Psyllid ID: psy10
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 100 | ||||||
| 383854170 | 687 | PREDICTED: G protein-coupled receptor ki | 0.73 | 0.106 | 0.904 | 3e-34 | |
| 328790520 | 686 | PREDICTED: LOW QUALITY PROTEIN: G protei | 0.73 | 0.106 | 0.890 | 8e-34 | |
| 380023197 | 642 | PREDICTED: LOW QUALITY PROTEIN: G protei | 0.73 | 0.113 | 0.890 | 9e-34 | |
| 156546725 | 686 | PREDICTED: G protein-coupled receptor ki | 0.73 | 0.106 | 0.890 | 1e-33 | |
| 242003622 | 695 | cAMP-dependent protein kinase catalytic | 0.73 | 0.105 | 0.904 | 2e-33 | |
| 307189223 | 649 | G protein-coupled receptor kinase 1 [Cam | 0.73 | 0.112 | 0.890 | 2e-33 | |
| 328717205 | 690 | PREDICTED: G protein-coupled receptor ki | 0.73 | 0.105 | 0.904 | 2e-33 | |
| 91088973 | 639 | PREDICTED: similar to G protein-coupled | 0.73 | 0.114 | 0.890 | 2e-33 | |
| 6175630 | 690 | G protein-coupled receptor kinase type 2 | 0.73 | 0.105 | 0.904 | 3e-33 | |
| 340719091 | 687 | PREDICTED: G protein-coupled receptor ki | 0.73 | 0.106 | 0.876 | 5e-33 |
| >gi|383854170|ref|XP_003702595.1| PREDICTED: G protein-coupled receptor kinase 1-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
Score = 149 bits (375), Expect = 3e-34, Method: Compositional matrix adjust.
Identities = 66/73 (90%), Positives = 72/73 (98%)
Query: 16 SDEVKEHPFFTGLDWTQVYMQKYTPPLIPPRGEVNAADAFDIGSFDEEDTKGIKLTEADQ 75
+DE+KEHPFF+G+DW QVY+QKYTPPLIPPRGEVNAADAFDIGSFDEEDTKGIKLT+ADQ
Sbjct: 445 ADELKEHPFFSGIDWQQVYLQKYTPPLIPPRGEVNAADAFDIGSFDEEDTKGIKLTDADQ 504
Query: 76 DLYKNFPLTISER 88
DLYKNFPLTISER
Sbjct: 505 DLYKNFPLTISER 517
|
Source: Megachile rotundata Species: Megachile rotundata Genus: Megachile Family: Megachilidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|328790520|ref|XP_396647.4| PREDICTED: LOW QUALITY PROTEIN: G protein-coupled receptor kinase 1 isoform 1 [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|380023197|ref|XP_003695412.1| PREDICTED: LOW QUALITY PROTEIN: G protein-coupled receptor kinase 1-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|156546725|ref|XP_001604700.1| PREDICTED: G protein-coupled receptor kinase 1-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|242003622|ref|XP_002422801.1| cAMP-dependent protein kinase catalytic subunit, putative [Pediculus humanus corporis] gi|212505659|gb|EEB10063.1| cAMP-dependent protein kinase catalytic subunit, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|307189223|gb|EFN73671.1| G protein-coupled receptor kinase 1 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|328717205|ref|XP_003246147.1| PREDICTED: G protein-coupled receptor kinase 1 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|91088973|ref|XP_966480.1| PREDICTED: similar to G protein-coupled receptor kinase 1 CG40129-PA [Tribolium castaneum] gi|270011553|gb|EFA08001.1| hypothetical protein TcasGA2_TC005590 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|6175630|gb|AAF05109.1|AF157046_1 G protein-coupled receptor kinase type 2 [Homarus americanus] | Back alignment and taxonomy information |
|---|
| >gi|340719091|ref|XP_003397990.1| PREDICTED: G protein-coupled receptor kinase 1-like [Bombus terrestris] gi|350423291|ref|XP_003493433.1| PREDICTED: G protein-coupled receptor kinase 1-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 100 | ||||||
| UNIPROTKB|F1NTL1 | 625 | ADRBK2 "Uncharacterized protei | 0.73 | 0.116 | 0.835 | 4.4e-30 | |
| ZFIN|ZDB-GENE-030616-382 | 688 | adrbk2 "adrenergic, beta, rece | 0.73 | 0.106 | 0.821 | 5.7e-29 | |
| FB|FBgn0260798 | 700 | Gprk1 "G protein-coupled recep | 0.73 | 0.104 | 0.835 | 7.7e-29 | |
| UNIPROTKB|F1PF32 | 646 | ADRBK2 "Uncharacterized protei | 0.73 | 0.113 | 0.821 | 1e-28 | |
| UNIPROTKB|P35626 | 688 | ADRBK2 "Beta-adrenergic recept | 0.73 | 0.106 | 0.821 | 1.2e-28 | |
| UNIPROTKB|F1N7J3 | 652 | ADRBK1 "Beta-adrenergic recept | 0.73 | 0.111 | 0.794 | 7.6e-28 | |
| MGI|MGI:87941 | 688 | Adrbk2 "adrenergic receptor ki | 0.71 | 0.103 | 0.816 | 8.9e-28 | |
| UNIPROTKB|P21146 | 689 | ADRBK1 "Beta-adrenergic recept | 0.73 | 0.105 | 0.794 | 8.9e-28 | |
| UNIPROTKB|E2R5J6 | 689 | ADRBK1 "Uncharacterized protei | 0.73 | 0.105 | 0.794 | 8.9e-28 | |
| UNIPROTKB|P25098 | 689 | ADRBK1 "Beta-adrenergic recept | 0.73 | 0.105 | 0.794 | 8.9e-28 |
| UNIPROTKB|F1NTL1 ADRBK2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Score = 339 (124.4 bits), Expect = 4.4e-30, P = 4.4e-30
Identities = 61/73 (83%), Positives = 67/73 (91%)
Query: 16 SDEVKEHPFFTGLDWTQVYMQKYTPPLIPPRGEVNAADAFDIGSFDEEDTKGIKLTEADQ 75
+ EVKEHPFF G+DW QVY+QKY PPLIPPRGEVNAADAFDIGSFDEEDTKGIKL ++DQ
Sbjct: 381 AQEVKEHPFFKGIDWQQVYLQKYPPPLIPPRGEVNAADAFDIGSFDEEDTKGIKLLDSDQ 440
Query: 76 DLYKNFPLTISER 88
+LYKNFPL ISER
Sbjct: 441 ELYKNFPLVISER 453
|
|
| ZFIN|ZDB-GENE-030616-382 adrbk2 "adrenergic, beta, receptor kinase 2" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0260798 Gprk1 "G protein-coupled receptor kinase 1" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PF32 ADRBK2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P35626 ADRBK2 "Beta-adrenergic receptor kinase 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N7J3 ADRBK1 "Beta-adrenergic receptor kinase 1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:87941 Adrbk2 "adrenergic receptor kinase, beta 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P21146 ADRBK1 "Beta-adrenergic receptor kinase 1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R5J6 ADRBK1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P25098 ADRBK1 "Beta-adrenergic receptor kinase 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 100 | |||
| cd05606 | 278 | cd05606, STKc_beta_ARK, Catalytic domain of the Pr | 1e-12 | |
| cd05633 | 279 | cd05633, STKc_GRK3, Catalytic domain of the Protei | 2e-10 | |
| cd05585 | 312 | cd05585, STKc_YPK1_like, Catalytic domain of Yeast | 2e-08 | |
| cd05577 | 277 | cd05577, STKc_GRK, Catalytic domain of the Protein | 6e-08 | |
| cd05589 | 324 | cd05589, STKc_PKN, Catalytic domain of the Protein | 2e-07 | |
| cd05575 | 323 | cd05575, STKc_SGK, Catalytic domain of the Protein | 9e-07 | |
| cd05571 | 323 | cd05571, STKc_PKB, Catalytic domain of the Protein | 2e-06 | |
| cd05614 | 332 | cd05614, STKc_MSK2_N, N-terminal catalytic domain | 5e-06 | |
| PTZ00263 | 329 | PTZ00263, PTZ00263, protein kinase A catalytic sub | 6e-06 | |
| cd05604 | 325 | cd05604, STKc_SGK3, Catalytic domain of the Protei | 1e-05 | |
| cd05580 | 290 | cd05580, STKc_PKA, Catalytic domain of the Protein | 1e-05 | |
| cd05586 | 330 | cd05586, STKc_Sck1_like, Catalytic domain of Suppr | 1e-05 | |
| cd05570 | 318 | cd05570, STKc_PKC, Catalytic domain of the Protein | 2e-05 | |
| cd05582 | 318 | cd05582, STKc_RSK_N, N-terminal catalytic domain o | 3e-05 | |
| smart00133 | 64 | smart00133, S_TK_X, Extension to Ser/Thr-type prot | 7e-05 | |
| cd05590 | 320 | cd05590, STKc_nPKC_eta, Catalytic domain of the Pr | 8e-05 | |
| cd05591 | 321 | cd05591, STKc_nPKC_epsilon, Catalytic domain of th | 1e-04 | |
| cd05594 | 325 | cd05594, STKc_PKB_alpha, Catalytic domain of the P | 1e-04 | |
| cd05583 | 288 | cd05583, STKc_MSK_N, N-terminal catalytic domain o | 1e-04 | |
| cd05588 | 329 | cd05588, STKc_aPKC, Catalytic domain of the Protei | 2e-04 | |
| cd05612 | 291 | cd05612, STKc_PRKX_like, Catalytic domain of PRKX- | 2e-04 | |
| cd05573 | 350 | cd05573, STKc_ROCK_NDR_like, Catalytic domain of R | 3e-04 | |
| cd05617 | 327 | cd05617, STKc_aPKC_zeta, Catalytic domain of the P | 3e-04 | |
| cd05595 | 323 | cd05595, STKc_PKB_beta, Catalytic domain of the Pr | 4e-04 | |
| cd05599 | 364 | cd05599, STKc_NDR_like, Catalytic domain of Nuclea | 5e-04 | |
| cd05603 | 321 | cd05603, STKc_SGK2, Catalytic domain of the Protei | 5e-04 | |
| cd05609 | 305 | cd05609, STKc_MAST, Catalytic domain of the Protei | 6e-04 | |
| cd05584 | 323 | cd05584, STKc_p70S6K, Catalytic domain of the Prot | 0.001 | |
| cd05587 | 324 | cd05587, STKc_cPKC, Catalytic domain of the Protei | 0.001 | |
| cd05619 | 316 | cd05619, STKc_nPKC_theta, Catalytic domain of the | 0.001 | |
| cd05593 | 328 | cd05593, STKc_PKB_gamma, Catalytic domain of the P | 0.002 | |
| cd05592 | 316 | cd05592, STKc_nPKC_theta_delta, Catalytic domain o | 0.002 | |
| cd05574 | 316 | cd05574, STKc_phototropin_like, Catalytic domain o | 0.002 | |
| cd05605 | 285 | cd05605, STKc_GRK4_like, Catalytic domain of G pro | 0.004 | |
| cd05579 | 265 | cd05579, STKc_MAST_like, Catalytic domain of Micro | 0.004 |
| >gnl|CDD|173697 cd05606, STKc_beta_ARK, Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase | Back alignment and domain information |
|---|
Score = 61.1 bits (148), Expect = 1e-12
Identities = 22/48 (45%), Positives = 30/48 (62%), Gaps = 5/48 (10%)
Query: 3 KHKAKTPIQQQL-----RSDEVKEHPFFTGLDWTQVYMQKYTPPLIPP 45
+ + + ++L + EVKEHPFF LDW V++QKY PPLIPP
Sbjct: 231 EGLLQRDVNRRLGCLGRGAQEVKEHPFFRSLDWQMVFLQKYPPPLIPP 278
|
Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, beta-adrenergic receptor kinase (beta-ARK) group, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. The beta-ARK group is composed of GRK2, GRK3, and similar proteins. GRK2 and GRK3 are both widely expressed in many tissues, although GRK2 is present at higher levels. They contain an N-terminal RGS homology (RH) domain, a central catalytic domain, and C-terminal pleckstrin homology (PH) domain that mediates PIP2 and G protein betagamma-subunit translocation to the membrane. GRK2 (also called beta-ARK or beta-ARK1) is important in regulating several cardiac receptor responses. It plays a role in cardiac development and in hypertension. Deletion of GRK2 in mice results in embryonic lethality, caused by hypoplasia of the ventricular myocardium. GRK2 also plays important roles in the liver (as a regulator of portal blood pressure), in immune cells, and in the nervous system. Altered GRK2 expression has been reported in several disorders including major depression, schizophrenia, bipolar disorder, and Parkinsonism. Length = 278 |
| >gnl|CDD|173722 cd05633, STKc_GRK3, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 | Back alignment and domain information |
|---|
| >gnl|CDD|173676 cd05585, STKc_YPK1_like, Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173668 cd05577, STKc_GRK, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173680 cd05589, STKc_PKN, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N | Back alignment and domain information |
|---|
| >gnl|CDD|173666 cd05575, STKc_SGK, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173662 cd05571, STKc_PKB, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B | Back alignment and domain information |
|---|
| >gnl|CDD|173705 cd05614, STKc_MSK2_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|140289 PTZ00263, PTZ00263, protein kinase A catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173695 cd05604, STKc_SGK3, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 | Back alignment and domain information |
|---|
| >gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173677 cd05586, STKc_Sck1_like, Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173661 cd05570, STKc_PKC, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C | Back alignment and domain information |
|---|
| >gnl|CDD|173673 cd05582, STKc_RSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase | Back alignment and domain information |
|---|
| >gnl|CDD|214529 smart00133, S_TK_X, Extension to Ser/Thr-type protein kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173681 cd05590, STKc_nPKC_eta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta | Back alignment and domain information |
|---|
| >gnl|CDD|173682 cd05591, STKc_nPKC_epsilon, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon | Back alignment and domain information |
|---|
| >gnl|CDD|173685 cd05594, STKc_PKB_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha | Back alignment and domain information |
|---|
| >gnl|CDD|173674 cd05583, STKc_MSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173679 cd05588, STKc_aPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C | Back alignment and domain information |
|---|
| >gnl|CDD|173703 cd05612, STKc_PRKX_like, Catalytic domain of PRKX-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173708 cd05617, STKc_aPKC_zeta, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta | Back alignment and domain information |
|---|
| >gnl|CDD|173686 cd05595, STKc_PKB_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta | Back alignment and domain information |
|---|
| >gnl|CDD|173690 cd05599, STKc_NDR_like, Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173694 cd05603, STKc_SGK2, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|173700 cd05609, STKc_MAST, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173675 cd05584, STKc_p70S6K, Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173678 cd05587, STKc_cPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C | Back alignment and domain information |
|---|
| >gnl|CDD|173709 cd05619, STKc_nPKC_theta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta | Back alignment and domain information |
|---|
| >gnl|CDD|173684 cd05593, STKc_PKB_gamma, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma | Back alignment and domain information |
|---|
| >gnl|CDD|173683 cd05592, STKc_nPKC_theta_delta, Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta | Back alignment and domain information |
|---|
| >gnl|CDD|173665 cd05574, STKc_phototropin_like, Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173696 cd05605, STKc_GRK4_like, Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 100 | |||
| KOG0694|consensus | 694 | 99.83 | ||
| KOG0986|consensus | 591 | 99.8 | ||
| KOG0598|consensus | 357 | 99.67 | ||
| KOG0696|consensus | 683 | 99.67 | ||
| KOG0690|consensus | 516 | 99.62 | ||
| KOG0605|consensus | 550 | 99.59 | ||
| KOG0695|consensus | 593 | 99.58 | ||
| KOG0616|consensus | 355 | 99.53 | ||
| KOG0612|consensus | 1317 | 99.34 | ||
| KOG0610|consensus | 459 | 99.31 | ||
| smart00133 | 64 | S_TK_X Extension to Ser/Thr-type protein kinases. | 99.15 | |
| KOG0614|consensus | 732 | 99.09 | ||
| cd05617 | 327 | STKc_aPKC_zeta Catalytic domain of the Protein Ser | 99.07 | |
| cd05590 | 320 | STKc_nPKC_eta Catalytic domain of the Protein Seri | 99.03 | |
| cd05570 | 318 | STKc_PKC Catalytic domain of the Protein Serine/Th | 99.02 | |
| cd05619 | 316 | STKc_nPKC_theta Catalytic domain of the Protein Se | 99.02 | |
| KOG0608|consensus | 1034 | 99.0 | ||
| cd05592 | 316 | STKc_nPKC_theta_delta Catalytic domain of the Prot | 98.99 | |
| cd05589 | 324 | STKc_PKN Catalytic domain of the Protein Serine/Th | 98.99 | |
| KOG0603|consensus | 612 | 98.98 | ||
| cd05620 | 316 | STKc_nPKC_delta Catalytic domain of the Protein Se | 98.92 | |
| cd05588 | 329 | STKc_aPKC Catalytic domain of the Protein Serine/T | 98.9 | |
| cd05571 | 323 | STKc_PKB Catalytic domain of the Protein Serine/Th | 98.87 | |
| PTZ00426 | 340 | cAMP-dependent protein kinase catalytic subunit; P | 98.86 | |
| cd05618 | 329 | STKc_aPKC_iota Catalytic domain of the Protein Ser | 98.85 | |
| cd05587 | 324 | STKc_cPKC Catalytic domain of the Protein Serine/T | 98.84 | |
| cd05591 | 321 | STKc_nPKC_epsilon Catalytic domain of the Protein | 98.83 | |
| cd05616 | 323 | STKc_cPKC_beta Catalytic domain of the Protein Ser | 98.83 | |
| cd05586 | 330 | STKc_Sck1_like Catalytic domain of Suppressor of l | 98.82 | |
| cd05585 | 312 | STKc_YPK1_like Catalytic domain of Yeast Protein K | 98.77 | |
| cd05615 | 323 | STKc_cPKC_alpha Catalytic domain of the Protein Se | 98.76 | |
| cd05593 | 328 | STKc_PKB_gamma Catalytic domain of the Protein Ser | 98.75 | |
| cd05614 | 332 | STKc_MSK2_N N-terminal catalytic domain of the Pro | 98.75 | |
| cd05604 | 325 | STKc_SGK3 Catalytic domain of the Protein Serine/T | 98.74 | |
| PTZ00263 | 329 | protein kinase A catalytic subunit; Provisional | 98.7 | |
| cd05575 | 323 | STKc_SGK Catalytic domain of the Protein Serine/Th | 98.63 | |
| cd05631 | 285 | STKc_GRK4 Catalytic domain of the Protein Serine/T | 98.61 | |
| cd05584 | 323 | STKc_p70S6K Catalytic domain of the Protein Serine | 98.53 | |
| cd05602 | 325 | STKc_SGK1 Catalytic domain of the Protein Serine/T | 98.53 | |
| cd05573 | 350 | STKc_ROCK_NDR_like Catalytic domain of ROCK- and N | 98.53 | |
| cd05595 | 323 | STKc_PKB_beta Catalytic domain of the Protein Seri | 98.52 | |
| cd05582 | 318 | STKc_RSK_N N-terminal catalytic domain of the Prot | 98.5 | |
| cd05612 | 291 | STKc_PRKX_like Catalytic domain of PRKX-like Prote | 98.49 | |
| KOG0592|consensus | 604 | 98.45 | ||
| cd05603 | 321 | STKc_SGK2 Catalytic domain of the Protein Serine/T | 98.29 | |
| cd05594 | 325 | STKc_PKB_alpha Catalytic domain of the Protein Ser | 98.28 | |
| cd05599 | 364 | STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel | 98.28 | |
| cd05625 | 382 | STKc_LATS1 Catalytic domain of the Protein Serine/ | 98.27 | |
| cd05630 | 285 | STKc_GRK6 Catalytic domain of the Protein Serine/T | 98.26 | |
| cd05596 | 370 | STKc_ROCK Catalytic domain of the Protein Serine/T | 98.23 | |
| cd05605 | 285 | STKc_GRK4_like Catalytic domain of G protein-coupl | 98.23 | |
| cd05607 | 277 | STKc_GRK7 Catalytic domain of the Protein Serine/T | 98.23 | |
| cd05627 | 360 | STKc_NDR2 Catalytic domain of the Protein Serine/T | 98.22 | |
| cd05608 | 280 | STKc_GRK1 Catalytic domain of the Protein Serine/T | 98.21 | |
| cd05628 | 363 | STKc_NDR1 Catalytic domain of the Protein Serine/T | 98.21 | |
| cd05626 | 381 | STKc_LATS2 Catalytic domain of the Protein Serine/ | 98.16 | |
| cd05629 | 377 | STKc_NDR_like_fungal Catalytic domain of Fungal Nu | 98.14 | |
| cd05580 | 290 | STKc_PKA Catalytic domain of the Protein Serine/Th | 98.13 | |
| cd05601 | 330 | STKc_CRIK Catalytic domain of the Protein Serine/T | 98.12 | |
| cd05621 | 370 | STKc_ROCK2 Catalytic domain of the Protein Serine/ | 98.06 | |
| cd05583 | 288 | STKc_MSK_N N-terminal catalytic domain of the Prot | 98.05 | |
| cd05633 | 279 | STKc_GRK3 Catalytic domain of the Protein Serine/T | 97.98 | |
| cd05622 | 371 | STKc_ROCK1 Catalytic domain of the Protein Serine/ | 97.86 | |
| cd05577 | 277 | STKc_GRK Catalytic domain of the Protein Serine/Th | 97.79 | |
| cd05623 | 332 | STKc_MRCK_alpha Catalytic domain of the Protein Se | 97.78 | |
| cd05632 | 285 | STKc_GRK5 Catalytic domain of the Protein Serine/T | 97.78 | |
| KOG0606|consensus | 1205 | 97.74 | ||
| cd05597 | 331 | STKc_DMPK_like Catalytic domain of Myotonic Dystro | 97.7 | |
| cd05598 | 376 | STKc_LATS Catalytic domain of the Protein Serine/T | 97.6 | |
| cd05600 | 333 | STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- | 97.51 | |
| cd05613 | 290 | STKc_MSK1_N N-terminal catalytic domain of the Pro | 97.5 | |
| cd05624 | 331 | STKc_MRCK_beta Catalytic domain of the Protein Ser | 97.46 | |
| cd05606 | 278 | STKc_beta_ARK Catalytic domain of the Protein Seri | 97.45 | |
| PF00433 | 48 | Pkinase_C: Protein kinase C terminal domain; Inter | 97.39 | |
| cd05609 | 305 | STKc_MAST Catalytic domain of the Protein Serine/T | 97.17 | |
| cd05610 | 669 | STKc_MASTL Catalytic domain of the Protein Serine/ | 97.04 | |
| cd05574 | 316 | STKc_phototropin_like Catalytic domain of Phototro | 96.99 | |
| KOG0606|consensus | 1205 | 96.52 | ||
| cd07869 | 303 | STKc_PFTAIRE1 Catalytic domain of the Serine/Threo | 95.82 | |
| PLN03225 | 566 | Serine/threonine-protein kinase SNT7; Provisional | 94.48 | |
| cd07859 | 338 | STKc_TDY_MAPK_plant Catalytic domain of the Serine | 94.16 | |
| cd06644 | 292 | STKc_STK10_LOK Catalytic domain of the Protein Ser | 93.93 | |
| PHA03207 | 392 | serine/threonine kinase US3; Provisional | 93.92 | |
| PTZ00284 | 467 | protein kinase; Provisional | 93.65 | |
| cd07875 | 364 | STKc_JNK1 Catalytic domain of the Serine/Threonine | 93.49 | |
| cd07873 | 301 | STKc_PCTAIRE1 Catalytic domain of the Serine/Threo | 93.44 | |
| cd07872 | 309 | STKc_PCTAIRE2 Catalytic domain of the Serine/Threo | 93.35 | |
| PTZ00036 | 440 | glycogen synthase kinase; Provisional | 93.22 | |
| cd06616 | 288 | PKc_MKK4 Catalytic domain of the dual-specificity | 92.87 | |
| PHA03210 | 501 | serine/threonine kinase US3; Provisional | 92.22 | |
| cd07853 | 372 | STKc_NLK Catalytic domain of the Serine/Threonine | 92.03 | |
| cd07876 | 359 | STKc_JNK2 Catalytic domain of the Serine/Threonine | 91.73 | |
| PHA03212 | 391 | serine/threonine kinase US3; Provisional | 91.65 | |
| KOG0585|consensus | 576 | 91.24 | ||
| cd07845 | 309 | STKc_CDK10 Catalytic domain of the Serine/Threonin | 91.2 | |
| cd07879 | 342 | STKc_p38delta_MAPK13 Catalytic domain of the Serin | 91.17 | |
| cd07878 | 343 | STKc_p38beta_MAPK11 Catalytic domain of the Serine | 90.83 | |
| cd06649 | 331 | PKc_MEK2 Catalytic domain of the dual-specificity | 90.62 | |
| cd07858 | 337 | STKc_TEY_MAPK_plant Catalytic domain of the Serine | 90.58 | |
| cd07851 | 343 | STKc_p38 Catalytic domain of the Serine/Threonine | 90.31 | |
| cd08216 | 314 | PK_STRAD Pseudokinase domain of STE20-related kina | 90.08 | |
| KOG0615|consensus | 475 | 89.74 | ||
| cd08227 | 327 | PK_STRAD_alpha Pseudokinase domain of STE20-relate | 89.54 | |
| cd06617 | 283 | PKc_MKK3_6 Catalytic domain of the dual-specificit | 89.5 | |
| cd07849 | 336 | STKc_ERK1_2_like Catalytic domain of Extracellular | 89.12 | |
| cd07854 | 342 | STKc_MAPK4_6 Catalytic domain of the Serine/Threon | 89.11 | |
| cd07841 | 298 | STKc_CDK7 Catalytic domain of the Serine/Threonine | 89.04 | |
| cd06650 | 333 | PKc_MEK1 Catalytic domain of the dual-specificity | 88.92 | |
| cd07834 | 330 | STKc_MAPK Catalytic domain of the Serine/Threonine | 88.9 | |
| PTZ00024 | 335 | cyclin-dependent protein kinase; Provisional | 88.44 | |
| cd08226 | 328 | PK_STRAD_beta Pseudokinase domain of STE20-related | 88.27 | |
| PLN00034 | 353 | mitogen-activated protein kinase kinase; Provision | 88.18 | |
| KOG0665|consensus | 369 | 88.01 | ||
| cd07880 | 343 | STKc_p38gamma_MAPK12 Catalytic domain of the Serin | 87.62 | |
| cd07874 | 355 | STKc_JNK3 Catalytic domain of the Serine/Threonine | 87.58 | |
| cd07856 | 328 | STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre | 87.46 | |
| cd06621 | 287 | PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek | 87.26 | |
| cd06611 | 280 | STKc_SLK_like Catalytic domain of Ste20-like kinas | 87.03 | |
| KOG0575|consensus | 592 | 86.44 | ||
| cd06609 | 274 | STKc_MST3_like Catalytic domain of Mammalian Ste20 | 86.16 | |
| cd06619 | 279 | PKc_MKK5 Catalytic domain of the dual-specificity | 85.62 | |
| KOG0583|consensus | 370 | 85.48 | ||
| cd07850 | 353 | STKc_JNK Catalytic domain of the Serine/Threonine | 85.25 | |
| cd07855 | 334 | STKc_ERK5 Catalytic domain of the Serine/Threonine | 85.05 | |
| cd06615 | 308 | PKc_MEK Catalytic domain of the dual-specificity P | 84.53 | |
| cd07877 | 345 | STKc_p38alpha_MAPK14 Catalytic domain of the Serin | 83.25 | |
| cd06658 | 292 | STKc_PAK5 Catalytic domain of the Protein Serine/T | 83.08 | |
| KOG0581|consensus | 364 | 82.43 | ||
| cd06643 | 282 | STKc_SLK Catalytic domain of the Protein Serine/Th | 81.98 | |
| cd06622 | 286 | PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS | 81.98 | |
| KOG0588|consensus | 786 | 81.87 | ||
| KOG0604|consensus | 400 | 81.63 | ||
| cd06917 | 277 | STKc_NAK1_like Catalytic domain of Fungal Nak1-lik | 81.02 | |
| KOG0579|consensus | 1187 | 80.73 |
| >KOG0694|consensus | Back alignment and domain information |
|---|
Probab=99.83 E-value=1.9e-21 Score=146.07 Aligned_cols=81 Identities=30% Similarity=0.636 Sum_probs=71.3
Q ss_pred CCCccCCCCCcccC----ChhhhhcCCCCCCCChhHHhcCcCCCCccCCCCCCCCCCCCCCCCCCccccCCC--------
Q psy10 1 MPKHKAKTPIQQQL----RSDEVKEHPFFTGLDWTQVYMQKYTPPLIPPRGEVNAADAFDIGSFDEEDTKGI-------- 68 (100)
Q Consensus 1 l~k~l~k~p~~r~~----g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~~~~~~~~~~~d~~~f~~~~~~~~-------- 68 (100)
|+++|+|+|.+||+ |+++||.||||+.|||++|++|+++|||+|.+ ++..|.+|||++++.+.
T Consensus 599 l~~ll~k~p~kRLG~~e~d~~~i~~hpFFr~i~w~~L~~r~i~PPf~P~i-----~~~~D~snFd~eFt~e~p~Lt~~~~ 673 (694)
T KOG0694|consen 599 MRRLLRKNPEKRLGSGERDAEDIKKHPFFRSIDWDDLLNRRIKPPFVPTI-----KGPEDVSNFDEEFTSEKPALTPSDP 673 (694)
T ss_pred HHHHhccCcccccCCCCCCchhhhhCCccccCCHHHHhhccCCCCCCccc-----CChhhhcccchhhhcCCCccCCCCc
Confidence 56889999999985 49999999999999999999999999999995 78999999999998653
Q ss_pred -CCChhhhcccCCcccCCC
Q psy10 69 -KLTEADQDLYKNFPLTIS 86 (100)
Q Consensus 69 -~~~~~~~~~F~~Fsy~~~ 86 (100)
.++..+|..|.||+|+++
T Consensus 674 ~~l~~~~q~~F~~Fs~~~~ 692 (694)
T KOG0694|consen 674 RPLTEEEQEAFRDFSFVAE 692 (694)
T ss_pred cccchhhHHHhcCccccCC
Confidence 244677899999999876
|
|
| >KOG0986|consensus | Back alignment and domain information |
|---|
| >KOG0598|consensus | Back alignment and domain information |
|---|
| >KOG0696|consensus | Back alignment and domain information |
|---|
| >KOG0690|consensus | Back alignment and domain information |
|---|
| >KOG0605|consensus | Back alignment and domain information |
|---|
| >KOG0695|consensus | Back alignment and domain information |
|---|
| >KOG0616|consensus | Back alignment and domain information |
|---|
| >KOG0612|consensus | Back alignment and domain information |
|---|
| >KOG0610|consensus | Back alignment and domain information |
|---|
| >smart00133 S_TK_X Extension to Ser/Thr-type protein kinases | Back alignment and domain information |
|---|
| >KOG0614|consensus | Back alignment and domain information |
|---|
| >cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta | Back alignment and domain information |
|---|
| >cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta | Back alignment and domain information |
|---|
| >cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C | Back alignment and domain information |
|---|
| >cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta | Back alignment and domain information |
|---|
| >KOG0608|consensus | Back alignment and domain information |
|---|
| >cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta | Back alignment and domain information |
|---|
| >cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N | Back alignment and domain information |
|---|
| >KOG0603|consensus | Back alignment and domain information |
|---|
| >cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta | Back alignment and domain information |
|---|
| >cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C | Back alignment and domain information |
|---|
| >cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B | Back alignment and domain information |
|---|
| >PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota | Back alignment and domain information |
|---|
| >cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C | Back alignment and domain information |
|---|
| >cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon | Back alignment and domain information |
|---|
| >cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta | Back alignment and domain information |
|---|
| >cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha | Back alignment and domain information |
|---|
| >cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma | Back alignment and domain information |
|---|
| >cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 | Back alignment and domain information |
|---|
| >cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 | Back alignment and domain information |
|---|
| >PTZ00263 protein kinase A catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase | Back alignment and domain information |
|---|
| >cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 | Back alignment and domain information |
|---|
| >cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase | Back alignment and domain information |
|---|
| >cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 | Back alignment and domain information |
|---|
| >cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta | Back alignment and domain information |
|---|
| >cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase | Back alignment and domain information |
|---|
| >cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >KOG0592|consensus | Back alignment and domain information |
|---|
| >cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 | Back alignment and domain information |
|---|
| >cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha | Back alignment and domain information |
|---|
| >cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 | Back alignment and domain information |
|---|
| >cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 | Back alignment and domain information |
|---|
| >cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase | Back alignment and domain information |
|---|
| >cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 | Back alignment and domain information |
|---|
| >cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 | Back alignment and domain information |
|---|
| >cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 | Back alignment and domain information |
|---|
| >cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 | Back alignment and domain information |
|---|
| >cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 | Back alignment and domain information |
|---|
| >cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase | Back alignment and domain information |
|---|
| >cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase | Back alignment and domain information |
|---|
| >cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 | Back alignment and domain information |
|---|
| >cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase | Back alignment and domain information |
|---|
| >cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 | Back alignment and domain information |
|---|
| >cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 | Back alignment and domain information |
|---|
| >cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase | Back alignment and domain information |
|---|
| >cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha | Back alignment and domain information |
|---|
| >cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 | Back alignment and domain information |
|---|
| >KOG0606|consensus | Back alignment and domain information |
|---|
| >cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor | Back alignment and domain information |
|---|
| >cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 | Back alignment and domain information |
|---|
| >cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta | Back alignment and domain information |
|---|
| >cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase | Back alignment and domain information |
|---|
| >PF00433 Pkinase_C: Protein kinase C terminal domain; InterPro: IPR017892 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases | Back alignment and domain information |
|---|
| >cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase | Back alignment and domain information |
|---|
| >cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase | Back alignment and domain information |
|---|
| >cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >KOG0606|consensus | Back alignment and domain information |
|---|
| >cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase | Back alignment and domain information |
|---|
| >PLN03225 Serine/threonine-protein kinase SNT7; Provisional | Back alignment and domain information |
|---|
| >cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants | Back alignment and domain information |
|---|
| >cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase | Back alignment and domain information |
|---|
| >PHA03207 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >PTZ00284 protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 | Back alignment and domain information |
|---|
| >cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase | Back alignment and domain information |
|---|
| >cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase | Back alignment and domain information |
|---|
| >PTZ00036 glycogen synthase kinase; Provisional | Back alignment and domain information |
|---|
| >cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 | Back alignment and domain information |
|---|
| >PHA03210 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase | Back alignment and domain information |
|---|
| >cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 | Back alignment and domain information |
|---|
| >PHA03212 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >KOG0585|consensus | Back alignment and domain information |
|---|
| >cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 | Back alignment and domain information |
|---|
| >cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 | Back alignment and domain information |
|---|
| >cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants | Back alignment and domain information |
|---|
| >cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein | Back alignment and domain information |
|---|
| >KOG0615|consensus | Back alignment and domain information |
|---|
| >cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha | Back alignment and domain information |
|---|
| >cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 | Back alignment and domain information |
|---|
| >cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 | Back alignment and domain information |
|---|
| >cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 | Back alignment and domain information |
|---|
| >cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 | Back alignment and domain information |
|---|
| >cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >PTZ00024 cyclin-dependent protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta | Back alignment and domain information |
|---|
| >PLN00034 mitogen-activated protein kinase kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0665|consensus | Back alignment and domain information |
|---|
| >cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 | Back alignment and domain information |
|---|
| >cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 | Back alignment and domain information |
|---|
| >cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases | Back alignment and domain information |
|---|
| >cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >KOG0575|consensus | Back alignment and domain information |
|---|
| >cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 | Back alignment and domain information |
|---|
| >KOG0583|consensus | Back alignment and domain information |
|---|
| >cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase | Back alignment and domain information |
|---|
| >cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 | Back alignment and domain information |
|---|
| >cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase | Back alignment and domain information |
|---|
| >cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 | Back alignment and domain information |
|---|
| >KOG0581|consensus | Back alignment and domain information |
|---|
| >cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase | Back alignment and domain information |
|---|
| >cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases | Back alignment and domain information |
|---|
| >KOG0588|consensus | Back alignment and domain information |
|---|
| >KOG0604|consensus | Back alignment and domain information |
|---|
| >cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >KOG0579|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 100 | ||||
| 3cik_A | 689 | Human Grk2 In Complex With Gbetagamma Subunits Leng | 7e-31 | ||
| 3krw_A | 688 | Human Grk2 In Complex With Gbetgamma Subunits And B | 7e-31 | ||
| 1omw_A | 689 | Crystal Structure Of The Complex Between G Protein- | 7e-31 | ||
| 3psc_A | 695 | Bovine Grk2 In Complex With Gbetagamma Subunits Len | 7e-31 | ||
| 3c4w_A | 543 | Crystal Structure Of G Protein Coupled Receptor Kin | 2e-05 | ||
| 3c4x_A | 543 | Crystal Structure Of G Protein Coupled Receptor Kin | 2e-05 | ||
| 3t8o_A | 543 | Rhodopsin Kinase (grk1) L166k Mutant At 2.5a Resolu | 2e-05 | ||
| 3nyn_A | 576 | Crystal Structure Of G Protein-Coupled Receptor Kin | 4e-05 | ||
| 2acx_A | 576 | Crystal Structure Of G Protein Coupled Receptor Kin | 4e-05 | ||
| 3qc9_A | 543 | Crystal Structure Of Cross-Linked Bovine Grk1 T8cN4 | 5e-05 |
| >pdb|3CIK|A Chain A, Human Grk2 In Complex With Gbetagamma Subunits Length = 689 | Back alignment and structure |
|
| >pdb|3KRW|A Chain A, Human Grk2 In Complex With Gbetgamma Subunits And Balanol (Soak) Length = 688 | Back alignment and structure |
| >pdb|1OMW|A Chain A, Crystal Structure Of The Complex Between G Protein-Coupled Receptor Kinase 2 And Heterotrimeric G Protein Beta 1 And Gamma 2 Subunits Length = 689 | Back alignment and structure |
| >pdb|3PSC|A Chain A, Bovine Grk2 In Complex With Gbetagamma Subunits Length = 695 | Back alignment and structure |
| >pdb|3C4W|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 1 Bound To Atp And Magnesium Chloride At 2.7a Length = 543 | Back alignment and structure |
| >pdb|3C4X|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 1 Bound To Atp And Magnesium Chloride At 2.9a Length = 543 | Back alignment and structure |
| >pdb|3T8O|A Chain A, Rhodopsin Kinase (grk1) L166k Mutant At 2.5a Resolution Length = 543 | Back alignment and structure |
| >pdb|3NYN|A Chain A, Crystal Structure Of G Protein-Coupled Receptor Kinase 6 In Complex With Sangivamycin Length = 576 | Back alignment and structure |
| >pdb|2ACX|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 6 Bound To Amppnp Length = 576 | Back alignment and structure |
| >pdb|3QC9|A Chain A, Crystal Structure Of Cross-Linked Bovine Grk1 T8cN480C DOUBLE MUTANT Complexed With Adp And Mg Length = 543 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 100 | |||
| 3pvu_A | 695 | Beta-adrenergic receptor kinase 1; transferase, se | 5e-24 | |
| 3c4z_A | 543 | Rhodopsin kinase; Ser/Thr kinase, RGS homology dom | 2e-19 | |
| 2acx_A | 576 | G protein-coupled receptor kinase 6; GRK, G transf | 2e-17 | |
| 1rdq_E | 350 | PKA C-alpha, CAMP-dependent protein kinase, alpha- | 5e-11 | |
| 4fr4_A | 384 | YANK1, serine/threonine-protein kinase 32A; struct | 6e-11 | |
| 1fot_A | 318 | TPK1 delta, CAMP-dependent protein kinase type 1; | 9e-11 | |
| 1o6l_A | 337 | RAC-beta serine/threonine protein kinase; protein | 3e-10 | |
| 3a8x_A | 345 | Protein kinase C IOTA type; transferase; HET: TPO; | 6e-10 | |
| 4dc2_A | 396 | Protein kinase C IOTA type; kinase, substrate, cel | 6e-10 | |
| 3txo_A | 353 | PKC-L, NPKC-ETA, protein kinase C ETA type; phosph | 8e-10 | |
| 1xjd_A | 345 | Protein kinase C, theta type; PKC-theta, ATP, AMP, | 1e-09 | |
| 2r5t_A | 373 | Serine/threonine-protein kinase SGK1; AGC protein | 3e-09 | |
| 3v8s_A | 410 | RHO-associated protein kinase 1; dimerization, myo | 4e-09 | |
| 3pfq_A | 674 | PKC-B, PKC-beta, protein kinase C beta type; phosp | 6e-09 | |
| 3g51_A | 325 | Ribosomal protein S6 kinase alpha-3; N-terminal ki | 7e-09 | |
| 4ejn_A | 446 | RAC-alpha serine/threonine-protein kinase; AKT1, a | 1e-08 | |
| 3a62_A | 327 | Ribosomal protein S6 kinase beta-1; kinase domain, | 1e-08 | |
| 2i0e_A | 353 | Protein kinase C-beta II; serine/threonine protein | 2e-08 | |
| 2vd5_A | 412 | DMPK protein; serine/threonine-protein kinase, kin | 1e-07 | |
| 4aw2_A | 437 | Serine/threonine-protein kinase MRCK alpha; transf | 3e-07 | |
| 1vzo_A | 355 | Ribosomal protein S6 kinase alpha 5; protein kinas | 6e-07 | |
| 1uu3_A | 310 | HPDK1, 3-phosphoinositide dependent protein kinase | 8e-05 |
| >3pvu_A Beta-adrenergic receptor kinase 1; transferase, serine/threonine-protein kinase, ATP-binding, I membrane; HET: QRW; 2.48A {Bos taurus} PDB: 3psc_A* 3pvw_A* 1omw_A 1ym7_A 2bcj_A* 3cik_A 3krw_A* 3krx_A* 1bak_A Length = 695 | Back alignment and structure |
|---|
Score = 93.4 bits (232), Expect = 5e-24
Identities = 58/76 (76%), Positives = 66/76 (86%)
Query: 16 SDEVKEHPFFTGLDWTQVYMQKYTPPLIPPRGEVNAADAFDIGSFDEEDTKGIKLTEADQ 75
+ EVKE PFF LDW V++QKY PPLIPPRGEVNAADAFDIGSFDEEDTKGIKL ++DQ
Sbjct: 444 AQEVKESPFFRSLDWQMVFLQKYPPPLIPPRGEVNAADAFDIGSFDEEDTKGIKLLDSDQ 503
Query: 76 DLYKNFPLTISERLAE 91
+LY+NFPLTISER +
Sbjct: 504 ELYRNFPLTISERWQQ 519
|
| >3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Length = 543 | Back alignment and structure |
|---|
| >2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Length = 576 | Back alignment and structure |
|---|
| >1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Length = 350 | Back alignment and structure |
|---|
| >4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Length = 384 | Back alignment and structure |
|---|
| >1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Length = 318 | Back alignment and structure |
|---|
| >1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Length = 337 | Back alignment and structure |
|---|
| >3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Length = 345 | Back alignment and structure |
|---|
| >4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Length = 396 | Back alignment and structure |
|---|
| >3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Length = 345 | Back alignment and structure |
|---|
| >2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Length = 373 | Back alignment and structure |
|---|
| >3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Length = 410 | Back alignment and structure |
|---|
| >3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Length = 674 | Back alignment and structure |
|---|
| >3g51_A Ribosomal protein S6 kinase alpha-3; N-terminal kinase domain of P90 ribosomal S6 kinase 2, ATP- binding, nucleotide-binding, phosphoprotein; HET: ANP; 1.80A {Mus musculus} PDB: 2z7q_A* 2z7r_A* 2z7s_A* Length = 325 | Back alignment and structure |
|---|
| >4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 | Back alignment and structure |
|---|
| >3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Length = 327 | Back alignment and structure |
|---|
| >2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Length = 353 | Back alignment and structure |
|---|
| >2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Length = 412 | Back alignment and structure |
|---|
| >4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Length = 437 | Back alignment and structure |
|---|
| >1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Length = 355 | Back alignment and structure |
|---|
| >1uu3_A HPDK1, 3-phosphoinositide dependent protein kinase-1; PKB, inhibitor, LY333531, diabetes, cancer, transferase, serine/threonine-protein kinase; HET: SEP LY4; 1.7A {Homo sapiens} SCOP: d.144.1.7 PDB: 1okz_A* 1oky_A* 1uu7_A* 1uu8_A* 2biy_A* 3rwp_A* 2xch_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* ... Length = 310 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 100 | |||
| 3v5w_A | 689 | G-protein coupled receptor kinase 2; inhibitor com | 99.84 | |
| 4dc2_A | 396 | Protein kinase C IOTA type; kinase, substrate, cel | 99.68 | |
| 1o6l_A | 337 | RAC-beta serine/threonine protein kinase; protein | 99.59 | |
| 3txo_A | 353 | PKC-L, NPKC-ETA, protein kinase C ETA type; phosph | 99.58 | |
| 2i0e_A | 353 | Protein kinase C-beta II; serine/threonine protein | 99.58 | |
| 3pfq_A | 674 | PKC-B, PKC-beta, protein kinase C beta type; phosp | 99.55 | |
| 2r5t_A | 373 | Serine/threonine-protein kinase SGK1; AGC protein | 99.55 | |
| 3a8x_A | 345 | Protein kinase C IOTA type; transferase; HET: TPO; | 99.54 | |
| 1xjd_A | 345 | Protein kinase C, theta type; PKC-theta, ATP, AMP, | 99.52 | |
| 3c4z_A | 543 | Rhodopsin kinase; Ser/Thr kinase, RGS homology dom | 99.52 | |
| 3v8s_A | 410 | RHO-associated protein kinase 1; dimerization, myo | 99.49 | |
| 2acx_A | 576 | G protein-coupled receptor kinase 6; GRK, G transf | 99.48 | |
| 1rdq_E | 350 | PKA C-alpha, CAMP-dependent protein kinase, alpha- | 99.4 | |
| 2vd5_A | 412 | DMPK protein; serine/threonine-protein kinase, kin | 99.39 | |
| 1fot_A | 318 | TPK1 delta, CAMP-dependent protein kinase type 1; | 99.33 | |
| 4aw2_A | 437 | Serine/threonine-protein kinase MRCK alpha; transf | 99.32 | |
| 4ejn_A | 446 | RAC-alpha serine/threonine-protein kinase; AKT1, a | 99.22 | |
| 3ubd_A | 304 | Ribosomal protein S6 kinase alpha-3; kinase-inhibi | 99.19 | |
| 4fr4_A | 384 | YANK1, serine/threonine-protein kinase 32A; struct | 99.07 | |
| 3a62_A | 327 | Ribosomal protein S6 kinase beta-1; kinase domain, | 98.97 | |
| 1vzo_A | 355 | Ribosomal protein S6 kinase alpha 5; protein kinas | 98.72 | |
| 4aw0_A | 311 | HPDK1, 3-phosphoinositide-dependent protein kinase | 98.58 | |
| 3rp9_A | 458 | Mitogen-activated protein kinase; structural genom | 97.56 | |
| 3n9x_A | 432 | Phosphotransferase; malaria kinase, structural gen | 97.12 | |
| 2qr7_A | 342 | Ribosomal protein S6 kinase alpha-3; kinase domain | 97.12 | |
| 4g31_A | 299 | Eukaryotic translation initiation factor 2-alpha; | 97.11 | |
| 2eu9_A | 355 | Dual specificity protein kinase CLK3; kinase domai | 97.06 | |
| 3lm5_A | 327 | Serine/threonine-protein kinase 17B; STK17B, serin | 96.9 | |
| 3p23_A | 432 | Serine/threonine-protein kinase/endoribonuclease; | 96.9 | |
| 4agu_A | 311 | Cyclin-dependent kinase-like 1; transferase, phosp | 96.85 | |
| 2yab_A | 361 | Death-associated protein kinase 2; apoptosis, tran | 96.76 | |
| 3oz6_A | 388 | Mitogen-activated protein kinase 1, serine/threon | 96.72 | |
| 2pml_X | 348 | PFPK7, Ser/Thr protein kinase; phosphorylati trans | 96.29 | |
| 3uto_A | 573 | Twitchin; kinase, muscle sarcomere, transferase; H | 96.23 | |
| 2a2a_A | 321 | Death-associated protein kinase 2; autoinhibition, | 96.2 | |
| 3gni_B | 389 | Strad alpha; kinase fold, pseudokinase, alpha heli | 96.04 | |
| 3qyz_A | 364 | Mitogen-activated protein kinase 1; transferase, s | 95.94 | |
| 1phk_A | 298 | Phosphorylase kinase; glycogen metabolism, transfe | 95.85 | |
| 4b99_A | 398 | Mitogen-activated protein kinase 7; transferase, i | 95.77 | |
| 2y0a_A | 326 | Death-associated protein kinase 1; transferase, ca | 95.67 | |
| 4e7w_A | 394 | Glycogen synthase kinase 3; GSK3, PTyr195, transfe | 95.61 | |
| 2ac3_A | 316 | MAP kinase-interacting serine/threonine kinase 2; | 95.59 | |
| 2vwi_A | 303 | Serine/threonine-protein kinase OSR1; STE kinase, | 95.55 | |
| 2pmi_A | 317 | Negative RE, cyclin-dependent protein kinase PHO85 | 95.52 | |
| 1blx_A | 326 | Cyclin-dependent kinase 6; inhibitor protein, cycl | 95.49 | |
| 2j7t_A | 302 | Serine/threonine-protein kinase 10; transferase, A | 95.27 | |
| 2xrw_A | 371 | Mitogen-activated protein kinase 8; transcription, | 95.22 | |
| 4fih_A | 346 | Serine/threonine-protein kinase PAK 4; kinase doma | 95.2 | |
| 2r3i_A | 299 | Cell division protein kinase 2; serine/threonine-p | 95.13 | |
| 3fe3_A | 328 | MAP/microtubule affinity-regulating kinase 3; seri | 94.99 | |
| 1zy4_A | 303 | Serine/threonine-protein kinase GCN2; translation | 94.96 | |
| 2i6l_A | 320 | Mitogen-activated protein kinase 6; MAPK6, ERK3, e | 94.93 | |
| 3mtl_A | 324 | Cell division protein kinase 16; pctaire1, indirub | 94.92 | |
| 1q8y_A | 373 | SR protein kinase; transferase; HET: ADP ADE; 2.05 | 94.82 | |
| 4exu_A | 371 | Mitogen-activated protein kinase 13; P38 kinase, t | 94.82 | |
| 2b9h_A | 353 | MAP kinase FUS3, mitogen-activated protein kinase | 94.81 | |
| 3dls_A | 335 | PAS domain-containing serine/threonine-protein KI; | 94.69 | |
| 3rgf_A | 405 | Cyclin-dependent kinase 8; protein kinase complex, | 94.61 | |
| 3q60_A | 371 | ROP5B; pseudokinase, transferase; HET: ATP; 1.72A | 94.59 | |
| 4fie_A | 423 | Serine/threonine-protein kinase PAK 4; kinase doma | 94.57 | |
| 3pg1_A | 362 | Mitogen-activated protein kinase, putative (MAP K | 94.38 | |
| 3e3p_A | 360 | Protein kinase, putative glycogen synthase kinase; | 94.34 | |
| 3i6u_A | 419 | CDS1, serine/threonine-protein kinase CHK2; Ser/Th | 94.34 | |
| 3eqc_A | 360 | Dual specificity mitogen-activated protein kinase; | 93.93 | |
| 1cm8_A | 367 | Phosphorylated MAP kinase P38-gamma; phosphorylati | 93.87 | |
| 4aaa_A | 331 | Cyclin-dependent kinase-like 2; transferase, phosp | 93.73 | |
| 1j1b_A | 420 | Glycogen synthase kinase-3 beta; complex, TAU, AMP | 93.71 | |
| 3coi_A | 353 | Mitogen-activated protein kinase 13; P38D, P38delt | 93.7 | |
| 2vgo_A | 284 | Serine/threonine-protein kinase 12-A; nucleotide-b | 93.68 | |
| 2yex_A | 276 | Serine/threonine-protein kinase CHK1; transferase, | 93.68 | |
| 3uc3_A | 361 | Serine/threonine-protein kinase SRK2I; SNRK2, ABA | 93.43 | |
| 3a99_A | 320 | Proto-oncogene serine/threonine-protein kinase PI; | 93.43 | |
| 3mi9_A | 351 | Cell division protein kinase 9; P-TEFB, HIV-1, pro | 93.43 | |
| 3kvw_A | 429 | DYRK2, dual specificity tyrosine-phosphorylation-r | 93.34 | |
| 3ttj_A | 464 | Mitogen-activated protein kinase 10; JNK3, protein | 93.19 | |
| 2w4o_A | 349 | Calcium/calmodulin-dependent protein kinase type I | 93.17 | |
| 2ycf_A | 322 | Serine/threonine-protein kinase CHK2; transferase, | 93.11 | |
| 1kob_A | 387 | Twitchin; kinase, intrasteric regulation; 2.30A {A | 92.99 | |
| 3hko_A | 345 | Calcium/calmodulin-dependent protein kinase with d | 92.99 | |
| 3tki_A | 323 | Serine/threonine-protein kinase CHK1; cell checkpo | 92.85 | |
| 3eb0_A | 383 | Putative uncharacterized protein; kinase cryptospo | 92.66 | |
| 2fst_X | 367 | Mitogen-activated protein kinase 14; active mutant | 92.61 | |
| 2x4f_A | 373 | Myosin light chain kinase family member 4; LUNG, b | 92.37 | |
| 1ua2_A | 346 | CAK, cell division protein kinase 7; cell cycle, p | 92.26 | |
| 3h4j_B | 336 | AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin | 91.78 | |
| 3bhy_A | 283 | Death-associated protein kinase 3; death associate | 91.61 | |
| 3kk8_A | 284 | Calcium/calmodulin dependent protein kinase II; AT | 91.53 | |
| 3cok_A | 278 | Serine/threonine-protein kinase PLK4; POLO-like ki | 91.52 | |
| 4b9d_A | 350 | Serine/threonine-protein kinase NEK1; transferase, | 91.32 | |
| 2x7f_A | 326 | TRAF2 and NCK-interacting protein kinase; serine/t | 91.3 | |
| 3com_A | 314 | Serine/threonine-protein kinase 4; MST1, STE20-lik | 91.24 | |
| 3fxz_A | 297 | Serine/threonine-protein kinase PAK 1; transferase | 90.84 | |
| 3kex_A | 325 | Receptor tyrosine-protein kinase ERBB-3; kinase do | 90.66 | |
| 3kn6_A | 325 | Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 | 90.59 | |
| 3c0i_A | 351 | Peripheral plasma membrane protein CASK; neurexin, | 90.56 | |
| 2wtk_C | 305 | Serine/threonine-protein kinase 11; transferase-me | 90.55 | |
| 2rio_A | 434 | Serine/threonine-protein kinase/endoribonuclease I | 90.26 | |
| 3fme_A | 290 | Dual specificity mitogen-activated protein kinase; | 90.13 | |
| 3m2w_A | 299 | MAP kinase-activated protein kinase 2; small molec | 90.02 | |
| 1tki_A | 321 | Titin; serine kinase, muscle, autoinhibition; 2.00 | 89.44 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 89.26 | |
| 1nxk_A | 400 | MAP kinase-activated protein kinase 2; MK2, phosph | 89.25 | |
| 2c30_A | 321 | Serine/threonine-protein kinase PAK 6; CRIB domain | 88.55 | |
| 3zgw_A | 347 | Maternal embryonic leucine zipper kinase; transfer | 88.4 | |
| 2h6d_A | 276 | 5'-AMP-activated protein kinase catalytic subunit | 88.18 | |
| 3fhr_A | 336 | MAP kinase-activated protein kinase 3; kinase-inhi | 88.1 | |
| 3byv_A | 377 | Rhoptry kinase; malaria, transferase, structural g | 88.09 | |
| 2iwi_A | 312 | Serine/threonine-protein kinase PIM-2; nucleotide- | 87.98 | |
| 2clq_A | 295 | Mitogen-activated protein kinase kinase kinase 5; | 87.96 | |
| 3fdn_A | 279 | Serine/threonine-protein kinase 6; aurora kinase i | 87.06 | |
| 2jam_A | 304 | Calcium/calmodulin-dependent protein kinase type 1 | 86.83 | |
| 3f3z_A | 277 | Calcium/calmodulin-dependent protein kinase with d | 86.79 | |
| 2y94_A | 476 | 5'-AMP-activated protein kinase catalytic subunit; | 86.41 | |
| 3aln_A | 327 | Dual specificity mitogen-activated protein kinase; | 86.1 | |
| 3qa8_A | 676 | MGC80376 protein; kinase ubiquitin-like domain, ph | 86.0 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 85.99 | |
| 3an0_A | 340 | Dual specificity mitogen-activated protein kinase; | 84.9 | |
| 3cek_A | 313 | Dual specificity protein kinase TTK; HMPS1, PYT, E | 84.59 | |
| 3soa_A | 444 | Calcium/calmodulin-dependent protein kinase type a | 84.34 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 84.33 | |
| 3sv0_A | 483 | Casein kinase I-like; typical kinase domain fold, | 83.93 | |
| 4g3f_A | 336 | NF-kappa-beta-inducing kinase; non-RD kinase, prot | 83.89 | |
| 2dyl_A | 318 | Dual specificity mitogen-activated protein kinase | 83.73 | |
| 2zmd_A | 390 | Dual specificity protein kinase TTK; MPS1, T686A, | 83.57 | |
| 3dbq_A | 343 | Dual specificity protein kinase TTK; MPS1 structur | 83.48 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 83.35 | |
| 2bdw_A | 362 | Hypothetical protein K11E8.1D; kinase, calmodulin | 83.09 | |
| 2rku_A | 294 | Serine/threonine-protein kinase PLK1; structure of | 81.48 | |
| 2owb_A | 335 | Serine/threonine-protein kinase PLK1; catalytic do | 80.08 |
| >3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A | Back alignment and structure |
|---|
Probab=99.84 E-value=1.2e-21 Score=148.80 Aligned_cols=90 Identities=64% Similarity=1.051 Sum_probs=73.9
Q ss_pred CCccCCCCCcccC----ChhhhhcCCCCCCCChhHHhcCcCCCCccCCCCCCCCCCCCCCCCCCccccCCCCCChhhhcc
Q psy10 2 PKHKAKTPIQQQL----RSDEVKEHPFFTGLDWTQVYMQKYTPPLIPPRGEVNAADAFDIGSFDEEDTKGIKLTEADQDL 77 (100)
Q Consensus 2 ~k~l~k~p~~r~~----g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~~~~~~~~~~~d~~~f~~~~~~~~~~~~~~~~~ 77 (100)
+++|.++|.+|++ |++||++||||++|||+.|.++++.|||+|.+..+++.+.+|+++|+++++....++..+++.
T Consensus 426 ~~lL~~dP~~Rl~~~~~ga~ei~~HpfF~~idW~~l~~~~~~pP~~P~~~~~~~~~~fD~~~fd~e~~~~~~~~~~d~~~ 505 (689)
T 3v5w_A 426 EGLLQRDVNRRLGCLGRGAQEVKESPFFRSLDWQMVFLQKYPPPLIPPRGEVNAADAFDIGSFDEEDTKGIKLLDSDQEL 505 (689)
T ss_dssp HHHTCSCGGGCTTCSSSTHHHHTTSGGGTTCCHHHHHTTCSCCSCCCCTTCSSTTBCCC---------CCCCCCHHHHTT
T ss_pred HHHccCCHhHCCCCCCCCHHHHhcCccccCCCHHHHHcCCCCcCccCCCCCCCcCCCCCCccCCccccCCCCCCchHHHH
Confidence 4677888888874 799999999999999999999999999999988888889999999999999988888899999
Q ss_pred cCCcccCCCHHHHH
Q psy10 78 YKNFPLTISERLAE 91 (100)
Q Consensus 78 F~~Fsy~~~~~~~~ 91 (100)
|.+|+|+.++.||+
T Consensus 506 f~~Fs~~~~~~~q~ 519 (689)
T 3v5w_A 506 YRNFPLTISERWQQ 519 (689)
T ss_dssp TTTCCEECHHHHHH
T ss_pred HhCCCccCccchhh
Confidence 99999999999986
|
| >4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... | Back alignment and structure |
|---|
| >3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* | Back alignment and structure |
|---|
| >3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A | Back alignment and structure |
|---|
| >2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* | Back alignment and structure |
|---|
| >3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* | Back alignment and structure |
|---|
| >1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* | Back alignment and structure |
|---|
| >3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B | Back alignment and structure |
|---|
| >3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* | Back alignment and structure |
|---|
| >2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* | Back alignment and structure |
|---|
| >1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... | Back alignment and structure |
|---|
| >2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* | Back alignment and structure |
|---|
| >4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* | Back alignment and structure |
|---|
| >3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* | Back alignment and structure |
|---|
| >4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* | Back alignment and structure |
|---|
| >1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... | Back alignment and structure |
|---|
| >3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* | Back alignment and structure |
|---|
| >2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A | Back alignment and structure |
|---|
| >4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* | Back alignment and structure |
|---|
| >2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* | Back alignment and structure |
|---|
| >3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* | Back alignment and structure |
|---|
| >3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* | Back alignment and structure |
|---|
| >3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A | Back alignment and structure |
|---|
| >2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A | Back alignment and structure |
|---|
| >3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* | Back alignment and structure |
|---|
| >3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... | Back alignment and structure |
|---|
| >1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* | Back alignment and structure |
|---|
| >4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} | Back alignment and structure |
|---|
| >2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A | Back alignment and structure |
|---|
| >2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* | Back alignment and structure |
|---|
| >2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* | Back alignment and structure |
|---|
| >1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B | Back alignment and structure |
|---|
| >2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* | Back alignment and structure |
|---|
| >2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... | Back alignment and structure |
|---|
| >4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* | Back alignment and structure |
|---|
| >2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... | Back alignment and structure |
|---|
| >3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A | Back alignment and structure |
|---|
| >1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A | Back alignment and structure |
|---|
| >2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A | Back alignment and structure |
|---|
| >4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A | Back alignment and structure |
|---|
| >2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* | Back alignment and structure |
|---|
| >3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* | Back alignment and structure |
|---|
| >4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} | Back alignment and structure |
|---|
| >3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* | Back alignment and structure |
|---|
| >3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} | Back alignment and structure |
|---|
| >3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A | Back alignment and structure |
|---|
| >3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... | Back alignment and structure |
|---|
| >1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* | Back alignment and structure |
|---|
| >1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... | Back alignment and structure |
|---|
| >3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} | Back alignment and structure |
|---|
| >2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... | Back alignment and structure |
|---|
| >2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... | Back alignment and structure |
|---|
| >3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A | Back alignment and structure |
|---|
| >3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... | Back alignment and structure |
|---|
| >3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* | Back alignment and structure |
|---|
| >3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* | Back alignment and structure |
|---|
| >3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* | Back alignment and structure |
|---|
| >2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} | Back alignment and structure |
|---|
| >2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* | Back alignment and structure |
|---|
| >1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* | Back alignment and structure |
|---|
| >3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... | Back alignment and structure |
|---|
| >2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} | Back alignment and structure |
|---|
| >1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... | Back alignment and structure |
|---|
| >3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* | Back alignment and structure |
|---|
| >3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
| >4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* | Back alignment and structure |
|---|
| >2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* | Back alignment and structure |
|---|
| >3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* | Back alignment and structure |
|---|
| >3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A | Back alignment and structure |
|---|
| >3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A | Back alignment and structure |
|---|
| >2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* | Back alignment and structure |
|---|
| >3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A | Back alignment and structure |
|---|
| >3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* | Back alignment and structure |
|---|
| >1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* | Back alignment and structure |
|---|
| >1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C | Back alignment and structure |
|---|
| >2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* | Back alignment and structure |
|---|
| >2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* | Back alignment and structure |
|---|
| >3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* | Back alignment and structure |
|---|
| >3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A | Back alignment and structure |
|---|
| >2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... | Back alignment and structure |
|---|
| >2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A | Back alignment and structure |
|---|
| >3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* | Back alignment and structure |
|---|
| >2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* | Back alignment and structure |
|---|
| >3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* | Back alignment and structure |
|---|
| >3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* | Back alignment and structure |
|---|
| >3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} | Back alignment and structure |
|---|
| >3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* | Back alignment and structure |
|---|
| >2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} | Back alignment and structure |
|---|
| >2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* | Back alignment and structure |
|---|
| >3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* | Back alignment and structure |
|---|
| >2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B | Back alignment and structure |
|---|
| >2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* | Back alignment and structure |
|---|
| >2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 100 | ||||
| d1omwa3 | 364 | d.144.1.7 (A:186-549) G-protein coupled receptor k | 2e-26 | |
| d1fota_ | 316 | d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni | 5e-11 | |
| d1xjda_ | 320 | d.144.1.7 (A:) Protein kinase C, theta type {Human | 4e-10 | |
| d1rdqe_ | 350 | d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni | 4e-10 | |
| d1o6la_ | 337 | d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap | 3e-09 | |
| d1vzoa_ | 322 | d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 | 2e-06 | |
| d1uu3a_ | 288 | d.144.1.7 (A:) 3-phosphoinositide dependent protei | 5e-05 | |
| d1jksa_ | 293 | d.144.1.7 (A:) Death-associated protein kinase, Da | 5e-04 |
| >d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Protein kinase-like (PK-like) superfamily: Protein kinase-like (PK-like) family: Protein kinases, catalytic subunit domain: G-protein coupled receptor kinase 2 species: Cow (Bos taurus) [TaxId: 9913]
Score = 97.5 bits (242), Expect = 2e-26
Identities = 58/75 (77%), Positives = 65/75 (86%)
Query: 17 DEVKEHPFFTGLDWTQVYMQKYTPPLIPPRGEVNAADAFDIGSFDEEDTKGIKLTEADQD 76
EVKE PFF LDW V++QKY PPLIPPRGEVNAADAFDIGSFDEEDTKGIKL ++DQ+
Sbjct: 260 QEVKESPFFRSLDWQMVFLQKYPPPLIPPRGEVNAADAFDIGSFDEEDTKGIKLLDSDQE 319
Query: 77 LYKNFPLTISERLAE 91
LY+NFPLTISER +
Sbjct: 320 LYRNFPLTISERWQQ 334
|
| >d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 | Back information, alignment and structure |
|---|
| >d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 | Back information, alignment and structure |
|---|
| >d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 | Back information, alignment and structure |
|---|
| >d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 | Back information, alignment and structure |
|---|
| >d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 | Back information, alignment and structure |
|---|
| >d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 | Back information, alignment and structure |
|---|
| >d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 100 | |||
| d1omwa3 | 364 | G-protein coupled receptor kinase 2 {Cow (Bos taur | 99.57 | |
| d1o6la_ | 337 | Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 | 99.49 | |
| d1xjda_ | 320 | Protein kinase C, theta type {Human (Homo sapiens) | 99.48 | |
| d1fota_ | 316 | cAMP-dependent PK, catalytic subunit {Baker's yeas | 99.31 | |
| d1rdqe_ | 350 | cAMP-dependent PK, catalytic subunit {Mouse (Mus m | 99.29 | |
| d1vzoa_ | 322 | Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( | 99.01 | |
| d1uu3a_ | 288 | 3-phosphoinositide dependent protein kinase-1 Pdk1 | 98.47 | |
| d1jksa_ | 293 | Death-associated protein kinase, Dap {Human (Homo | 97.85 | |
| d1q8ya_ | 362 | Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T | 97.07 | |
| d1gz8a_ | 298 | Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T | 96.13 | |
| d1xwsa_ | 273 | Proto-oncogene serine/threonine-protein kinase Pim | 95.99 | |
| d2b1pa1 | 355 | c-jun N-terminal kinase (jnk3s) {Human (Homo sapie | 95.97 | |
| d1cm8a_ | 346 | MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: | 95.94 | |
| d1koaa2 | 350 | Twitchin, kinase domain {Caenorhabditis elegans, p | 95.57 | |
| d1s9ja_ | 322 | Dual specificity mitogen-activated protein kinase | 95.52 | |
| d3blha1 | 318 | Cell division protein kinase 9, CDK9 {Human (Homo | 95.44 | |
| d2gfsa1 | 348 | MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] | 95.42 | |
| d1koba_ | 352 | Twitchin, kinase domain {California sea hare (Aply | 95.26 | |
| d1ua2a_ | 299 | Cell division protein kinase 7, CDK7 {Human (Homo | 95.22 | |
| d1a06a_ | 307 | Calmodulin-dependent protein kinase {Rat (Rattus n | 95.2 | |
| d1q5ka_ | 350 | Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho | 95.13 | |
| d1yhwa1 | 293 | pak1 {Human (Homo sapiens) [TaxId: 9606]} | 94.71 | |
| d2jfla1 | 288 | STE20-like serine/threonine-protein kinase, SLK {H | 93.9 | |
| d1pmea_ | 345 | MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 | 93.69 | |
| d1tkia_ | 321 | Titin, kinase domain {Human (Homo sapiens) [TaxId: | 93.37 | |
| d2ozaa1 | 335 | MAP kinase activated protein kinase 2, mapkap2 {Hu | 91.57 | |
| d1u5ra_ | 309 | Serine/threonine protein kinase TAO2 {Rat (Rattus | 88.31 | |
| d1blxa_ | 305 | Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T | 85.32 |
| >d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Protein kinase-like (PK-like) superfamily: Protein kinase-like (PK-like) family: Protein kinases, catalytic subunit domain: G-protein coupled receptor kinase 2 species: Cow (Bos taurus) [TaxId: 9913]
Probab=99.57 E-value=3.3e-16 Score=109.62 Aligned_cols=90 Identities=64% Similarity=1.051 Sum_probs=59.4
Q ss_pred CCccCCCCCcccC----ChhhhhcCCCCCCCChhHHhcCcCCCCccCCCCCCCCCCCCCCCCCCccccCCCCCChhhhcc
Q psy10 2 PKHKAKTPIQQQL----RSDEVKEHPFFTGLDWTQVYMQKYTPPLIPPRGEVNAADAFDIGSFDEEDTKGIKLTEADQDL 77 (100)
Q Consensus 2 ~k~l~k~p~~r~~----g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~~~~~~~~~~~d~~~f~~~~~~~~~~~~~~~~~ 77 (100)
++.|.++|.+|+. +++||++||||++|||+.+..++++||++|.....+..+.+|+++|+++.+........+++.
T Consensus 241 ~~~L~~dP~~R~t~~~~~a~eil~Hp~f~~i~~~~~~~~~~~~p~~p~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~ 320 (364)
T d1omwa3 241 EGLLQRDVNRRLGCLGRGAQEVKESPFFRSLDWQMVFLQKYPPPLIPPRGEVNAADAFDIGSFDEEDTKGIKLLDSDQEL 320 (364)
T ss_dssp HHHTCSSTTTSTTTSSSTHHHHHTSGGGTTCCHHHHHTTCSCCSCCCCCC--------------------CCCCSSSSGG
T ss_pred HHHcccCHHHhCCCcccCHHHHHcCccccCCCHHHHhcCCCCcCcCCCCCCCCcCCccccccCChhhccCCCCCChHHHH
Confidence 4677888888874 589999999999999999999999999999877666677788888888777666666677889
Q ss_pred cCCcccCCCHHHHH
Q psy10 78 YKNFPLTISERLAE 91 (100)
Q Consensus 78 F~~Fsy~~~~~~~~ 91 (100)
|.+|++..+..++.
T Consensus 321 ~~~~~~~~~~~~~~ 334 (364)
T d1omwa3 321 YRNFPLTISERWQQ 334 (364)
T ss_dssp GTTCCEECHHHHHH
T ss_pred HhcCCccCchHHHH
Confidence 99999987766654
|
| >d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} | Back information, alignment and structure |
|---|
| >d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|