1| PREDICTED: histone H3.3 isoform 2 [Nomascus leucogenys] gi|332252007|ref|XP_003275143.1| PREDICTED: histone H3.3 isoform 5 [Nomascus leucogenys] gi|332252009|ref|XP_003275144.1| PREDICTED: histone H3.3 isoform 6 [Nomascus leucogenys] gi|332252011|ref|XP_003275145.1| PREDICTED: histone H3.3 isoform 7 [Nomascus leucogenys] gi|332260129|ref|XP_003279138.1| PREDICTED: histone H3.3 isoform 3 [Nomascus leucogenys] gi|332812065|ref|XP_003308826.1| PREDICTED: histone H3.3 isoform 1 [Pan troglodytes] gi|332812069|ref|XP_003339055.1| PREDICTED: histone H3.3 [Pan troglodytes] gi|332812071|ref|XP_003308828.1| PREDICTED: histone H3.3 isoform 3 [Pan troglodytes] gi|332812073|ref|XP_003308830.1| PREDICTED: histone H3.3 isoform 5 [Pan troglodytes] gi|332812077|ref|XP_003339057.1| PREDICTED: histone H3.3 [Pan troglodytes] gi|332849085|ref|XP_003315784.1| PREDICTED: histone H3.3 [Pan troglodytes] gi|340376747|ref|XP_003386893.1| PREDICTED: histone H3.3-like [Amphimedon queenslandica] gi|340724796|ref|XP_003400767.1| PREDICTED: histone H3.3-like [Bombus terrestris] gi|340724804|ref|XP_003400771.1| PREDICTED: histone H3.3 isoform 1 [Bombus terrestris] gi|340724806|ref|XP_003400772.1| PREDICTED: histone H3.3 isoform 2 [Bombus terrestris] gi|340724808|ref|XP_003400773.1| PREDICTED: histone H3.3 isoform 3 [Bombus terrestris] gi|340724810|ref|XP_003400774.1| PREDICTED: histone H3.3 isoform 4 [Bombus terrestris] gi|340724812|ref|XP_003400775.1| PREDICTED: histone H3.3 isoform 5 [Bombus terrestris] gi|340724814|ref|XP_003400776.1| PREDICTED: histone H3.3 isoform 6 [Bombus terrestris] gi|344278391|ref|XP_003410978.1| PREDICTED: histone H3.3-like [Loxodonta africana] gi|344291160|ref|XP_003417304.1| PREDICTED: histone H3.3-like [Loxodonta africana] gi|347966658|ref|XP_003435952.1| AGAP001813-PB [Anopheles gambiae str. PEST] gi|348502319|ref|XP_003438715.1| PREDICTED: histone H3.3-like [Oreochromis niloticus] gi|348502535|ref|XP_003438823.1| PREDICTED: histone H3.3-like [Oreochromis niloticus] gi|348524667|ref|XP_003449844.1| PREDICTED: histone H3.3-like [Oreochromis niloticus] gi|348551304|ref|XP_003461470.1| PREDICTED: histone H3.3-like [Cavia porcellus] gi|348553198|ref|XP_003462414.1| PREDICTED: histone H3.3-like [Cavia porcellus] gi|350398298|ref|XP_003485151.1| PREDICTED: histone H3.3-like [Bombus impatiens] gi|350398312|ref|XP_003485156.1| PREDICTED: histone H3.3-like isoform 1 [Bombus impatiens] gi|350398315|ref|XP_003485157.1| PREDICTED: histone H3.3-like isoform 2 [Bombus impatiens] gi|363746092|ref|XP_003643522.1| PREDICTED: histone H3.3-like [Gallus gallus] gi|380021168|ref|XP_003694444.1| PREDICTED: histone H3.3-like isoform 1 [Apis florea] gi|380021170|ref|XP_003694445.1| PREDICTED: histone H3.3-like isoform 2 [Apis florea] gi|380021172|ref|XP_003694446.1| PREDICTED: histone H3.3-like isoform 1 [Apis florea] gi|380021174|ref|XP_003694447.1| PREDICTED: histone H3.3-like isoform 2 [Apis florea] gi|380021176|ref|XP_003694448.1| PREDICTED: histone H3.3-like isoform 3 [Apis florea] gi|383865267|ref|XP_003708096.1| PREDICTED: histone H3.3-like [Megachile rotundata] gi|383865269|ref|XP_003708097.1| PREDICTED: histone H3.3-like [Megachile rotundata] gi|391329086|ref|XP_003739008.1| PREDICTED: histone H3.3-like [Metaseiulus occidentalis] gi|391348271|ref|XP_003748371.1| PREDICTED: histone H3.3-like [Metaseiulus occidentalis] gi|392332906|ref|XP_003752732.1| PREDICTED: histone H3.3-like [Rattus norvegicus] gi|395531470|ref|XP_003767801.1| PREDICTED: histone H3.3-like [Sarcophilus harrisii] gi|395728954|ref|XP_003775464.1| PREDICTED: histone H3.3-like [Pongo abelii] gi|395825930|ref|XP_003786173.1| PREDICTED: histone H3.3-like [Otolemur garnettii] gi|395836179|ref|XP_003791041.1| PREDICTED: histone H3.3-like [Otolemur garnettii] gi|397484318|ref|XP_003813324.1| PREDICTED: histone H3.3-like isoform 1 [Pan paniscus] gi|397484320|ref|XP_003813325.1| PREDICTED: histone H3.3-like isoform 2 [Pan paniscus] gi|397487800|ref|XP_003814967.1| PREDICTED: histone H3.3-like isoform 1 [Pan paniscus] gi|397487802|ref|XP_003814968.1| PREDICTED: histone H3.3-like isoform 2 [Pan paniscus] gi|397487804|ref|XP_003814969.1| PREDICTED: histone H3.3-like isoform 3 [Pan paniscus] gi|397487806|ref|XP_003814970.1| PREDICTED: histone H3.3-like isoform 4 [Pan paniscus] gi|397487808|ref|XP_003814971.1| PREDICTED: histone H3.3-like isoform 5 [Pan paniscus] gi|397487810|ref|XP_003814972.1| PREDICTED: histone H3.3-like isoform 6 [Pan paniscus] gi|402857049|ref|XP_003893086.1| PREDICTED: histone H3.3 [Papio anubis] gi|402858020|ref|XP_003893529.1| PREDICTED: histone H3.3-like isoform 1 [Papio anubis] gi|402858022|ref|XP_003893530.1| PREDICTED: histone H3.3-like isoform 2 [Papio anubis] gi|402858024|ref|XP_003893531.1| PREDICTED: histone H3.3-like isoform 3 [Papio anubis] gi|402858026|ref|XP_003893532.1| PREDICTED: histone H3.3-like isoform 4 [Papio anubis] gi|402901097|ref|XP_003913493.1| PREDICTED: histone H3.3 isoform 1 [Papio anubis] gi|402901099|ref|XP_003913494.1| PREDICTED: histone H3.3 isoform 2 [Papio anubis] gi|403277380|ref|XP_003930341.1| PREDICTED: histone H3.3 isoform 1 [Saimiri boliviensis boliviensis] gi|403277382|ref|XP_003930342.1| PREDICTED: histone H3.3 isoform 2 [Saimiri boliviensis boliviensis] gi|403277384|ref|XP_003930343.1| PREDICTED: histone H3.3 isoform 3 [Saimiri boliviensis boliviensis] gi|403280542|ref|XP_003931776.1| PREDICTED: histone H3.3 [Saimiri boliviensis boliviensis] gi|410034519|ref|XP_003949752.1| PREDICTED: histone H3.3 [Pan troglodytes] gi|410034521|ref|XP_003949753.1| PREDICTED: histone H3.3 [Pan troglodytes] gi|410895731|ref|XP_003961353.1| PREDICTED: histone H3.3-like [Takifugu rubripes] gi|410914598|ref|XP_003970774.1| PREDICTED: histone H3.3-like [Takifugu rubripes] gi|410928060|ref|XP_003977419.1| PREDICTED: histone H3.3-like [Takifugu rubripes] gi|410981710|ref|XP_003997209.1| PREDICTED: histone H3.3 [Felis catus] gi|410985661|ref|XP_003999137.1| PREDICTED: histone H3.3 [Felis catus] gi|426238462|ref|XP_004013172.1| PREDICTED: histone H3.3 [Ovis aries] gi|426239547|ref|XP_004013682.1| PREDICTED: histone H3.3 [Ovis aries] gi|426333961|ref|XP_004028534.1| PREDICTED: histone H3.3 isoform 1 [Gorilla gorilla gorilla] gi|426333963|ref|XP_004028535.1| PREDICTED: histone H3.3 isoform 2 [Gorilla gorilla gorilla] gi|426333965|ref|XP_004028536.1| PREDICTED: histone H3.3 isoform 3 [Gorilla gorilla gorilla] gi|426333967|ref|XP_004028537.1| PREDICTED: histone H3.3 isoform 4 [Gorilla gorilla gorilla] gi|426333969|ref|XP_004028538.1| PREDICTED: histone H3.3 isoform 5 [Gorilla gorilla gorilla] gi|426333971|ref|XP_004028539.1| PREDICTED: histone H3.3 isoform 6 [Gorilla gorilla gorilla] gi|426333973|ref|XP_004028540.1| PREDICTED: histone H3.3 isoform 7 [Gorilla gorilla gorilla] gi|426333975|ref|XP_004028541.1| PREDICTED: histone H3.3 isoform 8 [Gorilla gorilla gorilla] gi|426346816|ref|XP_004041067.1| PREDICTED: histone H3.3 [Gorilla gorilla gorilla] gi|432923025|ref|XP_004080398.1| PREDICTED: histone H3.3-like [Oryzias latipes] gi|432948638|ref|XP_004084106.1| PREDICTED: histone H3.3-like [Oryzias latipes] gi|441612528|ref|XP_004088086.1| PREDICTED: histone H3.3 [Nomascus leucogenys] gi|441622394|ref|XP_004088836.1| PREDICTED: histone H3.3-like isoform 2 [Nomascus leucogenys] gi|441622397|ref|XP_004088837.1| PREDICTED: histone H3.3-like isoform 3 [Nomascus leucogenys] gi|55977042|sp|P84245.2|H33_RAT RecName: Full=Histone H3.3 gi|55977062|sp|P84243.2|H33_HUMAN RecName: Full=Histone H3.3 gi|55977063|sp|P84244.2|H33_MOUSE RecName: Full=Histone H3.3 gi|55977064|sp|P84246.2|H33_RABIT RecName: Full=Histone H3.3 gi|55977065|sp|P84247.2|H33_CHICK RecName: Full=Histone H3.3; AltName: Full=H3.3A/B; AltName: Full=Histone H3 class II gi|55977066|sp|P84248.2|H33_SPISO RecName: Full=Histone H3.3 gi|55977067|sp|P84249.2|H33_DROME RecName: Full=Histone H3.3; AltName: Full=H3.3Q; AltName: Full=H3.A/B gi|55977068|sp|P84250.2|H33_DROHY RecName: Full=Histone H3.3; AltName: Full=H3.A/B gi|56404321|sp|Q71LE2.3|H33_PIG RecName: Full=Histone H3.3 gi|75040237|sp|Q5E9F8.3|H33_BOVIN RecName: Full=Histone H3.3 gi|82237558|sp|Q6P823.3|H33_XENTR RecName: Full=Histone H3.3 gi|82237785|sp|Q6PI20.3|H33_DANRE RecName: Full=Histone H3.3 gi|82237787|sp|Q6PI79.3|H33_XENLA RecName: Full=Histone H3.3 gi|411024500|pdb|4HGA|B Chain B, Structure Of The Variant Histone H3.3-H4 Heterodimer In Complex With Its Chaperone Daxx gi|10441988|gb|AAG17271.1|AF218029_1 unknown [Homo sapiens] gi|18643343|gb|AAL76273.1|AF469469_1 histone H3.3A [Sus scrofa] gi|1568|emb|CAA36179.1| unnamed protein product [Oryctolagus cuniculus] gi|8046|emb|CAA37819.1| Histone H3.3Q [Drosophila melanogaster] gi|51198|emb|CAA31940.1| unnamed protein product [Mus musculus] gi|63480|emb|CAA68458.1| unnamed protein product [Gallus gallus] gi|161190|gb|AAA29965.1| histone H3 [Spisula solidissima] gi|211853|gb|AAA48794.1| histone 3.3 [Gallus gallus] gi|306848|gb|AAA52653.1| H3.3 histone [Homo sapiens] gi|306849|gb|AAA52654.1| H3.3 histone [Homo sapiens] gi|313319|emb|CAA52035.1| histon H3 [Rattus norvegicus] gi|761716|emb|CAA88778.1| histone H3.3 [Homo sapiens] gi|963024|emb|CAA57078.1| histone H3.3 [Drosophila hydei] gi|963026|emb|CAA57081.1| histone H3.3 [Drosophila hydei] gi|963029|emb|CAA57080.1| histone H3.3 [Drosophila melanogaster] gi|963031|emb|CAA57077.1| histone H3.3 [Drosophila melanogaster] gi|1006654|emb|CAA57712.1| histone H3.3A variant [Drosophila melanogaster] gi|1838986|emb|CAB06625.1| histone H3.3A [Mus musculus] gi|7291014|gb|AAF46452.1| histone H3.3B, isoform A [Drosophila melanogaster] gi|7296940|gb|AAF52213.1| histone H3.3A, isoform A [Drosophila melanogaster] gi|12654577|gb|AAH01124.1| H3 histone, family 3B (H3.3B) [Homo sapiens] gi|12805577|gb|AAH02268.1| H3 histone, family 3A [Mus musculus] gi|12833274|dbj|BAB22464.1| unnamed protein product [Mus musculus] gi|13676330|gb|AAH06497.1| H3 histone, family 3B (H3.3B) [Homo sapiens] gi|15215164|gb|AAH12687.1| H3 histone, family 3A [Mus musculus] gi|15215436|gb|AAH12813.1| H3 histone, family 3B (H3.3B) [Homo sapiens] gi|16580107|gb|AAK61362.1| histone 3A [Anopheles gambiae] gi|17028475|gb|AAH17558.1| H3 histone, family 3B (H3.3B) [Homo sapiens] gi|17945243|gb|AAL48679.1| RE14004p [Drosophila melanogaster] gi|20810210|gb|AAH29405.1| H3 histone, family 3A [Homo sapiens] gi|21392000|gb|AAM48354.1| LD17717p [Drosophila melanogaster] gi|21429128|gb|AAM50283.1| RE21618p [Drosophila melanogaster] gi|22831984|gb|AAN09245.1| histone H3.3B, isoform B [Drosophila melanogaster] gi|22902309|gb|AAH37730.1| H3 histone, family 3B [Mus musculus] gi|25058578|gb|AAH38989.1| H3 histone, family 3A [Homo sapiens] gi|26332330|dbj|BAC29895.1| unnamed protein product [Mus musculus] gi|26353000|dbj|BAC40130.1| unnamed protein product [Mus musculus] gi|27370860|gb|AAH41218.1| MGC52708 protein [Xenopus laevis] gi|27503244|gb|AAH42290.1| H3f3b-prov protein [Xenopus laevis] gi|27769186|gb|AAH42309.1| H3f3a-prov protein [Xenopus laevis] gi|28381593|gb|AAO41645.1| histone H3.3B, isoform C [Drosophila melanogaster] gi|29124583|gb|AAH49017.1| Zgc:56418 [Danio rerio] gi|30173649|gb|EAA01174.2| AGAP001813-PA [Anopheles gambiae str. PEST] gi|31873260|emb|CAD97621.1| hypothetical protein [Homo sapiens] gi|34783839|gb|AAH57444.1| H3 histone, family 3C [Danio rerio] gi|38047789|gb|AAR09797.1| similar to Drosophila melanogaster His3.3A, partial [Drosophila yakuba] gi|38174124|gb|AAH61408.1| H3 histone, family 3B (H3.3B) [Xenopus (Silurana) tropicalis] gi|38648851|gb|AAH63159.1| H3 histone, family 3B [Rattus norvegicus] gi|47215774|emb|CAG02570.1| unnamed protein product [Tetraodon nigroviridis] gi|47216831|emb|CAG02722.1| unnamed protein product [Tetraodon nigroviridis] gi|47224861|emb|CAG06431.1| unnamed protein product [Tetraodon nigroviridis] gi|47506869|gb|AAH70966.1| MGC78769 protein [Xenopus laevis] gi|48290305|emb|CAF25046.1| histone H3.3 [Oikopleura dioica] gi|48734917|gb|AAH71406.1| H3 histone, family 3A [Danio rerio] gi|49522764|gb|AAH74158.1| MGC81913 protein [Xenopus laevis] gi|49903578|gb|AAH77035.1| MGC89877 protein [Xenopus (Silurana) tropicalis] gi|50926784|gb|AAH78759.1| H3 histone, family 3B [Rattus norvegicus] gi|51814315|gb|AAU09479.1| GekBS038P [Gekko japonicus] gi|51858469|gb|AAH81560.1| H3 histone, family 3B (H3.3B) [Homo sapiens] gi|53734121|gb|AAH83353.1| H3 histone, family 3A [Mus musculus] gi|54644282|gb|EAL33023.1| GA19158 [Drosophila pseudoobscura pseudoobscura] gi|55778406|gb|AAH86580.1| H3f3b protein [Rattus norvegicus] gi|56388767|gb|AAH87725.1| H3f3b protein [Rattus norvegicus] gi|57033178|gb|AAH88835.1| H3 histone, family 3A [Mus musculus] gi|59858289|gb|AAX08979.1| H3 histone, family 3A [Bos taurus] gi|60392147|gb|AAX19363.1| replacement histone H3.3 [Ruditapes philippinarum] gi|62027558|gb|AAH92043.1| H3 histone, family 3B [Mus musculus] gi|62202237|gb|AAH92854.1| Zgc:110292 [Danio rerio] gi|63102453|gb|AAH95447.1| H3 histone, family 3A [Homo sapiens] gi|73586640|gb|AAI03072.1| H3F3A protein [Bos taurus] gi|74139378|dbj|BAE40831.1| unnamed protein product [Mus musculus] gi|74139993|dbj|BAE31831.1| unnamed protein product [Mus musculus] gi|74141311|dbj|BAE35953.1| unnamed protein product [Mus musculus] gi|74141850|dbj|BAE40995.1| unnamed protein product [Mus musculus] gi|74142224|dbj|BAE31877.1| unnamed protein product [Mus musculus] gi|74142363|dbj|BAE31939.1| unnamed protein product [Mus musculus] gi|74151792|dbj|BAE29685.1| unnamed protein product [Mus musculus] gi|74152073|dbj|BAE32069.1| unnamed protein product [Mus musculus] gi|74179935|dbj|BAE36524.1| unnamed protein product [Mus musculus] gi|74181381|dbj|BAE29966.1| unnamed protein product [Mus musculus] gi|74187463|dbj|BAE36694.1| unnamed protein product [Mus musculus] gi|74189303|dbj|BAE22687.1| unnamed protein product [Mus musculus] gi|74190333|dbj|BAE37253.1| unnamed protein product [Mus musculus] gi|74191357|dbj|BAE30261.1| unnamed protein product [Mus musculus] gi|74191472|dbj|BAE30314.1| unnamed protein product [Mus musculus] gi|74196024|dbj|BAE30566.1| unnamed protein product [Mus musculus] gi|74196068|dbj|BAE30586.1| unnamed protein product [Mus musculus] gi|74196074|dbj|BAE30589.1| unnamed protein product [Mus musculus] gi|74198107|dbj|BAE35232.1| unnamed protein product [Mus musculus] gi|74204175|dbj|BAE39850.1| unnamed protein product [Mus musculus] gi|74204268|dbj|BAE39892.1| unnamed protein product [Mus musculus] gi|74204718|dbj|BAE35427.1| unnamed protein product [Mus musculus] gi|74207125|dbj|BAE30757.1| unnamed protein product [Mus musculus] gi|74211975|dbj|BAE40157.1| unnamed protein product [Mus musculus] gi|74214504|dbj|BAE31102.1| unnamed protein product [Mus musculus] gi|74214793|dbj|BAE31231.1| unnamed protein product [Mus musculus] gi|74214797|dbj|BAE31233.1| unnamed protein product [Mus musculus] gi|74219633|dbj|BAE29584.1| unnamed protein product [Mus musculus] gi|74219635|dbj|BAE29585.1| unnamed protein product [Mus musculus] gi|74219922|dbj|BAE40542.1| unnamed protein product [Mus musculus] gi|74220794|dbj|BAE31366.1| unnamed protein product [Mus musculus] gi|74225316|dbj|BAE31590.1| unnamed protein product [Mus musculus] gi|74225515|dbj|BAE31666.1| unnamed protein product [Mus musculus] gi|76780124|gb|AAI06303.1| MGC52708 protein [Xenopus laevis] gi|76780245|gb|AAI06178.1| H3 histone, family 3A [Mus musculus] gi|80477731|gb|AAI08702.1| H3 histone, family 3B (H3.3B) [Homo sapiens] gi|87248155|gb|ABD36130.1| h3 histone family 3a [Bombyx mori] gi|90819998|gb|ABD98756.1| putative H3 histone, family 3A [Graphocephala atropunctata] gi|95769331|gb|ABF57428.1| H3 histone, family 3B [Bos taurus] gi|108878058|gb|EAT42283.1| AAEL006158-PA [Aedes aegypti] gi|109716251|gb|ABG43104.1| histone H3 [Pectinaria gouldii] gi|115530764|emb|CAL49400.1| H3 histone [Xenopus (Silurana) tropicalis] gi|116063361|gb|AAI23121.1| MGC52708 protein [Xenopus laevis] gi|117645208|emb|CAL38070.1| hypothetical protein [synthetic construct] gi|119590176|gb|EAW69770.1| H3 histone, family 3A, isoform CRA_a [Homo sapiens] gi|119590177|gb|EAW69771.1| H3 histone, family 3A, isoform CRA_a [Homo sapiens] gi|119590178|gb|EAW69772.1| H3 histone, family 3A, isoform CRA_a [Homo sapiens] gi|119590179|gb|EAW69773.1| H3 histone, family 3A, isoform CRA_a [Homo sapiens] gi|119609723|gb|EAW89317.1| H3 histone, family 3B (H3.3B), isoform CRA_a [Homo sapiens] gi|119609724|gb|EAW89318.1| H3 histone, family 3B (H3.3B), isoform CRA_a [Homo sapiens] gi|119609725|gb|EAW89319.1| H3 histone, family 3B (H3.3B), isoform CRA_a [Homo sapiens] gi|121543839|gb|ABM55584.1| putative histone H3 [Maconellicoccus hirsutus] gi|121543855|gb|ABM55592.1| putative H3 histone, family 3B [Maconellicoccus hirsutus] gi|123984391|gb|ABM83541.1| H3 histone, family 3A [synthetic construct] gi|123998359|gb|ABM86781.1| H3 histone, family 3A [synthetic construct] gi|126635091|emb|CAK32534.1| histone H3.3 [Oikopleura dioica] gi|134025948|gb|AAI34735.1| H3 histone, family 3A [Bos taurus] gi|146741398|dbj|BAF62355.1| H3 histone, family 3A [Pan troglodytes verus] gi|148681198|gb|EDL13145.1| mCG19829 [Mus musculus] gi|148702598|gb|EDL34545.1| mCG6618 [Mus musculus] gi|149040876|gb|EDL94833.1| rCG20294, isoform CRA_a [Rattus norvegicus] gi|149054820|gb|EDM06637.1| H3 histone, family 3B, isoform CRA_a [Rattus norvegicus] gi|149212750|gb|ABR22618.1| histone 3 [Aplysia californica] gi|149689030|gb|ABR27830.1| H3 histone family 3B [Triatoma infestans] gi|156229982|gb|AAI52135.1| Zgc:64222 protein [Danio rerio] gi|158253878|gb|AAI54270.1| Zgc:56418 protein [Danio rerio] gi|158593674|gb|EDP32269.1| Histone H3.3, putative [Brugia malayi] gi|158595095|gb|EDP33668.1| Histone H3.3, putative [Brugia malayi] gi|160774424|gb|AAI55446.1| h3f3b protein [Xenopus (Silurana) tropicalis] gi|162415918|gb|ABX89280.1| histone cluster 1, H3a (predicted) [Papio anubis] gi|163915477|gb|AAI57317.1| MGC89877 protein [Xenopus (Silurana) tropicalis] gi|163916070|gb|AAI57315.1| h3f3b protein [Xenopus (Silurana) tropicalis] gi|165971617|gb|AAI58616.1| H3f3b protein [Rattus norvegicus] gi|166797097|gb|AAI59440.1| H3f3b protein [Rattus norvegicus] gi|167774103|gb|ABZ92486.1| H3 histone, family 3B (H3.3B) [synthetic construct] gi|167881403|gb|EDS44786.1| histone H3.3 type 2 [Culex quinquefasciatus] gi|182889676|gb|AAI65500.1| H3f3c protein [Danio rerio] gi|189053224|dbj|BAG34846.1| unnamed protein product [Homo sapiens] gi|190616692|gb|EDV32216.1| GF15720 [Drosophila ananassae] gi|190618238|gb|EDV33762.1| GF19171 [Drosophila ananassae] gi|190649015|gb|EDV46293.1| GG19000 [Drosophila erecta] gi|190660632|gb|EDV57824.1| GG25048 [Drosophila erecta] gi|193893232|gb|EDV92098.1| GH24723 [Drosophila grimshawi] gi|193905021|gb|EDW03888.1| GH11489 [Drosophila grimshawi] gi|193908547|gb|EDW07414.1| GI14879 [Drosophila mojavensis] gi|193912260|gb|EDW11127.1| GI16984 [Drosophila mojavensis] gi|194103311|gb|EDW25354.1| GL26550 [Drosophila persimilis] gi|194108477|gb|EDW30520.1| GL26831 [Drosophila persimilis] gi|194129232|gb|EDW51275.1| GM13676 [Drosophila sechellia] gi|194132764|gb|EDW54332.1| GM18523 [Drosophila sechellia] gi|194141601|gb|EDW58018.1| GJ15308 [Drosophila virilis] gi|194148316|gb|EDW64014.1| GJ17231 [Drosophila virilis] gi|194160585|gb|EDW75486.1| GK23881 [Drosophila willistoni] gi|194167467|gb|EDW82368.1| GK25162 [Drosophila willistoni] gi|194174776|gb|EDW88387.1| His3.3A [Drosophila yakuba] gi|194188592|gb|EDX02176.1| GE17412 [Drosophila yakuba] gi|194190212|gb|EDX03788.1| GD23319 [Drosophila simulans] gi|197127820|gb|ACH44318.1| putative H3 histone family 3A [Taeniopygia guttata] gi|197127821|gb|ACH44319.1| putative H3 histone family 3A [Taeniopygia guttata] gi|197129762|gb|ACH46260.1| putative H3 histone family 3B variant 2 [Taeniopygia guttata] gi|197129763|gb|ACH46261.1| putative H3 histone family 3B variant 2 [Taeniopygia guttata] gi|197129765|gb|ACH46263.1| putative H3 histone family 3B variant 1 [Taeniopygia guttata] gi|197129766|gb|ACH46264.1| putative H3 histone family 3B variant 1 [Taeniopygia guttata] gi|197129767|gb|ACH46265.1| putative H3 histone family 3B variant 2 [Taeniopygia guttata] gi|197129768|gb|ACH46266.1| putative H3 histone family 3B variant 1 [Taeniopygia guttata] gi|197129769|gb|ACH46267.1| putative H3 histone family 3B variant 2 [Taeniopygia guttata] gi|197129770|gb|ACH46268.1| putative H3 histone family 3B variant 1 [Taeniopygia guttata] gi|197129771|gb|ACH46269.1| putative H3 histone family 3B variant 1 [Taeniopygia guttata] gi|197129772|gb|ACH46270.1| putative H3 histone family 3B variant 1 [Taeniopygia guttata] gi|197129840|gb|ACH46338.1| putative H3 histone family 3B variant 1 [Taeniopygia guttata] gi|197129877|gb|ACH46375.1| putative H3 histone family 3A [Taeniopygia guttata] gi|197632043|gb|ACH70745.1| H3 histone family 3A [Salmo salar] gi|198146737|gb|EDY72858.1| GA22698 [Drosophila pseudoobscura pseudoobscura] gi|208966478|dbj|BAG73253.1| Histone H3.3 [synthetic construct] gi|209151288|gb|ACI33069.1| Histone H3.3 [Salmo salar] gi|209155450|gb|ACI33957.1| Histone H3.3 [Salmo salar] gi|209155988|gb|ACI34226.1| Histone H3.3 [Salmo salar] gi|209732440|gb|ACI67089.1| Histone H3.3 [Salmo salar] gi|209733828|gb|ACI67783.1| Histone H3.3 [Salmo salar] gi|209735012|gb|ACI68375.1| Histone H3.3 [Salmo salar] gi|209736882|gb|ACI69310.1| Histone H3.3 [Salmo salar] gi|209738400|gb|ACI70069.1| Histone H3.3 [Salmo salar] gi|212515835|gb|EEB17922.1| histone H3.3 [Pediculus humanus corporis] gi|215493015|gb|EEC02656.1| Core histone H2A/H2B/H3/H4 [Ixodes scapularis] gi|220950434|gb|ACL87760.1| His3.3A-PA [synthetic construct] gi|220959296|gb|ACL92191.1| His3.3A-PA [synthetic construct] gi|220959794|gb|ACL92440.1| His3.3A-PA [synthetic construct] gi|221219278|gb|ACM08300.1| Histone H3.3 [Salmo salar] gi|221220000|gb|ACM08661.1| Histone H3.3 [Salmo salar] gi|221220612|gb|ACM08967.1| Histone H3.3 [Salmo salar] gi|221221382|gb|ACM09352.1| Histone H3.3 [Salmo salar] gi|221222238|gb|ACM09780.1| Histone H3.3 [Salmo salar] gi|223646890|gb|ACN10203.1| Histone H3.3 [Salmo salar] gi|223646976|gb|ACN10246.1| Histone H3.3 [Salmo salar] gi|223672751|gb|ACN12557.1| Histone H3.3 [Salmo salar] gi|223672839|gb|ACN12601.1| Histone H3.3 [Salmo salar] gi|224924434|gb|ACN69167.1| H3 histone family 3A [Stomoxys calcitrans] gi|225703498|gb|ACO07595.1| Histone H3.3 [Oncorhynchus mykiss] gi|225706860|gb|ACO09276.1| Histone H3.3 [Osmerus mordax] gi|225706870|gb|ACO09281.1| Histone H3.3 [Osmerus mordax] gi|225713870|gb|ACO12781.1| Histone H3.3 [Lepeophtheirus salmonis] gi|225713976|gb|ACO12834.1| Histone H3.3 [Lepeophtheirus salmonis] gi|225718188|gb|ACO14940.1| Histone H3.3 [Caligus clemensi] gi|225718784|gb|ACO15238.1| Histone H3.3 [Caligus clemensi] gi|225719256|gb|ACO15474.1| Histone H3.3 [Caligus clemensi] gi|229274415|gb|EEN45251.1| hypothetical protein BRAFLDRAFT_120760 [Branchiostoma floridae] gi|229280870|gb|EEN51635.1| hypothetical protein BRAFLDRAFT_117519 [Branchiostoma floridae] gi|229367186|gb|ACQ58573.1| Histone H3.3 [Anoplopoma fimbria] gi|261335966|emb|CBH09251.1| putative Histone H3 [Heliconius melpomene] gi|261860160|dbj|BAI46602.1| H3 histone, family 3A [synthetic construct] gi|270011381|gb|EFA07829.1| hypothetical protein TcasGA2_TC005398 [Tribolium castaneum] gi|281350042|gb|EFB25626.1| hypothetical protein PANDA_008580 [Ailuropoda melanoleuca] gi|281354067|gb|EFB29651.1| hypothetical protein PANDA_016437 [Ailuropoda melanoleuca] gi|283468930|emb|CAP53904.1| histone H3.3 [Xenoturbella bocki] gi|283468934|emb|CAP57915.1| histone H3.3 [Xenoturbella bocki] gi|289743147|gb|ADD20321.1| H3 histone family 3A [Glossina morsitans morsitans] gi|289743149|gb|ADD20322.1| H3 histone family 3A [Glossina morsitans morsitans] gi|289743155|gb|ADD20325.1| H3 histone family 3A [Glossina morsitans morsitans] gi|290562447|gb|ADD38620.1| Histone H3.3 [Lepeophtheirus salmonis] gi|290562748|gb|ADD38769.1| Histone H3.3 [Lepeophtheirus salmonis] gi|291461559|dbj|BAI83414.1| histone H3 [Parasteatoda tepidariorum] gi|296476022|tpg|DAA18137.1| TPA: histone H3.3B-like [Bos taurus] gi|296479254|tpg|DAA21369.1| TPA: histone H3.3 [Bos taurus] gi|303659907|gb|ADM15975.1| Histone H3.3 [Salmo salar] gi|303665913|gb|ADM16206.1| Histone H3.3 [Salmo salar] gi|307095090|gb|ADN29851.1| histone H3.3 [Triatoma matogrossensis] gi|307169357|gb|EFN62078.1| Histone H3.3 [Camponotus floridanus] gi|307204447|gb|EFN83154.1| Histone H3.3 [Harpegnathos saltator] gi|307755311|gb|EFO14545.1| histone H3 [Loa loa] gi|307764087|gb|EFO23321.1| H3 histone, family 3A [Loa loa] gi|308321393|gb|ADO27848.1| histone h3.3 [Ictalurus furcatus] gi|308323577|gb|ADO28924.1| histone h3.3 [Ictalurus punctatus] gi|312371651|gb|EFR19783.1| hypothetical protein AND_30674 [Anopheles darlingi] gi|313220014|emb|CBY30878.1| unnamed protein product [Oikopleura dioica] gi|313234149|emb|CBY10218.1| unnamed protein product [Oikopleura dioica] gi|313235983|emb|CBY25129.1| unnamed protein product [Oikopleura dioica] gi|317419125|emb|CBN81162.1| Histone H3 [Dicentrarchus labrax] gi|317419264|emb|CBN81301.1| Uncharacterized protein [Dicentrarchus labrax] gi|321463426|gb|EFX74442.1| hypothetical protein DAPPUDRAFT_231307 [Daphnia pulex] gi|324509917|gb|ADY44152.1| Histone H3.3 [Ascaris suum] gi|325302694|tpg|DAA34575.1| TPA_exp: H3 histone family 3A [Amblyomma variegatum] gi|332028951|gb|EGI68969.1| Histone H3.3 [Acromyrmex echinatior] gi|332028952|gb|EGI68970.1| Histone H3.3 [Acromyrmex echinatior] gi|332375154|gb|AEE62718.1| unknown [Dendroctonus ponderosae] gi|333469959|gb|EGK97461.1| AGAP001813-PB [Anopheles gambiae str. PEST] gi|335775411|gb|AEH58563.1| histone H3.3-like protein [Equus caballus] gi|336087732|emb|CBM82511.1| histone H3.3 protein [Balanoglossus clavigerus] gi|343458983|gb|AEM37650.1| histone H3 [Epinephelus bruneus] gi|343959538|dbj|BAK63626.1| histone H3.3 [Pan troglodytes] gi|351703433|gb|EHB06352.1| Histone H3.3 [Heterocephalus glaber] gi|351707846|gb|EHB10765.1| Histone H3.3 [Heterocephalus glaber] gi|355558716|gb|EHH15496.1| hypothetical protein EGK_01597 [Macaca mulatta] gi|355568926|gb|EHH25207.1| hypothetical protein EGK_08989 [Macaca mulatta] gi|355745875|gb|EHH50500.1| hypothetical protein EGM_01343 [Macaca fascicularis] gi|355760552|gb|EHH61688.1| hypothetical protein EGM_19729 [Macaca fascicularis] gi|357627942|gb|EHJ77454.1| hypothetical protein KGM_11308 [Danaus plexippus] gi|384939288|gb|AFI33249.1| histone H3.3 [Macaca mulatta] gi|387016374|gb|AFJ50306.1| Histone H3.3 [Crotalus adamanteus] gi|387016376|gb|AFJ50307.1| Histone H3.3 [Crotalus adamanteus] gi|387016378|gb|AFJ50308.1| H3 histone, family 3A [Crotalus adamanteus] gi|387541660|gb|AFJ71457.1| histone H3.3 [Macaca mulatta] gi|389609103|dbj|BAM18163.1| histone H3.3B [Papilio xuthus] gi|389611069|dbj|BAM19145.1| histone H3.3B [Papilio polytes] gi|392881652|gb|AFM89658.1| histone H33 [Callorhinchus milii] gi|402588820|gb|EJW82753.1| histone H3 [Wuchereria bancrofti] gi|402593333|gb|EJW87260.1| histone H3 [Wuchereria bancrofti] gi|405947928|gb|EKC17910.1| Histone H3.3 [Crassostrea gigas] gi|410220188|gb|JAA07313.1| H3 histone, family 3A [Pan troglodytes] gi|410220190|gb|JAA07314.1| H3 histone, family 3A [Pan troglodytes] gi|410303558|gb|JAA30379.1| H3 histone, family 3A [Pan troglodytes] gi|417396085|gb|JAA45076.1| Putative histone h3.3-like protein [Desmodus rotundus] gi|417515874|gb|JAA53742.1| histone H3.3 [Sus scrofa] gi|427786365|gb|JAA58634.1| Putative family 3b.1 [Rhipicephalus pulchellus] gi|431908767|gb|ELK12359.1| Histone H3.3 [Pteropus alecto] gi|440213373|gb|AGB92618.1| histone H3.3A, isoform C [Drosophila melanogaster] gi|440213374|gb|AAN10526.2| histone H3.3A, isoform D [Drosophila melanogaster] gi|440216577|gb|AGB95217.1| histone H3.3B, isoform D [Drosophila melanogaster] gi|440896848|gb|ELR48666.1| hypothetical protein M91_05641 [Bos grunniens mutus] gi|440898503|gb|ELR49990.1| Histone H3.3 [Bos grunniens mutus] gi|442747111|gb|JAA65715.1| Putative histones h3 and h4 [Ixodes ricinus] gi|443429390|gb|AGC92675.1| Histone H3.3-like protein [Heliconius erato] gi|443692090|gb|ELT93764.1| hypothetical protein CAPTEDRAFT_152257 [Capitella teleta] gi|444727830|gb|ELW68308.1| Histone H3.3 [Tupaia chinensis]

Back alignment and taxonomy information

 Score =  258 bits (660), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 132/136 (97%), Gaps = 4/136 (2%)

Query: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHR----TVALREIRRYQKSTE 56
           MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHR    TVALREIRRYQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE 60

Query: 57  LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI 116
           LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI 120

Query: 117 MPKDIQLARRIRGERA 132
           MPKDIQLARRIRGERA
Sbjct: 121 MPKDIQLARRIRGERA 136

Source: Homo sapiens

Species: Homo sapiens

Genus: Homo

Family: Hominidae

Order: Primates

Class: Mammalia

Phylum: Chordata

Superkingdom: Eukaryota

>gi\|334359125\|pdb\|3AV2\|A Chain A, The Human Nucleosome Structure Containing The Histone Variant H3.3 gi\|334359129\|pdb\|3AV2\|E Chain E, The Human Nucleosome Structure Containing The Histone Variant H3.3	Back alignment and taxonomy information

>gi\|225703532\|gb\|ACO07612.1\| Histone H3.3 [Oncorhynchus mykiss]	Back alignment and taxonomy information

>gi|256086246|ref|XP_002579313.1| histone H3 [Schistosoma mansoni] gi|56753077|gb|AAW24748.1| SJCHGC01198 protein [Schistosoma japonicum] gi|226475830|emb|CAX72005.1| Histone H3.3 [Schistosoma japonicum] gi|226475832|emb|CAX72006.1| Histone H3.3 [Schistosoma japonicum] gi|226475834|emb|CAX72007.1| Histone H3.3 [Schistosoma japonicum] gi|226475836|emb|CAX72008.1| Histone H3.3 [Schistosoma japonicum] gi|226475838|emb|CAX72009.1| Histone H3.3 [Schistosoma japonicum] gi|226475840|emb|CAX72010.1| Histone H3.3 [Schistosoma japonicum] gi|226475842|emb|CAX72011.1| Histone H3.3 [Schistosoma japonicum] gi|226475844|emb|CAX72012.1| Histone H3.3 [Schistosoma japonicum] gi|226479668|emb|CAX78697.1| Histone H3.3 [Schistosoma japonicum] gi|226479670|emb|CAX78698.1| Histone H3.3 [Schistosoma japonicum] gi|226479674|emb|CAX78700.1| Histone H3.3 [Schistosoma japonicum] gi|226479676|emb|CAX78701.1| Histone H3.3 [Schistosoma japonicum] gi|226479678|emb|CAX78702.1| Histone H3.3 [Schistosoma japonicum] gi|226479680|emb|CAX78703.1| Histone H3.3 [Schistosoma japonicum] gi|226479682|emb|CAX78704.1| Histone H3.3 [Schistosoma japonicum] gi|226479684|emb|CAX78705.1| Histone H3.3 [Schistosoma japonicum] gi|226479686|emb|CAX78706.1| Histone H3.3 [Schistosoma japonicum] gi|226479688|emb|CAX78707.1| Histone H3.3 [Schistosoma japonicum] gi|226479690|emb|CAX78708.1| Histone H3.3 [Schistosoma japonicum] gi|226479692|emb|CAX78709.1| Histone H3.3 [Schistosoma japonicum] gi|226479694|emb|CAX78710.1| Histone H3.3 [Schistosoma japonicum] gi|226479696|emb|CAX78711.1| Histone H3.3 [Schistosoma japonicum] gi|226479698|emb|CAX78712.1| Histone H3.3 [Schistosoma japonicum] gi|226479700|emb|CAX78713.1| Histone H3.3 [Schistosoma japonicum] gi|226479702|emb|CAX78714.1| Histone H3.3 [Schistosoma japonicum] gi|226479704|emb|CAX78715.1| Histone H3.3 [Schistosoma japonicum] gi|226479708|emb|CAX78716.1| Histone H3.3 [Schistosoma japonicum] gi|226485525|emb|CAX75182.1| Histone H3.3 [Schistosoma japonicum] gi|226485527|emb|CAX75183.1| Histone H3.3 [Schistosoma japonicum] gi|226485529|emb|CAX75184.1| Histone H3.3 [Schistosoma japonicum] gi|226485531|emb|CAX75185.1| Histone H3.3 [Schistosoma japonicum] gi|238664740|emb|CAZ35552.1| histone H3, putative [Schistosoma mansoni] gi|349935962|dbj|GAA29599.1| histone H3 [Clonorchis sinensis]

Back alignment and taxonomy information

>gi\|307204446\|gb\|EFN83153.1\| Histone H3.3 [Harpegnathos saltator]	Back alignment and taxonomy information

>gi\|225704818\|gb\|ACO08255.1\| Histone H3.3 [Oncorhynchus mykiss]	Back alignment and taxonomy information

>gi\|45384744\|gb\|AAS59415.1\| histone H3.3B [Chinchilla lanigera]	Back alignment and taxonomy information

>gi\|221221048\|gb\|ACM09185.1\| Histone H3.3 [Salmo salar]	Back alignment and taxonomy information

>gi\|126697402\|gb\|ABO26658.1\| histone H3 [Haliotis discus discus] gi\|208657743\|gb\|ACI30168.1\| H3 histone family 3A [Anopheles darlingi]	Back alignment and taxonomy information

>gi\|189053462\|dbj\|BAG35628.1\| unnamed protein product [Homo sapiens]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		132
FB\|FBgn0014857		136	His3.3A "Histone H3.3A" [Droso	1.0	0.970	0.970	3e-62
FB\|FBgn0004828		136	His3.3B "Histone H3.3B" [Droso	1.0	0.970	0.970	3e-62
UNIPROTKB\|P84247		136	H3-IX "Histone H3.3" [Gallus g	1.0	0.970	0.970	3e-62
UNIPROTKB\|Q5E9F8		136	H3F3A "Histone H3.3" [Bos taur	1.0	0.970	0.970	3e-62
UNIPROTKB\|E2R6K5		136	H3F3B "Histone H3" [Canis lupu	1.0	0.970	0.970	3e-62
UNIPROTKB\|P84243		136	H3F3A "Histone H3.3" [Homo sap	1.0	0.970	0.970	3e-62
UNIPROTKB\|Q71LE2		136	H3F3A "Histone H3.3" [Sus scro	1.0	0.970	0.970	3e-62
RGD\|2319910		136	H3f3a "H3 histone, family 3A"	1.0	0.970	0.970	3e-62
RGD\|621095		136	H3f3b "H3 histone, family 3B"	1.0	0.970	0.970	3e-62
ZFIN\|ZDB-GENE-050417-65		137	h3f3b.1 "H3 histone, family 3B	1.0	0.963	0.963	4.8e-62

FB\|FBgn0014857 His3.3A "Histone H3.3A" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

 Score = 636 (228.9 bits), Expect = 3.0e-62, P = 3.0e-62
 Identities = 132/136 (97%), Positives = 132/136 (97%)

Query:     1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHR----TVALREIRRYQKSTE 56
             MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHR    TVALREIRRYQKSTE
Sbjct:     1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE 60

Query:    57 LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI 116
             LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI
Sbjct:    61 LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI 120

Query:   117 MPKDIQLARRIRGERA 132
             MPKDIQLARRIRGERA
Sbjct:   121 MPKDIQLARRIRGERA 136

GO:0006333 "chromatin assembly or disassembly" evidence=ISS

GO:0000786 "nucleosome" evidence=ISS

GO:0003677 "DNA binding" evidence=ISS

GO:0008360 "regulation of cell shape" evidence=IMP

GO:0007155 "cell adhesion" evidence=IMP

GO:0046982 "protein heterodimerization activity" evidence=IEA

GO:0006334 "nucleosome assembly" evidence=IEA

GO:0005700 "polytene chromosome" evidence=IDA

GO:0007140 "male meiosis" evidence=IGI

FB\|FBgn0004828 His3.3B "Histone H3.3B" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

UNIPROTKB\|P84247 H3-IX "Histone H3.3" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|Q5E9F8 H3F3A "Histone H3.3" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|E2R6K5 H3F3B "Histone H3" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|P84243 H3F3A "Histone H3.3" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|Q71LE2 H3F3A "Histone H3.3" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

RGD\|2319910 H3f3a "H3 histone, family 3A" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

RGD\|621095 H3f3b "H3 histone, family 3B" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-050417-65 h3f3b.1 "H3 histone, family 3B.1" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
P84235	H3_PLADU	No assigned EC number	0.9411	1.0	0.9705	N/A	N/A
P84234	H32_ONCMY	No assigned EC number	0.9411	1.0	0.9705	N/A	N/A
P84237	H3_TIGCA	No assigned EC number	0.9411	1.0	0.9705	N/A	N/A
P84236	H3_DROHY	No assigned EC number	0.9411	1.0	0.9705	N/A	N/A
P84231	H32_ICTBU	No assigned EC number	0.9411	1.0	0.9705	N/A	N/A
Q71DI3	H32_HUMAN	No assigned EC number	0.9411	1.0	0.9705	yes	N/A
P84233	H32_XENLA	No assigned EC number	0.9411	1.0	0.9705	N/A	N/A
P84232	H32_PORAF	No assigned EC number	0.9411	1.0	0.9705	N/A	N/A
Q8WSF1	H33_TRIPS	No assigned EC number	0.9632	1.0	0.9705	N/A	N/A
Q6LCK1	H32_BRANA	No assigned EC number	0.9264	1.0	0.9705	N/A	N/A
Q64400	H32_CRILO	No assigned EC number	0.9338	1.0	0.9705	N/A	N/A
P84239	H3_URECA	No assigned EC number	0.9411	1.0	0.9705	N/A	N/A
P84238	H3_CHITH	No assigned EC number	0.9411	1.0	0.9705	N/A	N/A
Q10453	H331_CAEEL	No assigned EC number	0.9632	1.0	0.9705	yes	N/A
A5PK61	H3C_BOVIN	No assigned EC number	0.9338	1.0	0.9705	yes	N/A
Q6PI79	H33_XENLA	No assigned EC number	0.9705	1.0	0.9705	N/A	N/A
P84230	H32_CAIMO	No assigned EC number	0.9411	1.0	0.9705	N/A	N/A
Q5RCC9	H33_PONAB	No assigned EC number	0.9632	1.0	0.9705	yes	N/A
Q6P823	H33_XENTR	No assigned EC number	0.9705	1.0	0.9705	yes	N/A
Q71T45	H32_EUPES	No assigned EC number	0.9264	1.0	0.9705	N/A	N/A
Q4QRF4	H32_DANRE	No assigned EC number	0.9411	1.0	0.9705	yes	N/A
P68430	H32_ONOVI	No assigned EC number	0.9264	1.0	0.9705	N/A	N/A
Q5E9F8	H33_BOVIN	No assigned EC number	0.9705	1.0	0.9705	yes	N/A
P84244	H33_MOUSE	No assigned EC number	0.9705	1.0	0.9705	yes	N/A
P84245	H33_RAT	No assigned EC number	0.9705	1.0	0.9705	yes	N/A
P84246	H33_RABIT	No assigned EC number	0.9705	1.0	0.9705	yes	N/A
P84247	H33_CHICK	No assigned EC number	0.9705	1.0	0.9705	yes	N/A
Q9U281	H332_CAEEL	No assigned EC number	0.9558	1.0	0.9705	yes	N/A
Q28D37	H32_XENTR	No assigned EC number	0.9411	1.0	0.9705	yes	N/A
P84243	H33_HUMAN	No assigned EC number	0.9705	1.0	0.9705	yes	N/A
P69248	H32_PETCR	No assigned EC number	0.9264	1.0	0.9705	N/A	N/A
P68428	H32_WHEAT	No assigned EC number	0.9264	1.0	0.9705	N/A	N/A
P68429	H32_MEDSA	No assigned EC number	0.9264	1.0	0.9705	N/A	N/A
P84248	H33_SPISO	No assigned EC number	0.9705	1.0	0.9705	N/A	N/A
P84249	H33_DROME	No assigned EC number	0.9705	1.0	0.9705	yes	N/A
P68427	H32_PEA	No assigned EC number	0.9264	1.0	0.9705	N/A	N/A
P02299	H3_DROME	No assigned EC number	0.9411	1.0	0.9705	yes	N/A
P84227	H32_BOVIN	No assigned EC number	0.9411	1.0	0.9705	yes	N/A
Q2RAD9	H32_ORYSJ	No assigned EC number	0.9264	1.0	0.9705	yes	N/A
Q76MV0	H32_TOBAC	No assigned EC number	0.9264	1.0	0.9705	N/A	N/A
P84228	H32_MOUSE	No assigned EC number	0.9411	1.0	0.9705	yes	N/A
P84229	H32_CHICK	No assigned EC number	0.9411	1.0	0.9705	yes	N/A
Q6LBE8	H32_MUSPA	No assigned EC number	0.9411	1.0	0.9705	N/A	N/A
Q6PI20	H33_DANRE	No assigned EC number	0.9705	1.0	0.9705	yes	N/A
A2Y533	H32_ORYSI	No assigned EC number	0.9264	1.0	0.9705	N/A	N/A
P02301	H3C_MOUSE	No assigned EC number	0.9558	1.0	0.9705	yes	N/A
Q71LE2	H33_PIG	No assigned EC number	0.9705	1.0	0.9705	yes	N/A
P84250	H33_DROHY	No assigned EC number	0.9705	1.0	0.9705	N/A	N/A
P69246	H32_MAIZE	No assigned EC number	0.9264	1.0	0.9705	N/A	N/A
P08903	H32_ENCAL	No assigned EC number	0.9338	1.0	0.9705	N/A	N/A

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		132
PTZ00018		136	PTZ00018, PTZ00018, histone H3; Provisional	1e-77
PLN00121		136	PLN00121, PLN00121, histone H3; Provisional	2e-67
smart00428		105	smart00428, H3, Histone H3	1e-50
PLN00161		135	PLN00161, PLN00161, histone H3; Provisional	4e-37
PLN00160		97	PLN00160, PLN00160, histone H3; Provisional	1e-33
pfam00125		75	pfam00125, Histone, Core histone H2A/H2B/H3/H4	5e-30
COG2036		91	COG2036, HHT1, Histones H3 and H4 [Chromatin struc	6e-27

>gnl\|CDD\|185400 PTZ00018, PTZ00018, histone H3; Provisional	Back alignment and domain information

 Score =  225 bits (574), Expect = 1e-77
 Identities = 124/136 (91%), Positives = 130/136 (95%), Gaps = 4/136 (2%)

Query: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHR----TVALREIRRYQKSTE 56
           MARTKQTARKSTGGKAPRKQLA+KAARKSAP TGG+KKPHR    TVALREIRRYQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLASKAARKSAPVTGGIKKPHRYRPGTVALREIRRYQKSTE 60

Query: 57  LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI 116
           LLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTI 120

Query: 117 MPKDIQLARRIRGERA 132
           MPKDIQLARRIRGER+
Sbjct: 121 MPKDIQLARRIRGERS 136

Length = 136

>gnl\|CDD\|177733 PLN00121, PLN00121, histone H3; Provisional	Back alignment and domain information

>gnl\|CDD\|128705 smart00428, H3, Histone H3	Back alignment and domain information

>gnl\|CDD\|215082 PLN00161, PLN00161, histone H3; Provisional	Back alignment and domain information

>gnl\|CDD\|165727 PLN00160, PLN00160, histone H3; Provisional	Back alignment and domain information

>gnl\|CDD\|201020 pfam00125, Histone, Core histone H2A/H2B/H3/H4	Back alignment and domain information

>gnl\|CDD\|224947 COG2036, HHT1, Histones H3 and H4 [Chromatin structure and dynamics]	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		132
PTZ00018		136	histone H3; Provisional	100.0
PLN00121		136	histone H3; Provisional	100.0
PLN00161		135	histone H3; Provisional	100.0
KOG1745\|consensus		137		100.0
PLN00160		97	histone H3; Provisional	100.0
smart00428		105	H3 Histone H3.	100.0
COG2036		91	HHT1 Histones H3 and H4 [Chromatin structure and d	99.93
PF00125		75	Histone: Core histone H2A/H2B/H3/H4 histone h2a si	99.85
cd07981		72	TAF12 TATA Binding Protein (TBP) Associated Factor	99.4
cd00076		85	H4 Histone H4, one of the four histones, along wit	99.28
PLN00035		103	histone H4; Provisional	99.24
PTZ00015		102	histone H4; Provisional	99.22
smart00803		65	TAF TATA box binding protein associated factor. TA	99.17
smart00417		74	H4 Histone H4.	99.07
PLN00158		116	histone H2B; Provisional	98.86
cd07979		117	TAF9 TATA Binding Protein (TBP) Associated Factor	98.81
PTZ00463		117	histone H2B; Provisional	98.77
PF00808		65	CBFD_NFYB_HMF: Histone-like transcription factor (	98.76
smart00427		89	H2B Histone H2B.	98.74
PF15630		76	CENP-S: Kinetochore component CENP-S; PDB: 4DRA_C	98.33
smart00576		77	BTP Bromodomain transcription factors and PHD doma	98.32
KOG1744\|consensus		127		98.29
cd00074		115	H2A Histone 2A; H2A is a subunit of the nucleosome	98.24
KOG0870\|consensus		172		98.13
PF03847		68	TFIID_20kDa: Transcription initiation factor TFIID	98.07
PF02969		66	TAF: TATA box binding protein associated factor (T	98.0
cd08050		343	TAF6 TATA Binding Protein (TBP) Associated Factor	97.98
PF02291		129	TFIID-31kDa: Transcription initiation factor IID,	97.88
PF15511		414	CENP-T: Centromere kinetochore component CENP-T; P	97.82
KOG1142\|consensus		258		97.62
KOG0869\|consensus		168		97.03
KOG3334\|consensus		148		96.75
KOG3467\|consensus		103		96.64
PF07524		77	Bromo_TP: Bromodomain associated; InterPro: IPR006	96.62
KOG0871\|consensus		156		95.83
PLN00154		136	histone H2A; Provisional	94.87
smart00414		106	H2A Histone 2A.	94.63
PF02269		93	TFIID-18kDa: Transcription initiation factor IID,	94.54
PTZ00017		134	histone H2A; Provisional	94.29
COG5262		132	HTA1 Histone H2A [Chromatin structure and dynamics	93.48
KOG2549\|consensus		576		93.04
PLN00156		139	histone H2AX; Provisional	92.88
PLN00157		132	histone H2A; Provisional	92.69
PLN00153		129	histone H2A; Provisional	92.15
PTZ00252		134	histone H2A; Provisional	91.08
COG5150		148	Class 2 transcription repressor NC2, beta subunit	90.9
COG5094		145	TAF9 Transcription initiation factor TFIID, subuni	90.6
KOG1756\|consensus		131		90.37
cd08045		212	TAF4 TATA Binding Protein (TBP) Associated Factor	90.29
cd07978		92	TAF13 The TATA Binding Protein (TBP) Associated Fa	90.27
PF05236		264	TAF4: Transcription initiation factor TFIID compon	89.32
KOG4336\|consensus		323		87.55
COG5248		126	TAF19 Transcription initiation factor TFIID, subun	84.25
KOG1657\|consensus		236		84.19
PF09123		138	DUF1931: Domain of unknown function (DUF1931); Int	82.7
KOG3901\|consensus		109		80.87
COG5208		286	HAP5 CCAAT-binding factor, subunit C [Transcriptio	80.77

>PTZ00018 histone H3; Provisional	Back alignment and domain information

Probab=100.00  E-value=5.7e-54  Score=318.53  Aligned_cols=131  Identities=95%  Similarity=1.291  Sum_probs=124.3

Q ss_pred             CCCccccccccCCCCCCcchhhhhhhccCCCCCCCCCCccc----cchhhhHHhhhcchhhhhhcchhHHHHHHHHhhhh
Q psy10959          1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHR----TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK   76 (132)
Q Consensus         1 Martk~~a~k~~~~kap~k~~~~~~~~~~~p~~~~~~~~~r----~~alrEIr~~Qkst~llipk~pF~RlVreI~~~~~   76 (132)
                      |||||+++++++|+++|+++.++++..++.+.+++.++++|    +++|+|||+||+||+|||||+||+||||||++++.
T Consensus         1 MaRtk~~~~k~~~~~~prk~~~~~~~~~~~~~~~~~~~~~r~rpGt~aLrEIr~yQkst~lLI~k~pF~RLVREI~~~~~   80 (136)
T PTZ00018          1 MARTKQTARKSTGGKAPRKQLASKAARKSAPVTGGIKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK   80 (136)
T ss_pred             CCCCCcCccCCCCCCCCcccccccccccCCCCCCCCCCCcccCCchhHHHHHHHHcccchhccccccHHHHHHHHHHHcC
Confidence            99999999999999999999988877777766777777766    99999999999999999999999999999999999


Q ss_pred             ccccccHHHHHHHHHHHHHHHHHHHHhHHHHhhhcCccccCcccHHHHHHHhccc
Q psy10959         77 TDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER  131 (132)
Q Consensus        77 ~~~r~~~~Al~aLQeaaE~~lv~lfe~a~~~a~HakRvTi~~kDi~La~rirg~~  131 (132)
                      .++|||++||++|||++|+|||+||||+|+||+||||||||++||+|+.+|||++
T Consensus        81 ~~~rf~~~al~aLQeaaE~yLv~lfed~~lca~HakRVTl~~kD~~L~~rirg~~  135 (136)
T PTZ00018         81 TDLRFQSSAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER  135 (136)
T ss_pred             CcceeeHHHHHHHHHHHHHHHHHHhhhhHHHHHhhcceecchhhHHHHHHhcccC
Confidence            9999999999999999999999999999999999999999999999999999986

>PLN00121 histone H3; Provisional	Back alignment and domain information

>PLN00161 histone H3; Provisional	Back alignment and domain information

>KOG1745\|consensus	Back alignment and domain information

>PLN00160 histone H3; Provisional	Back alignment and domain information

>smart00428 H3 Histone H3	Back alignment and domain information

>COG2036 HHT1 Histones H3 and H4 [Chromatin structure and dynamics]	Back alignment and domain information

>PF00125 Histone: Core histone H2A/H2B/H3/H4 histone h2a signature histone h2b signature histone h3 signature histone h4 signature; InterPro: IPR007125 The core histones together with some other DNA binding proteins appear to form a superfamily defined by a common fold and distant sequence similarities [, ]	Back alignment and domain information

>cd07981 TAF12 TATA Binding Protein (TBP) Associated Factor 12 (TAF12) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex	Back alignment and domain information

>cd00076 H4 Histone H4, one of the four histones, along with H2A, H2B and H3, which forms the eukaryotic nucleosome core; along with H3, it plays a central role in nucleosome formation; histones bind to DNA and wrap the genetic material into "beads on a string" in which DNA (the string) is wrapped around small blobs of histones (the beads) at regular intervals; play a role in the inheritance of specialized chromosome structures and the control of gene activity; defects in the establishment of proper chromosome structure by histones may activate or silence genes aberrantly and thus lead to disease; the sequence of histone H4 has remained almost invariant in more than 2 billion years of evolution

Back alignment and domain information

>PLN00035 histone H4; Provisional	Back alignment and domain information

>PTZ00015 histone H4; Provisional	Back alignment and domain information

>smart00803 TAF TATA box binding protein associated factor	Back alignment and domain information

>smart00417 H4 Histone H4	Back alignment and domain information

>PLN00158 histone H2B; Provisional	Back alignment and domain information

>cd07979 TAF9 TATA Binding Protein (TBP) Associated Factor 9 (TAF9) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex	Back alignment and domain information

>PTZ00463 histone H2B; Provisional	Back alignment and domain information

>PF00808 CBFD_NFYB_HMF: Histone-like transcription factor (CBF/NF-Y) and archaeal histone; InterPro: IPR003958 The CCAAT-binding factor (CBF) is a mammalian transcription factor that binds to a CCAAT motif in the promoters of a wide variety of genes, including type I collagen and albumin	Back alignment and domain information

>smart00427 H2B Histone H2B	Back alignment and domain information

>PF15630 CENP-S: Kinetochore component CENP-S; PDB: 4DRA_C 4DRB_H 3V9R_C	Back alignment and domain information

>smart00576 BTP Bromodomain transcription factors and PHD domain containing proteins	Back alignment and domain information

>KOG1744\|consensus	Back alignment and domain information

>cd00074 H2A Histone 2A; H2A is a subunit of the nucleosome	Back alignment and domain information

>KOG0870\|consensus	Back alignment and domain information

>PF03847 TFIID_20kDa: Transcription initiation factor TFIID subunit A; InterPro: IPR003228 Human transcription initiation factor TFIID is composed of the TATA-binding polypeptide (TBP) and at least 13 TBP-associated factors (TAFs) that collectively or individually are involved in activator-dependent transcription []	Back alignment and domain information

>PF02969 TAF: TATA box binding protein associated factor (TAF); InterPro: IPR004823 The TATA box binding protein associated factor (TAF) is part of the transcription initiation factor TFIID multimeric protein complex	Back alignment and domain information

>cd08050 TAF6 TATA Binding Protein (TBP) Associated Factor 6 (TAF6) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex	Back alignment and domain information

>PF02291 TFIID-31kDa: Transcription initiation factor IID, 31kD subunit; InterPro: IPR003162 Human transcription initiation factor TFIID is composed of the TATA-binding polypeptide (TBP) and at least 13 TBP-associated factors (TAFs) that collectively or individually are involved in activator-dependent transcription []	Back alignment and domain information

>PF15511 CENP-T: Centromere kinetochore component CENP-T; PDB: 3B0D_T 3B0C_T 3VH5_T 3VH6_T	Back alignment and domain information

>KOG1142\|consensus	Back alignment and domain information

>KOG0869\|consensus	Back alignment and domain information

>KOG3334\|consensus	Back alignment and domain information

>KOG3467\|consensus	Back alignment and domain information

>PF07524 Bromo_TP: Bromodomain associated; InterPro: IPR006565 This bromodomain is found in eukaryotic transcription factors and PHD domain containing proteins (IPR001965 from INTERPRO)	Back alignment and domain information

>KOG0871\|consensus	Back alignment and domain information

>PLN00154 histone H2A; Provisional	Back alignment and domain information

>smart00414 H2A Histone 2A	Back alignment and domain information

>PF02269 TFIID-18kDa: Transcription initiation factor IID, 18kD subunit; InterPro: IPR003195 This family includes the Spt3 yeast transcription factors and the 18 kDa subunit from human transcription initiation factor IID (TFIID-18)	Back alignment and domain information

>PTZ00017 histone H2A; Provisional	Back alignment and domain information

>COG5262 HTA1 Histone H2A [Chromatin structure and dynamics]	Back alignment and domain information

>KOG2549\|consensus	Back alignment and domain information

>PLN00156 histone H2AX; Provisional	Back alignment and domain information

>PLN00157 histone H2A; Provisional	Back alignment and domain information

>PLN00153 histone H2A; Provisional	Back alignment and domain information

>PTZ00252 histone H2A; Provisional	Back alignment and domain information

>COG5150 Class 2 transcription repressor NC2, beta subunit (Dr1) [Transcription]	Back alignment and domain information

>COG5094 TAF9 Transcription initiation factor TFIID, subunit TAF9 (also component of histone acetyltransferase SAGA) [Transcription]	Back alignment and domain information

>KOG1756\|consensus	Back alignment and domain information

>cd08045 TAF4 TATA Binding Protein (TBP) Associated Factor 4 (TAF4) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex	Back alignment and domain information

>cd07978 TAF13 The TATA Binding Protein (TBP) Associated Factor 13 (TAF13) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex	Back alignment and domain information

>PF05236 TAF4: Transcription initiation factor TFIID component TAF4 family; InterPro: IPR007900 Accurate transcription initiation at protein-coding genes by RNA polymerase II requires the assembly of a multiprotein complex around the mRNA start site	Back alignment and domain information

>KOG4336\|consensus	Back alignment and domain information

>COG5248 TAF19 Transcription initiation factor TFIID, subunit TAF13 [Transcription]	Back alignment and domain information

>KOG1657\|consensus	Back alignment and domain information

>PF09123 DUF1931: Domain of unknown function (DUF1931); InterPro: IPR015207 This entry represents a set of hypothetical bacterial proteins containing a core of six alpha-helices, where one central helix is surrounded by the other five	Back alignment and domain information

>KOG3901\|consensus	Back alignment and domain information

>COG5208 HAP5 CCAAT-binding factor, subunit C [Transcription]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		132
4hga_B		136	Structure Of The Variant Histone H3.3-H4 Heterodime		6e-70
3av2_A		139	The Human Nucleosome Structure Containing The Histo		7e-70
2hio_C		136	Histone Octamer (Chicken), Chromosomal Protein Leng		4e-68
3av1_A		139	The Human Nucleosome Structure Containing The Histo		5e-68
2cv5_A		136	Crystal Structure Of Human Nucleosome Core Particle		2e-67
3lel_A		136	Structural Insight Into The Sequence-Dependence Of		2e-67
3afa_A		139	The Human Nucleosome Structure Length = 139		2e-67
2io5_B		135	Crystal Structure Of The Cia- Histone H3-H4 Complex		2e-67
3azh_A		139	Crystal Structure Of Human Nucleosome Core Particle		5e-67
3azg_A		139	Crystal Structure Of Human Nucleosome Core Particle		5e-67
3azf_A		139	Crystal Structure Of Human Nucleosome Core Particle		5e-67
3aze_A		139	Crystal Structure Of Human Nucleosome Core Particle		5e-67
3ayw_A		139	Crystal Structure Of Human Nucleosome Core Particle		5e-67
1kx3_A		135	X-Ray Structure Of The Nucleosome Core Particle, Nc		1e-66
1f66_A		136	2.6 A Crystal Structure Of A Nucleosome Core Partic		1e-66
4h9n_A		135	Complex Structure 1 Of DaxxH3.3(SUB5)H4 Length = 13		3e-66
3kxb_A		135	Structural Characterization Of H3k56q Nucleosomes A		3e-66
3a6n_A		139	The Nucleosome Containing A Testis-Specific Histone		7e-66
1zla_A		135	X-Ray Structure Of A Kaposi's Sarcoma Herpesvirus L		7e-66
4h9s_A		135	Complex Structure 6 Of DaxxH3.3(SUB7)H4 Length = 13		2e-65
4h9o_A		135	Complex Structure 2 Of DaxxH3.3(SUB5,G90M)H4 Length		2e-65
1m18_A		135	Ligand Binding Alters The Structure And Dynamics Of		3e-65
1p3b_A		135	Crystallographic Studies Of Nucleosome Core Particl		3e-65
3c1c_A		135	The Effect Of H3 K79 Dimethylation And H4 K20 Trime		4e-65
1p3k_A		135	Crystallographic Studies Of Nucleosome Core Particl		1e-64
1p3a_A		135	Crystallographic Studies Of Nucleosome Core Particl		2e-64
1p3m_A		135	Crystallographic Studies Of Nucleosome Core Particl		2e-64
1p34_A		135	Crystallographic Studies Of Nucleosome Core Particl		2e-64
1p3l_A		135	Crystallographic Studies Of Nucleosome Core Particl		3e-64
1id3_A		135	Crystal Structure Of The Yeast Nucleosome Core Part		7e-62
4h9p_A		135	Complex Structure 3 Of DaxxH3.3(SUB5,G90A)H4 Length		7e-59
1aoi_A		116	Complex Between Nucleosome Core Particle (H3,H4,H2a		5e-56
1hio_C		93	Histone Octamer (Chicken), Chromosomal Protein, Alp		6e-46
3kwq_A		98	Structural Characterization Of H3k56q Nucleosomes A		7e-46
2hue_B		77	Structure Of The H3-h4 Chaperone Asf1 Bound To Hist		7e-37
4eo5_B		76	Yeast Asf1 Bound To H3H4G94P MUTANT Length = 76		8e-37
2yfw_A		92	Heterotetramer Structure Of Kluyveromyces Lactis Cs		3e-29
2yfv_A		100	The Heterotrimeric Complex Of Kluyveromyces Lactis		2e-28
3nqu_A		140	Crystal Structure Of Partially Trypsinized (Cenp-AH		9e-26
3an2_A		143	The Structure Of The Centromeric Nucleosome Contain		9e-26
3r45_A		156	Structure Of A Cenp-A-Histone H4 Heterodimer In Com		1e-25
2l5a_A		235	Structural Basis For Recognition Of Centromere Spec		2e-25
3nqj_A		82	Crystal Structure Of (Cenp-AH4)2 HETEROTETRAMER Len		5e-20
2ly8_A		121	The Budding Yeast Chaperone Scm3 Recognizes The Par		6e-15
4ft4_P		32	Crystal Structure Of Zea Mays Zmet2 In Complex H3(1		3e-09
4hsu_C		30	Crystal Structure Of Lsd2-npac With H3(1-26)in Spac		1e-08
3n9p_B		32	Cekdm7a From C.Elegans, Complex With H3k4me3k27me2		2e-08
3n9n_B		32	Cekdm7a From C.Elegans, Complex With H3k4me3k9me2 P		2e-08
4gu0_E		26	Crystal Structure Of Lsd2 With H3 Length = 26		2e-06
3u5p_I		28	Crystal Structure Of The Complex Of Trim33 Phd-Brom		9e-06
3a1b_A		159	Crystal Structure Of The Dnmt3a Add Domain In Compl		5e-05
3kv4_B		24	Structure Of Phf8 In Complex With Histone H3 Length		5e-05
3avr_B		22	Catalytic Fragment Of UtxKDM6A BOUND WITH HISTONE H		2e-04
2kft_B		21	Nmr Solution Structure Of The First Phd Finger Doma		2e-04
2kwk_B		20	Solution Structures Of The Double Phd Fingers Of Hu		3e-04
2uxn_E		21	Structural Basis Of Histone Demethylation By Lsd1 R		4e-04
2v1d_C		21	Structural Basis Of Lsd1-Corest Selectivity In Hist		4e-04
2g46_C		21	Structure Of Vset In Complex With Mek27 H3 Pept. An		8e-04

>pdb|4HGA|B Chain B, Structure Of The Variant Histone H3.3-H4 Heterodimer In Complex With Its Chaperone Daxx Length = 136