Psyllid ID: psy11008


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90------
MEDLAALFRMKTQSVIDRIVELQKTGALTGVIDDRGKFIYISQEELNSVATFIKQRGREELNSVATFIKQKGRVSVSELVENSNQLVTLIPDQIAS
cHHHHHHHcccHHHHHHHHHHHHHcccccEEEcccccEEEEcHHHHHHHHHHHHHHcccccHHHHHHHHccccccHHHHHHHccccEEEccccccc
cHHHHHHccccHHHHHHHHHHHHHcccEEEEEcccccEEEEcHHHHHHHHHHHHHcccccHHHHHHHHHHcccccHHHHHHHHccHEccccccccc
MEDLAALFRMKTQSVIDRIVELQKtgaltgviddrgKFIYISQEELNSVATFIKQRGREELNSVATFIKQKGRVSVSELVENSNQLVTLIPDQIAS
MEDLAALFRMKTQSVIDRIVElqktgaltgvidDRGKFIYISQEELNSVATFIKQRGREELNSVATfikqkgrvsvselvensnqlvtlipdqias
MEDLAALFRMKTQSVIDRIVELQKTGALTGVIDDRGKFIYISQEELNSVATFIKQRGREELNSVATFIKQKGRVSVSELVENSNQLVTLIPDQIAS
*****ALFRMKTQSVIDRIVELQKTGALTGVIDDRGKFIYISQEELNSVATFIKQRGREELNSVATFIKQKGRVSVSELV*****LVTL*******
*EDLAALFRMKTQSVIDRIVELQKTGALTGVIDDRGKFIYISQEELNSVATFIKQRGREELNSVATFIKQKGRVSVSELVENSNQLV**I******
MEDLAALFRMKTQSVIDRIVELQKTGALTGVIDDRGKFIYISQEELNSVATFIKQRGREELNSVATFIKQKGRVSVSELVENSNQLVTLIPDQIAS
MEDLAALFRMKTQSVIDRIVELQKTGALTGVIDDRGKFIYISQEELNSVATFIKQRGREELNSVATFIKQKGRVSVSELVENSNQLVTLIP*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEDLAALFRMKTQSVIDRIVELQKTGALTGVIDDRGKFIYISQEELNSVATFIKQRGREELNSVATFIKQKGRVSVSELVENSNQLVTLIPDQIAS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query96 2.2.26 [Sep-21-2011]
B0WIW5287 DDRGK domain-containing p N/A N/A 0.791 0.264 0.615 2e-25
C3Y431298 DDRGK domain-containing p yes N/A 0.802 0.258 0.597 1e-23
C0KYB6289 DDRGK domain-containing p N/A N/A 0.791 0.262 0.593 2e-23
B4PQC4312 DDRGK domain-containing p N/A N/A 0.791 0.243 0.582 5e-23
B3P045312 DDRGK domain-containing p N/A N/A 0.791 0.243 0.582 6e-23
B4NKL1307 DDRGK domain-containing p N/A N/A 0.843 0.263 0.572 7e-23
B4LYB9307 DDRGK domain-containing p N/A N/A 0.791 0.247 0.560 6e-22
B3MTS7304 DDRGK domain-containing p N/A N/A 0.791 0.25 0.549 3e-21
Q9VDD1309 DDRGK domain-containing p yes N/A 0.791 0.245 0.560 4e-21
Q295B1309 DDRGK domain-containing p yes N/A 0.791 0.245 0.549 1e-20
>sp|B0WIW5|DDRGK_CULQU DDRGK domain-containing protein 1 OS=Culex quinquefasciatus GN=CPIJ007479 PE=3 SV=1 Back     alignment and function desciption
 Score =  114 bits (285), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 56/91 (61%), Positives = 67/91 (73%), Gaps = 15/91 (16%)

Query: 1   MEDLAALFRMKTQSVIDRIVELQKTGALTGVIDDRGKFIYISQEELNSVATFIKQRGREE 60
           +EDLA  F++KTQ+ IDRIVELQK G L+GVIDDRGKFIYIS+EELN+VA FIKQR    
Sbjct: 208 LEDLAVQFKLKTQAAIDRIVELQKDGRLSGVIDDRGKFIYISEEELNAVAKFIKQR---- 263

Query: 61  LNSVATFIKQKGRVSVSELVENSNQLVTLIP 91
                      GRVS++EL ENSN L+ L+P
Sbjct: 264 -----------GRVSITELAENSNNLINLVP 283





Culex quinquefasciatus (taxid: 7176)
>sp|C3Y431|DDRGK_BRAFL DDRGK domain-containing protein 1 OS=Branchiostoma floridae GN=BRAFLDRAFT_114851 PE=3 SV=1 Back     alignment and function description
>sp|C0KYB6|DDRGK_BOMMO DDRGK domain-containing protein 1 OS=Bombyx mori PE=2 SV=1 Back     alignment and function description
>sp|B4PQC4|DDRGK_DROYA DDRGK domain-containing protein 1 OS=Drosophila yakuba GN=GE25716 PE=3 SV=1 Back     alignment and function description
>sp|B3P045|DDRGK_DROER DDRGK domain-containing protein 1 OS=Drosophila erecta GN=GG24454 PE=3 SV=1 Back     alignment and function description
>sp|B4NKL1|DDRGK_DROWI DDRGK domain-containing protein 1 OS=Drosophila willistoni GN=GK14514 PE=3 SV=1 Back     alignment and function description
>sp|B4LYB9|DDRGK_DROVI DDRGK domain-containing protein 1 OS=Drosophila virilis GN=GJ23857 PE=3 SV=1 Back     alignment and function description
>sp|B3MTS7|DDRGK_DROAN DDRGK domain-containing protein 1 OS=Drosophila ananassae GN=GF23066 PE=3 SV=1 Back     alignment and function description
>sp|Q9VDD1|DDRGK_DROME DDRGK domain-containing protein 1 OS=Drosophila melanogaster GN=CG5862 PE=1 SV=1 Back     alignment and function description
>sp|Q295B1|DDRGK_DROPS DDRGK domain-containing protein 1 OS=Drosophila pseudoobscura pseudoobscura GN=GA19186 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query96
170041823 287 conserved hypothetical protein [Culex qu 0.791 0.264 0.615 8e-24
312371973 253 hypothetical protein AND_20775 [Anophele 0.791 0.300 0.615 1e-23
380024518 290 PREDICTED: DDRGK domain-containing prote 0.791 0.262 0.593 5e-22
260828191 298 hypothetical protein BRAFLDRAFT_114851 [ 0.802 0.258 0.597 5e-22
242006420 279 conserved hypothetical protein [Pediculu 0.791 0.272 0.593 6e-22
66525595 290 PREDICTED: DDRGK domain-containing prote 0.791 0.262 0.593 7e-22
225703086 289 DDRGK domain-containing protein 1 precur 0.791 0.262 0.593 8e-22
383860848 290 PREDICTED: DDRGK domain-containing prote 0.791 0.262 0.604 2e-21
195498433 312 GE25716 [Drosophila yakuba] gi|290463224 0.791 0.243 0.582 2e-21
194899552 312 GG24454 [Drosophila erecta] gi|290463217 0.791 0.243 0.582 2e-21
>gi|170041823|ref|XP_001848649.1| conserved hypothetical protein [Culex quinquefasciatus] gi|290463215|sp|B0WIW5.1|DDRGK_CULQU RecName: Full=DDRGK domain-containing protein 1; Flags: Precursor gi|167865408|gb|EDS28791.1| conserved hypothetical protein [Culex quinquefasciatus] Back     alignment and taxonomy information
 Score =  114 bits (285), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 56/91 (61%), Positives = 67/91 (73%), Gaps = 15/91 (16%)

Query: 1   MEDLAALFRMKTQSVIDRIVELQKTGALTGVIDDRGKFIYISQEELNSVATFIKQRGREE 60
           +EDLA  F++KTQ+ IDRIVELQK G L+GVIDDRGKFIYIS+EELN+VA FIKQR    
Sbjct: 208 LEDLAVQFKLKTQAAIDRIVELQKDGRLSGVIDDRGKFIYISEEELNAVAKFIKQR---- 263

Query: 61  LNSVATFIKQKGRVSVSELVENSNQLVTLIP 91
                      GRVS++EL ENSN L+ L+P
Sbjct: 264 -----------GRVSITELAENSNNLINLVP 283




Source: Culex quinquefasciatus

Species: Culex quinquefasciatus

Genus: Culex

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|312371973|gb|EFR20028.1| hypothetical protein AND_20775 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|380024518|ref|XP_003696042.1| PREDICTED: DDRGK domain-containing protein 1-like isoform 1 [Apis florea] gi|380024520|ref|XP_003696043.1| PREDICTED: DDRGK domain-containing protein 1-like isoform 2 [Apis florea] Back     alignment and taxonomy information
>gi|260828191|ref|XP_002609047.1| hypothetical protein BRAFLDRAFT_114851 [Branchiostoma floridae] gi|290463213|sp|C3Y431.1|DDRGK_BRAFL RecName: Full=DDRGK domain-containing protein 1; Flags: Precursor gi|229294401|gb|EEN65057.1| hypothetical protein BRAFLDRAFT_114851 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|242006420|ref|XP_002424048.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212507354|gb|EEB11310.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|66525595|ref|XP_624506.1| PREDICTED: DDRGK domain-containing protein 1-like [Apis mellifera] Back     alignment and taxonomy information
>gi|225703086|ref|NP_001139535.1| DDRGK domain-containing protein 1 precursor [Bombyx mori] gi|290463212|sp|C0KYB6.1|DDRGK_BOMMO RecName: Full=DDRGK domain-containing protein 1; Flags: Precursor gi|224570310|gb|ACN56793.1| DDRGK superfamily protein [Bombyx mori] Back     alignment and taxonomy information
>gi|383860848|ref|XP_003705900.1| PREDICTED: DDRGK domain-containing protein 1-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|195498433|ref|XP_002096521.1| GE25716 [Drosophila yakuba] gi|290463224|sp|B4PQC4.1|DDRGK_DROYA RecName: Full=DDRGK domain-containing protein 1; Flags: Precursor gi|194182622|gb|EDW96233.1| GE25716 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|194899552|ref|XP_001979323.1| GG24454 [Drosophila erecta] gi|290463217|sp|B3P045.1|DDRGK_DROER RecName: Full=DDRGK domain-containing protein 1; Flags: Precursor gi|190651026|gb|EDV48281.1| GG24454 [Drosophila erecta] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query96
ZFIN|ZDB-GENE-040426-1050300 ddrgk1 "DDRGK domain containin 0.802 0.256 0.521 1.8e-16
UNIPROTKB|E1BUR3308 DDRGK1 "Uncharacterized protei 0.833 0.259 0.505 6.9e-16
UNIPROTKB|C1BL82298 ddrgk1 "DDRGK domain-containin 0.802 0.258 0.467 2.8e-15
TAIR|locus:2136457298 AT4G27120 "AT4G27120" [Arabido 0.791 0.255 0.472 8.5e-15
UNIPROTKB|F1S8B0312 DDRGK1 "Uncharacterized protei 0.677 0.208 0.569 7.4e-14
UNIPROTKB|F1MK36313 DDRGK1 "DDRGK domain-containin 0.677 0.207 0.569 7.6e-14
UNIPROTKB|Q1LZB0313 DDRGK1 "DDRGK domain-containin 0.677 0.207 0.569 7.6e-14
MGI|MGI:1924256315 Ddrgk1 "DDRGK domain containin 0.677 0.206 0.569 1.3e-13
UNIPROTKB|E2QZV2390 DDRGK1 "Uncharacterized protei 0.677 0.166 0.569 1.6e-13
UNIPROTKB|Q96HY6314 DDRGK1 "DDRGK domain-containin 0.677 0.207 0.553 2.2e-13
ZFIN|ZDB-GENE-040426-1050 ddrgk1 "DDRGK domain containing 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 204 (76.9 bits), Expect = 1.8e-16, P = 1.8e-16
 Identities = 48/92 (52%), Positives = 61/92 (66%)

Query:     1 MEDLAALFRMKTQSVIDRIVELQKTGALTGVIDDRGKFIYISQEELNSVATFIKQRGREE 60
             +EDLA+ F ++TQ  I R+ +L   G+LTGVIDDRGKFI+I+ EELN+VA FIKQRGR  
Sbjct:   219 LEDLASQFGLRTQDAIARLQDLIADGSLTGVIDDRGKFIFITPEELNAVAQFIKQRGR-- 276

Query:    61 LNSVATFIKQKGRVSVSELVENSNQLVTLIPD 92
                          VS+SEL + SN L+ L PD
Sbjct:   277 -------------VSISELAQASNTLINLTPD 295




GO:0003674 "molecular_function" evidence=ND
GO:0008150 "biological_process" evidence=ND
GO:0005783 "endoplasmic reticulum" evidence=IEA;ISS
UNIPROTKB|E1BUR3 DDRGK1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|C1BL82 ddrgk1 "DDRGK domain-containing protein 1" [Osmerus mordax (taxid:8014)] Back     alignment and assigned GO terms
TAIR|locus:2136457 AT4G27120 "AT4G27120" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1S8B0 DDRGK1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1MK36 DDRGK1 "DDRGK domain-containing protein 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q1LZB0 DDRGK1 "DDRGK domain-containing protein 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1924256 Ddrgk1 "DDRGK domain containing 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2QZV2 DDRGK1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q96HY6 DDRGK1 "DDRGK domain-containing protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9VDD1DDRGK_DROMENo assigned EC number0.56040.79160.2459yesN/A
Q6P0E5DDRGK_DANRENo assigned EC number0.52170.80200.2566yesN/A
Q295B1DDRGK_DROPSNo assigned EC number0.54940.79160.2459yesN/A
C3Y431DDRGK_BRAFLNo assigned EC number0.59780.80200.2583yesN/A
Q55CM7DDRGK_DICDINo assigned EC number0.52300.67700.1940yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query96
pfam09756189 pfam09756, DDRGK, DDRGK domain 6e-22
>gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain Back     alignment and domain information
 Score = 84.4 bits (209), Expect = 6e-22
 Identities = 44/86 (51%), Positives = 60/86 (69%), Gaps = 15/86 (17%)

Query: 2   EDLAALFRMKTQSVIDRIVELQKTGALTGVIDDRGKFIYISQEELNSVATFIKQRGREEL 61
           E+L+A F +KT+ VI+RI +L+  G++TGVIDDRGK+IYIS EEL +VA+FI +R     
Sbjct: 118 EELSAEFGLKTEDVIERIQDLEAQGSITGVIDDRGKYIYISPEELEAVASFINKR----- 172

Query: 62  NSVATFIKQKGRVSVSELVENSNQLV 87
                     GRVS+SEL E SN+L+
Sbjct: 173 ----------GRVSISELAEISNKLI 188


This is a family of proteins of approximately 300 residues, found in plants and vertebrates. They contain a highly conserved DDRGK motif. Length = 189

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 96
PF09756188 DDRGK: DDRGK domain; InterPro: IPR019153 This is a 100.0
KOG3054|consensus299 100.0
smart0041866 HTH_ARSR helix_turn_helix, Arsenical Resistance Op 97.37
PF09743 272 DUF2042: Uncharacterized conserved protein (DUF204 96.91
PRK14165217 winged helix-turn-helix domain-containing protein/ 96.76
smart0075388 PAM PCI/PINT associated module. 96.73
smart0008888 PINT motif in proteasome subunits, Int-6, Nip-1 an 96.73
PF01399105 PCI: PCI domain; InterPro: IPR000717 A homology do 96.22
PRK11169164 leucine-responsive transcriptional regulator; Prov 96.03
PF1346368 HTH_27: Winged helix DNA-binding domain; PDB: 3GFL 95.98
TIGR02337118 HpaR homoprotocatechuate degradation operon regula 95.8
cd0737766 WHTH_GntR Winged helix-turn-helix (WHTH) DNA-bindi 95.55
smart00347101 HTH_MARR helix_turn_helix multiple antibiotic resi 95.47
PLN03083 803 E3 UFM1-protein ligase 1 homolog; Provisional 95.45
smart00344108 HTH_ASNC helix_turn_helix ASNC type. AsnC: an auto 95.29
COG1522154 Lrp Transcriptional regulators [Transcription] 95.25
smart0034560 HTH_GNTR helix_turn_helix gluconate operon transcr 95.19
PRK06266178 transcription initiation factor E subunit alpha; V 95.05
cd0009078 HTH_ARSR Arsenical Resistance Operon Repressor and 94.88
PRK03573144 transcriptional regulator SlyA; Provisional 94.51
TIGR01889109 Staph_reg_Sar staphylococcal accessory regulator f 94.01
PRK11179153 DNA-binding transcriptional regulator AsnC; Provis 93.93
cd0476149 HTH_MerR-SF Helix-Turn-Helix DNA binding domain of 93.92
PF1354576 HTH_Crp_2: Crp-like helix-turn-helix domain; PDB: 93.88
PRK11512144 DNA-binding transcriptional repressor MarR; Provis 93.82
TIGR01884203 cas_HTH CRISPR locus-related DNA-binding protein. 93.72
TIGR02944130 suf_reg_Xantho FeS assembly SUF system regulator, 93.2
smart0041948 HTH_CRP helix_turn_helix, cAMP Regulatory protein. 93.05
PRK10870176 transcriptional repressor MprA; Provisional 92.95
PF13551112 HTH_29: Winged helix-turn helix 92.83
TIGR0176449 excise DNA binding domain, excisionase family. An 92.79
PRK09391230 fixK transcriptional regulator FixK; Provisional 92.45
PF09743 272 DUF2042: Uncharacterized conserved protein (DUF204 92.35
PF0197868 TrmB: Sugar-specific transcriptional regulator Trm 92.27
smart0052996 HTH_DTXR Helix-turn-helix diphteria tox regulatory 92.13
PRK03902142 manganese transport transcriptional regulator; Pro 92.02
COG1339214 Transcriptional regulator of a riboflavin/FAD bios 91.89
PRK13918202 CRP/FNR family transcriptional regulator; Provisio 91.75
PF1340442 HTH_AsnC-type: AsnC-type helix-turn-helix domain; 91.65
cd0009267 HTH_CRP helix_turn_helix, cAMP Regulatory protein 91.49
TIGR0012269 birA_repr_reg BirA biotin operon repressor domain. 91.39
PRK04172 489 pheS phenylalanyl-tRNA synthetase subunit alpha; P 91.11
PF1341248 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 90.98
PF1351852 HTH_28: Helix-turn-helix domain 90.94
PF0172665 LexA_DNA_bind: LexA DNA binding domain; InterPro: 90.84
PF0901269 FeoC: FeoC like transcriptional regulator; InterPr 90.65
smart0034691 HTH_ICLR helix_turn_helix isocitrate lyase regulat 90.64
TIGR03697193 NtcA_cyano global nitrogen regulator NtcA, cyanoba 90.59
COG1846126 MarR Transcriptional regulators [Transcription] 90.49
TIGR03338212 phnR_burk phosphonate utilization associated trans 90.37
COG314060 Uncharacterized protein conserved in bacteria [Fun 90.3
PRK10402226 DNA-binding transcriptional activator YeiL; Provis 90.04
PF0901269 FeoC: FeoC like transcriptional regulator; InterPr 89.89
cd0476467 HTH_MlrA-like_sg1 Helix-Turn-Helix DNA binding dom 89.61
PRK10141117 DNA-binding transcriptional repressor ArsR; Provis 89.6
PF1373055 HTH_36: Helix-turn-helix domain 89.6
PF1272851 HTH_17: Helix-turn-helix domain 89.44
PRK13777185 transcriptional regulator Hpr; Provisional 89.41
PF12419141 DUF3670: SNF2 Helicase protein ; InterPro: IPR0221 89.36
PF0822057 HTH_DeoR: DeoR-like helix-turn-helix domain; Inter 89.0
smart0042270 HTH_MERR helix_turn_helix, mercury resistance. 88.87
PRK09392236 ftrB transcriptional activator FtrB; Provisional 88.85
smart0042053 HTH_DEOR helix_turn_helix, Deoxyribose operon repr 88.51
PRK10512614 selenocysteinyl-tRNA-specific translation factor; 88.31
PF0827955 HTH_11: HTH domain; InterPro: IPR013196 Winged hel 88.25
PRK11414221 colanic acid/biofilm transcriptional regulator; Pr 88.21
PRK00215205 LexA repressor; Validated 87.3
TIGR00498199 lexA SOS regulatory protein LexA. LexA acts as a h 87.18
PF1341169 MerR_1: MerR HTH family regulatory protein; PDB: 2 86.64
PF1284061 HTH_20: Helix-turn-helix domain; PDB: 1ULY_A 2CWE_ 86.63
TIGR02698130 CopY_TcrY copper transport repressor, CopY/TcrY fa 86.61
PF0039264 GntR: Bacterial regulatory proteins, gntR family; 86.25
TIGR02702203 SufR_cyano iron-sulfur cluster biosynthesis transc 86.25
PF1280262 MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP 86.02
TIGR02787251 codY_Gpos GTP-sensing transcriptional pleiotropic 85.62
cd0476249 HTH_MerR-trunc Helix-Turn-Helix DNA binding domain 85.43
TIGR02812 235 fadR_gamma fatty acid metabolism transcriptional r 85.33
PRK09954 362 putative kinase; Provisional 84.82
TIGR02051124 MerR Hg(II)-responsive transcriptional regulator. 84.67
PF0140239 RHH_1: Ribbon-helix-helix protein, copG family; In 84.34
PRK11161235 fumarate/nitrate reduction transcriptional regulat 83.96
PRK11050152 manganese transport regulator MntR; Provisional 83.85
PF0032532 Crp: Bacterial regulatory proteins, crp family; In 83.76
TIGR00373158 conserved hypothetical protein TIGR00373. This fam 83.69
PF1449391 HTH_40: Helix-turn-helix domain 83.57
PF0132560 Fe_dep_repress: Iron dependent repressor, N-termin 83.42
smart0034284 HTH_ARAC helix_turn_helix, arabinose operon contro 83.26
PRK04984 239 fatty acid metabolism regulator; Provisional 82.66
PRK10421 253 DNA-binding transcriptional repressor LldR; Provis 82.42
PRK11534224 DNA-binding transcriptional regulator CsiR; Provis 82.21
COG165479 BirA Biotin operon repressor [Transcription] 82.06
COG1349 253 GlpR Transcriptional regulators of sugar metabolis 82.03
PRK00135188 scpB segregation and condensation protein B; Revie 81.77
PF1494777 HTH_45: Winged helix-turn-helix; PDB: 1XSX_B 1R7J_ 81.77
smart00351125 PAX Paired Box domain. 81.73
PF08784102 RPA_C: Replication protein A C terminal; InterPro: 81.73
PF1360180 HTH_34: Winged helix DNA-binding domain; PDB: 1UB9 81.24
cd0476896 HTH_BmrR-like Helix-Turn-Helix DNA binding domain 80.99
cd00131128 PAX Paired Box domain 80.86
KOG2235|consensus 776 80.72
PRK11523 253 DNA-binding transcriptional repressor ExuR; Provis 80.69
PRK09464 254 pdhR transcriptional regulator PdhR; Reviewed 80.35
PRK09990 251 DNA-binding transcriptional regulator GlcC; Provis 80.17
>PF09756 DDRGK: DDRGK domain; InterPro: IPR019153 This is a family of proteins of approximately 300 residues Back     alignment and domain information
Probab=100.00  E-value=4.5e-38  Score=236.14  Aligned_cols=73  Identities=67%  Similarity=1.022  Sum_probs=33.4

Q ss_pred             ChhhhhhhCCChHHHHHHHHHHHHcCCccEEeeCCCceEEEcHHHHHHHHHHHHhhchhchhhhhhhhccccceeHHHHH
Q psy11008          1 MEDLAALFRMKTQSVIDRIVELQKTGALTGVIDDRGKFIYISQEELNSVATFIKQRGREELNSVATFIKQKGRVSVSELV   80 (96)
Q Consensus         1 ledLAa~F~lktq~vI~RI~eL~~~g~ltGViDDRGKfIyIs~eEl~~Va~fI~~rgr~~~~~~~~~~~~~GRVsi~eL~   80 (96)
                      |+|||++|||+|++||+||++|+++|+|||||||||||||||++||++||+||++|               ||||++||+
T Consensus       116 ledla~~f~l~t~~~i~ri~~L~~~g~ltGv~DdrGkfIyIs~eE~~~va~fi~~r---------------GRvsi~el~  180 (188)
T PF09756_consen  116 LEDLAAEFGLRTQDVINRIQELEAEGRLTGVIDDRGKFIYISEEEMEAVAKFIKQR---------------GRVSISELA  180 (188)
T ss_dssp             HHHHHHHH-S-HHHHHHHHHHHHHHSSS-EEE-TT--EEE----------------------------------------
T ss_pred             HHHHHHHcCCCHHHHHHHHHHHHHCCCceeeEcCCCCeEEecHHHHHHHHHHHHHc---------------CCccHHHHH
Confidence            58999999999999999999999999999999999999999999999999999999               999999999


Q ss_pred             Hhccccee
Q psy11008         81 ENSNQLVT   88 (96)
Q Consensus        81 ~~sN~lI~   88 (96)
                      ++||+||+
T Consensus       181 ~~~N~~i~  188 (188)
T PF09756_consen  181 QESNRLIN  188 (188)
T ss_dssp             --------
T ss_pred             HHHHhhcC
Confidence            99999996



They contain a highly conserved DDRGK motif. The function is unknown. ; PDB: 1WI9_A.

>KOG3054|consensus Back     alignment and domain information
>smart00418 HTH_ARSR helix_turn_helix, Arsenical Resistance Operon Repressor Back     alignment and domain information
>PF09743 DUF2042: Uncharacterized conserved protein (DUF2042); InterPro: IPR018611 The ubiquitin fold modifier 1 (Ufm1) is the most recently discovered ubiquitin-like modifier whose conjugation (ufmylation) system is conserved in multicellular organisms Back     alignment and domain information
>PRK14165 winged helix-turn-helix domain-containing protein/riboflavin kinase; Provisional Back     alignment and domain information
>smart00753 PAM PCI/PINT associated module Back     alignment and domain information
>smart00088 PINT motif in proteasome subunits, Int-6, Nip-1 and TRIP-15 Back     alignment and domain information
>PF01399 PCI: PCI domain; InterPro: IPR000717 A homology domain of unclear function, occurs in the C-terminal region of several regulatory components of the 26S proteasome as well as in other proteins Back     alignment and domain information
>PRK11169 leucine-responsive transcriptional regulator; Provisional Back     alignment and domain information
>PF13463 HTH_27: Winged helix DNA-binding domain; PDB: 3GFL_A 2YR2_B 3GFM_A 3GFJ_A 3GF2_A 3GEZ_A 2GXG_A 3GFI_A 2EB7_A Back     alignment and domain information
>TIGR02337 HpaR homoprotocatechuate degradation operon regulator, HpaR Back     alignment and domain information
>cd07377 WHTH_GntR Winged helix-turn-helix (WHTH) DNA-binding domain of the GntR family of transcriptional regulators Back     alignment and domain information
>smart00347 HTH_MARR helix_turn_helix multiple antibiotic resistance protein Back     alignment and domain information
>PLN03083 E3 UFM1-protein ligase 1 homolog; Provisional Back     alignment and domain information
>smart00344 HTH_ASNC helix_turn_helix ASNC type Back     alignment and domain information
>COG1522 Lrp Transcriptional regulators [Transcription] Back     alignment and domain information
>smart00345 HTH_GNTR helix_turn_helix gluconate operon transcriptional repressor Back     alignment and domain information
>PRK06266 transcription initiation factor E subunit alpha; Validated Back     alignment and domain information
>cd00090 HTH_ARSR Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors Back     alignment and domain information
>PRK03573 transcriptional regulator SlyA; Provisional Back     alignment and domain information
>TIGR01889 Staph_reg_Sar staphylococcal accessory regulator family Back     alignment and domain information
>PRK11179 DNA-binding transcriptional regulator AsnC; Provisional Back     alignment and domain information
>cd04761 HTH_MerR-SF Helix-Turn-Helix DNA binding domain of transcription regulators from the MerR superfamily Back     alignment and domain information
>PF13545 HTH_Crp_2: Crp-like helix-turn-helix domain; PDB: 3LA2_A 3LA3_B 3LA7_A 3B02_A 3E97_A 2H6C_B 1OMI_A 2BGC_H 2BEO_A 2GAU_A Back     alignment and domain information
>PRK11512 DNA-binding transcriptional repressor MarR; Provisional Back     alignment and domain information
>TIGR01884 cas_HTH CRISPR locus-related DNA-binding protein Back     alignment and domain information
>TIGR02944 suf_reg_Xantho FeS assembly SUF system regulator, gammaproteobacterial Back     alignment and domain information
>smart00419 HTH_CRP helix_turn_helix, cAMP Regulatory protein Back     alignment and domain information
>PRK10870 transcriptional repressor MprA; Provisional Back     alignment and domain information
>PF13551 HTH_29: Winged helix-turn helix Back     alignment and domain information
>TIGR01764 excise DNA binding domain, excisionase family Back     alignment and domain information
>PRK09391 fixK transcriptional regulator FixK; Provisional Back     alignment and domain information
>PF09743 DUF2042: Uncharacterized conserved protein (DUF2042); InterPro: IPR018611 The ubiquitin fold modifier 1 (Ufm1) is the most recently discovered ubiquitin-like modifier whose conjugation (ufmylation) system is conserved in multicellular organisms Back     alignment and domain information
>PF01978 TrmB: Sugar-specific transcriptional regulator TrmB; InterPro: IPR002831 TrmB, is a protein of 38,800 apparent molecular weight, that is involved in the maltose-specific regulation of the trehalose/maltose ABC transport operon in Thermococcus litoralis Back     alignment and domain information
>smart00529 HTH_DTXR Helix-turn-helix diphteria tox regulatory element Back     alignment and domain information
>PRK03902 manganese transport transcriptional regulator; Provisional Back     alignment and domain information
>COG1339 Transcriptional regulator of a riboflavin/FAD biosynthetic operon [Transcription / Coenzyme metabolism] Back     alignment and domain information
>PRK13918 CRP/FNR family transcriptional regulator; Provisional Back     alignment and domain information
>PF13404 HTH_AsnC-type: AsnC-type helix-turn-helix domain; PDB: 2ZNY_E 2ZNZ_G 1RI7_A 2CYY_A 2E1C_A 2VC1_B 2QZ8_A 2W29_C 2IVM_B 2VBX_B Back     alignment and domain information
>cd00092 HTH_CRP helix_turn_helix, cAMP Regulatory protein C-terminus; DNA binding domain of prokaryotic regulatory proteins belonging to the catabolite activator protein family Back     alignment and domain information
>TIGR00122 birA_repr_reg BirA biotin operon repressor domain Back     alignment and domain information
>PRK04172 pheS phenylalanyl-tRNA synthetase subunit alpha; Provisional Back     alignment and domain information
>PF13412 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 1I1G_B 2IA0_B 3I4P_A 2GQQ_A 2L4A_A 2CFX_B 2DBB_B 2EFO_A 2EFQ_A 2PN6_A Back     alignment and domain information
>PF13518 HTH_28: Helix-turn-helix domain Back     alignment and domain information
>PF01726 LexA_DNA_bind: LexA DNA binding domain; InterPro: IPR006199 This is the DNA binding domain of the LexA SOS regulon repressor which prevents expression of DNA repair proteins in bacteria Back     alignment and domain information
>PF09012 FeoC: FeoC like transcriptional regulator; InterPro: IPR015102 This entry contains several transcriptional regulators, including FeoC, which contain a HTH motif Back     alignment and domain information
>smart00346 HTH_ICLR helix_turn_helix isocitrate lyase regulation Back     alignment and domain information
>TIGR03697 NtcA_cyano global nitrogen regulator NtcA, cyanobacterial Back     alignment and domain information
>COG1846 MarR Transcriptional regulators [Transcription] Back     alignment and domain information
>TIGR03338 phnR_burk phosphonate utilization associated transcriptional regulator Back     alignment and domain information
>COG3140 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK10402 DNA-binding transcriptional activator YeiL; Provisional Back     alignment and domain information
>PF09012 FeoC: FeoC like transcriptional regulator; InterPro: IPR015102 This entry contains several transcriptional regulators, including FeoC, which contain a HTH motif Back     alignment and domain information
>cd04764 HTH_MlrA-like_sg1 Helix-Turn-Helix DNA binding domain of putative MlrA-like transcription regulators Back     alignment and domain information
>PRK10141 DNA-binding transcriptional repressor ArsR; Provisional Back     alignment and domain information
>PF13730 HTH_36: Helix-turn-helix domain Back     alignment and domain information
>PF12728 HTH_17: Helix-turn-helix domain Back     alignment and domain information
>PRK13777 transcriptional regulator Hpr; Provisional Back     alignment and domain information
>PF12419 DUF3670: SNF2 Helicase protein ; InterPro: IPR022138 This domain family is found in bacteria, archaea and eukaryotes, and is approximately 140 amino acids in length Back     alignment and domain information
>PF08220 HTH_DeoR: DeoR-like helix-turn-helix domain; InterPro: IPR001034 The deoR-type HTH domain is a DNA-binding, helix-turn-helix (HTH) domain of about 50-60 amino acids present in transcription regulators of the deoR family, involved in sugar catabolism Back     alignment and domain information
>smart00422 HTH_MERR helix_turn_helix, mercury resistance Back     alignment and domain information
>PRK09392 ftrB transcriptional activator FtrB; Provisional Back     alignment and domain information
>smart00420 HTH_DEOR helix_turn_helix, Deoxyribose operon repressor Back     alignment and domain information
>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>PF08279 HTH_11: HTH domain; InterPro: IPR013196 Winged helix DNA-binding proteins share a related winged helix-turn-helix DNA-binding motif, where the "wings", or loops, are small beta-sheets Back     alignment and domain information
>PRK11414 colanic acid/biofilm transcriptional regulator; Provisional Back     alignment and domain information
>PRK00215 LexA repressor; Validated Back     alignment and domain information
>TIGR00498 lexA SOS regulatory protein LexA Back     alignment and domain information
>PF13411 MerR_1: MerR HTH family regulatory protein; PDB: 2JML_A 3GP4_A 3GPV_B Back     alignment and domain information
>PF12840 HTH_20: Helix-turn-helix domain; PDB: 1ULY_A 2CWE_A 1Y0U_B 2QUF_B 2QLZ_C 2OQG_B 2ZKZ_C 3PQK_A 3PQJ_D 3F6O_B Back     alignment and domain information
>TIGR02698 CopY_TcrY copper transport repressor, CopY/TcrY family Back     alignment and domain information
>PF00392 GntR: Bacterial regulatory proteins, gntR family; InterPro: IPR000524 Many bacterial transcription regulation proteins bind DNA through a helix-turn-helix (HTH) motif, which can be classified into subfamilies on the basis of sequence similarities Back     alignment and domain information
>TIGR02702 SufR_cyano iron-sulfur cluster biosynthesis transcriptional regulator SufR Back     alignment and domain information
>PF12802 MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP4_B 3KP2_A 3KP5_A 3KP3_B 3KP7_A 3NQO_B 3K0L_B Back     alignment and domain information
>TIGR02787 codY_Gpos GTP-sensing transcriptional pleiotropic repressor CodY Back     alignment and domain information
>cd04762 HTH_MerR-trunc Helix-Turn-Helix DNA binding domain of truncated MerR-like proteins Back     alignment and domain information
>TIGR02812 fadR_gamma fatty acid metabolism transcriptional regulator FadR Back     alignment and domain information
>PRK09954 putative kinase; Provisional Back     alignment and domain information
>TIGR02051 MerR Hg(II)-responsive transcriptional regulator Back     alignment and domain information
>PF01402 RHH_1: Ribbon-helix-helix protein, copG family; InterPro: IPR002145 CopG, also known as RepA, is responsible for the regulation of plasmid copy number Back     alignment and domain information
>PRK11161 fumarate/nitrate reduction transcriptional regulator; Provisional Back     alignment and domain information
>PRK11050 manganese transport regulator MntR; Provisional Back     alignment and domain information
>PF00325 Crp: Bacterial regulatory proteins, crp family; InterPro: IPR001808 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif Back     alignment and domain information
>TIGR00373 conserved hypothetical protein TIGR00373 Back     alignment and domain information
>PF14493 HTH_40: Helix-turn-helix domain Back     alignment and domain information
>PF01325 Fe_dep_repress: Iron dependent repressor, N-terminal DNA binding domain; InterPro: IPR022687 The DtxR-type HTH domain is a DNA-binding, winged helix-turn-helix (wHTH) domain of about 65 residues present in metalloregulators of the DtxR/MntR family Back     alignment and domain information
>smart00342 HTH_ARAC helix_turn_helix, arabinose operon control protein Back     alignment and domain information
>PRK04984 fatty acid metabolism regulator; Provisional Back     alignment and domain information
>PRK10421 DNA-binding transcriptional repressor LldR; Provisional Back     alignment and domain information
>PRK11534 DNA-binding transcriptional regulator CsiR; Provisional Back     alignment and domain information
>COG1654 BirA Biotin operon repressor [Transcription] Back     alignment and domain information
>COG1349 GlpR Transcriptional regulators of sugar metabolism [Transcription / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK00135 scpB segregation and condensation protein B; Reviewed Back     alignment and domain information
>PF14947 HTH_45: Winged helix-turn-helix; PDB: 1XSX_B 1R7J_A Back     alignment and domain information
>smart00351 PAX Paired Box domain Back     alignment and domain information
>PF08784 RPA_C: Replication protein A C terminal; InterPro: IPR014892 This protein corresponds to the C-terminal of the single stranded DNA binding protein RPA (replication protein A) Back     alignment and domain information
>PF13601 HTH_34: Winged helix DNA-binding domain; PDB: 1UB9_A Back     alignment and domain information
>cd04768 HTH_BmrR-like Helix-Turn-Helix DNA binding domain of BmrR-like transcription regulators Back     alignment and domain information
>cd00131 PAX Paired Box domain Back     alignment and domain information
>KOG2235|consensus Back     alignment and domain information
>PRK11523 DNA-binding transcriptional repressor ExuR; Provisional Back     alignment and domain information
>PRK09464 pdhR transcriptional regulator PdhR; Reviewed Back     alignment and domain information
>PRK09990 DNA-binding transcriptional regulator GlcC; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query96
1wi9_A72 Solution Structure Of The Pci Domain From Mouse Hyp 5e-08
>pdb|1WI9|A Chain A, Solution Structure Of The Pci Domain From Mouse Hypothetical Protein Aah51541 Length = 72 Back     alignment and structure

Iteration: 1

Score = 52.8 bits (125), Expect = 5e-08, Method: Compositional matrix adjust. Identities = 26/48 (54%), Positives = 33/48 (68%) Query: 1 MEDLAALFRMKTQSVIDRIVELQKTGALTGVIDDRGKFIYISQEELNS 48 +EDLA ++TQ I+RI +L G LTGVIDDRGKFIYI+ +S Sbjct: 24 LEDLAFQMGLRTQDAINRIQDLLTEGTLTGVIDDRGKFIYITPSGPSS 71

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query96
1wi9_A72 Protein C20ORF116 homolog; helix-turn-helix motif, 8e-17
>1wi9_A Protein C20ORF116 homolog; helix-turn-helix motif, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: a.4.5.47 Length = 72 Back     alignment and structure
 Score = 67.6 bits (165), Expect = 8e-17
 Identities = 25/43 (58%), Positives = 31/43 (72%)

Query: 1  MEDLAALFRMKTQSVIDRIVELQKTGALTGVIDDRGKFIYISQ 43
          +EDLA    ++TQ  I+RI +L   G LTGVIDDRGKFIYI+ 
Sbjct: 24 LEDLAFQMGLRTQDAINRIQDLLTEGTLTGVIDDRGKFIYITP 66


Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query96
1wi9_A72 Protein C20ORF116 homolog; helix-turn-helix motif, 99.94
1ub9_A100 Hypothetical protein PH1061; helix-turn-helix moti 97.46
3cuo_A99 Uncharacterized HTH-type transcriptional regulato; 97.44
2kko_A108 Possible transcriptional regulatory protein (possi 97.23
3jth_A98 Transcription activator HLYU; transcription factor 97.1
3f6v_A151 Possible transcriptional regulator, ARSR family pr 97.03
3f6o_A118 Probable transcriptional regulator, ARSR family pr 96.93
2oqg_A114 Possible transcriptional regulator, ARSR family P; 96.91
1r1u_A106 CZRA, repressor protein; zinc, DNA binding, transc 96.83
3pqk_A102 Biofilm growth-associated repressor; helix-turn-he 96.78
1tbx_A99 ORF F-93, hypothetical 11.0 kDa protein; sulfolobu 96.75
1u2w_A122 CADC repressor, cadmium efflux system accessory pr 96.67
2cg4_A152 Regulatory protein ASNC; DNA binding, FFRP, LRP fa 96.66
2pn6_A150 ST1022, 150AA long hypothetical transcriptional re 96.6
2qvo_A95 Uncharacterized protein AF_1382; PSI, structural g 96.6
3df8_A111 Possible HXLR family transcriptional factor; APC89 96.47
3tgn_A146 ADC operon repressor ADCR; helix-turn-helix, trans 96.47
2hzt_A107 Putative HTH-type transcriptional regulator YTCD; 96.4
1q1h_A110 TFE, transcription factor E, TFE; TFIIE, transcrip 96.39
2hr3_A147 Probable transcriptional regulator; MCSG, structur 96.38
3oop_A143 LIN2960 protein; protein structure initiative, PSI 96.37
2jsc_A118 Transcriptional regulator RV1994C/MT2050; cadmium, 96.36
1lj9_A144 Transcriptional regulator SLYA; HTH DNA binding pr 96.33
1r1t_A122 Transcriptional repressor SMTB; zinc, transcriptio 96.31
2dbb_A151 Putative HTH-type transcriptional regulator PH006; 96.26
2pjp_A121 Selenocysteine-specific elongation factor; SELB, p 96.2
3eco_A139 MEPR; mutlidrug efflux pump regulator winged helix 96.11
3s2w_A159 Transcriptional regulator, MARR family; structural 96.11
1sfx_A109 Conserved hypothetical protein AF2008; structural 96.1
1jgs_A138 Multiple antibiotic resistance protein MARR; trans 96.08
2heo_A67 Z-DNA binding protein 1; protein DLM1-Z-DNA comple 96.05
2p5v_A162 Transcriptional regulator, LRP/ASNC family; NMB057 96.03
3k0l_A162 Repressor protein; helix-turn-helix, structural ge 96.01
2nnn_A140 Probable transcriptional regulator; structural gen 96.01
3bdd_A142 Regulatory protein MARR; putative multiple antibio 95.98
2lkp_A119 Transcriptional regulator, ARSR family; symmetric 95.97
3cjn_A162 Transcriptional regulator, MARR family; silicibact 95.96
3bja_A139 Transcriptional regulator, MARR family, putative; 95.95
2rdp_A150 Putative transcriptional regulator MARR; PFAM PF01 95.95
2eth_A154 Transcriptional regulator, putative, MAR family; M 95.92
3bj6_A152 Transcriptional regulator, MARR family; helix-turn 95.91
2bv6_A142 MGRA, HTH-type transcriptional regulator MGRA; mul 95.89
2w25_A150 Probable transcriptional regulatory protein; trans 95.88
3bro_A141 Transcriptional regulator; helix_TURN_helix, multi 95.88
2fbi_A142 Probable transcriptional regulator; MARR, APC5816, 95.86
2gxg_A146 146AA long hypothetical transcriptional regulator; 95.84
3hsr_A140 HTH-type transcriptional regulator SARZ; helix-tur 95.81
2a61_A145 Transcriptional regulator TM0710; APC4350, MCSG, m 95.77
2htj_A81 P fimbrial regulatory protein KS71A; winged helix- 95.74
2e1c_A171 Putative HTH-type transcriptional regulator PH151; 95.74
1s3j_A155 YUSO protein; structural genomics, MARR transcript 95.74
1z7u_A112 Hypothetical protein EF0647; winged-helix-turn-hel 95.74
2pg4_A95 Uncharacterized protein; structural genomics, join 95.73
3nrv_A148 Putative transcriptional regulator (MARR/EMRR FAM; 95.73
2cyy_A151 Putative HTH-type transcriptional regulator PH151; 95.68
3deu_A166 Transcriptional regulator SLYA; MARR, WING-helix, 95.67
2fbh_A146 Transcriptional regulator PA3341; MARR, transcript 95.66
2nyx_A168 Probable transcriptional regulatory protein, RV14; 95.64
1i1g_A141 Transcriptional regulator LRPA; helix-turn-helix, 95.64
2cfx_A144 HTH-type transcriptional regulator LRPC; transcrip 95.62
3e6m_A161 MARR family transcriptional regulator; APC88769, s 95.62
2fsw_A107 PG_0823 protein; alpha-beta structure, helix-turn- 95.61
3f3x_A144 Transcriptional regulator, MARR family, putative; 95.59
3b73_A111 PHIH1 repressor-like protein; winged-helix-turn-he 95.59
3g3z_A145 NMB1585, transcriptional regulator, MARR family; t 95.56
1ufm_A84 COP9 complex subunit 4; helix-turn-helix, structur 95.53
3kp7_A151 Transcriptional regulator TCAR; multiple drug resi 95.5
2fa5_A162 Transcriptional regulator MARR/EMRR family; multip 95.49
3cdh_A155 Transcriptional regulator, MARR family; helix-turn 95.46
2pex_A153 Transcriptional regulator OHRR; transcription regu 95.43
4hbl_A149 Transcriptional regulator, MARR family; HTH, trans 95.4
2f2e_A146 PA1607; transcription factor, helix-TRUN-helix, AP 95.35
3fm5_A150 Transcriptional regulator; MCSG, PF04017, PSI, MAR 95.35
2d1h_A109 ST1889, 109AA long hypothetical transcriptional re 95.33
2b0l_A102 GTP-sensing transcriptional pleiotropic repressor; 95.33
2frh_A127 SARA, staphylococcal accessory regulator A; winged 95.31
3nqo_A189 MARR-family transcriptional regulator; structural 95.29
3jw4_A148 Transcriptional regulator, MARR/EMRR family; DNA-b 95.29
3bpv_A138 Transcriptional regulator; MARR, DNA binding, tran 95.28
2ia0_A171 Putative HTH-type transcriptional regulator PF086; 95.26
3ech_A142 MEXR, multidrug resistance operon repressor; winge 95.26
3boq_A160 Transcriptional regulator, MARR family; MARR famil 95.25
2zkz_A99 Transcriptional repressor PAGR; protein-DNA, HTH m 95.23
1yyv_A131 Putative transcriptional regulator; reductive meth 95.19
2qww_A154 Transcriptional regulator, MARR family; YP_013417. 95.04
1qgp_A77 Protein (double stranded RNA adenosine deaminase); 95.02
1z91_A147 Organic hydroperoxide resistance transcriptional; 94.94
1on2_A142 Transcriptional regulator MNTR; helix-turn-helix, 94.94
4ev0_A216 Transcription regulator, CRP family; CAMP binding, 94.85
3u2r_A168 Regulatory protein MARR; structural genomics, PSI- 94.83
3r0a_A123 Putative transcriptional regulator; structural gen 94.78
3i4p_A162 Transcriptional regulator, ASNC family; PSI, struc 94.52
1ku9_A152 Hypothetical protein MJ223; putative transcription 94.41
2fxa_A207 Protease production regulatory protein HPR; protea 94.3
2h09_A155 Transcriptional regulator MNTR; transcription regu 93.97
4aik_A151 Transcriptional regulator SLYA; transcription, tra 93.94
4b8x_A147 SCO5413, possible MARR-transcriptional regulator; 93.88
2x4h_A139 Hypothetical protein SSO2273; transcription; 2.30A 93.85
3dv8_A220 Transcriptional regulator, CRP/FNR family; cyclic 93.75
1lva_A258 Selenocysteine-specific elongation factor; winged- 93.74
3hrs_A 214 Metalloregulator SCAR; DTXR/MNTR family member, tr 93.72
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 93.38
3tqn_A113 Transcriptional regulator, GNTR family; regulatory 93.06
3d0s_A227 Transcriptional regulatory protein; CAMP receptor 93.03
2zcw_A202 TTHA1359, transcriptional regulator, FNR/CRP famil 92.9
2fbk_A181 Transcriptional regulator, MARR family; winged-hel 92.86
3fx3_A237 Cyclic nucleotide-binding protein; helix_TURN_heli 92.73
1j5y_A187 Transcriptional regulator, biotin repressor famil; 92.64
1ft9_A222 Carbon monoxide oxidation system transcription reg 92.45
2qq9_A 226 Diphtheria toxin repressor; regulator, DTXR, helix 92.29
3e6c_C250 CPRK, cyclic nucleotide-binding protein; CPRK, hal 92.23
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 92.15
1p4x_A250 Staphylococcal accessory regulator A homologue; wi 92.0
4a5n_A131 Uncharacterized HTH-type transcriptional regulato; 91.91
1sd4_A126 Penicillinase repressor; BLAI, MECI, methicillin, 91.9
1okr_A123 MECI, methicillin resistance regulatory protein ME 91.78
2bgc_A238 PRFA; bacterial infection, human pathogen, transcr 91.72
3b02_A195 Transcriptional regulator, CRP family; structural 91.65
3ic7_A126 Putative transcriptional regulator; helix-turn-hel 91.58
3l7w_A108 Putative uncharacterized protein SMU.1704; PADR, t 91.49
2gau_A232 Transcriptional regulator, CRP/FNR family; structu 91.42
3e97_A231 Transcriptional regulator, CRP/FNR family; YP_6044 91.3
1qbj_A81 Protein (double-stranded RNA specific adenosine D 91.28
1uly_A192 Hypothetical protein PH1932; helix-turn-helix, str 91.2
2wte_A244 CSA3; antiviral protein, viral resistance, winged 91.14
3cta_A 230 Riboflavin kinase; structural genomics, transferas 91.04
3iuo_A122 ATP-dependent DNA helicase RECQ; C-terminal, GI PS 90.86
2v7f_A150 RPS19, RPS19E SSU ribosomal protein S19E; diamond 90.78
4b4t_O393 26S proteasome regulatory subunit RPN9; hydrolase, 90.68
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 90.58
2co5_A99 Viral protein F93; viral protein-winged helix comp 90.54
1y0u_A96 Arsenical resistance operon repressor, putative; s 90.38
2esh_A118 Conserved hypothetical protein TM0937; APC5794, st 90.14
1fx7_A 230 Iron-dependent repressor IDER; DTXR, iron-dependen 90.07
2v79_A135 DNA replication protein DNAD; primosome, DNA-bindi 90.03
2fmy_A220 COOA, carbon monoxide oxidation system transcripti 90.0
1oyi_A82 Double-stranded RNA-binding protein; (alpha+beta) 89.91
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 89.8
2jt1_A77 PEFI protein; solution structure, winged helix-tur 89.72
3k2z_A196 LEXA repressor; winged helix-turn-helix, SOS syste 89.55
4fx0_A148 Probable transcriptional repressor protein; helix- 89.46
3neu_A125 LIN1836 protein; structural genomics, PSI-2, prote 89.08
1xn7_A78 Hypothetical protein YHGG; alpha+beta, GFT structu 89.01
2g9w_A138 Conserved hypothetical protein; DNA-binding domain 88.95
2ba3_A51 NIKA; dimer, bacterial conjugation, relaxase, DNA 88.89
2dk8_A81 DNA-directed RNA polymerase III 39 kDa polypeptide 88.7
2k9i_A55 Plasmid PRN1, complete sequence; plasmid COPY cont 88.44
2k02_A87 Ferrous iron transport protein C; FEOC, iron-sulfu 87.79
3ihu_A222 Transcriptional regulator, GNTR family; YP_298823. 87.64
1hsj_A487 Fusion protein consisting of staphylococcus access 87.39
3lmm_A583 Uncharacterized protein; multi-domained alpha-beta 87.34
1xmk_A79 Double-stranded RNA-specific adenosine deaminase; 87.15
2hs5_A239 Putative transcriptional regulator GNTR; APC6050, 86.95
1bia_A 321 BIRA bifunctional protein; transcription regulatio 86.43
2fu4_A83 Ferric uptake regulation protein; DNA binding doma 86.31
3by6_A126 Predicted transcriptional regulator; structural ge 86.24
3la7_A243 Global nitrogen regulator; activator, DNA-binding, 86.05
3hhh_A116 Transcriptional regulator, PADR family; PF03551, s 85.77
4ham_A134 LMO2241 protein; structural genomics, PSI-biology, 85.68
2vn2_A128 DNAD, chromosome replication initiation protein; D 85.45
4esf_A117 PADR-like transcriptional regulator; PADR family, 85.39
1xma_A145 Predicted transcriptional regulator; southea colla 84.93
1mkm_A 249 ICLR transcriptional regulator; structural genomic 84.81
2gqq_A163 Leucine-responsive regulatory protein; helix-turn- 84.32
1yg2_A179 Gene activator APHA; virulence factor, winged heli 84.1
3tdu_C77 Cullin-1, CUL-1; E2:E3, ligase-protein binding com 83.9
3ri2_A123 Transcriptional regulator, PADR-like family; PSI-b 83.72
3f8m_A 248 GNTR-family protein transcriptional regulator; PHN 83.35
1iuy_A92 Cullin-3 homologue; winged helix, structural genom 82.75
2xvc_A59 ESCRT-III, SSO0910; cell cycle, cell division, cyt 82.44
3rkx_A 323 Biotin-[acetyl-COA-carboxylase] ligase; biotin pro 82.42
1pdn_C128 Protein (PRD paired); protein-DNA complex, double 81.74
3ryp_A210 Catabolite gene activator; CAMP receptor protein ( 81.59
1hw1_A 239 FADR, fatty acid metabolism regulator protein; hel 81.5
1p4x_A250 Staphylococcal accessory regulator A homologue; wi 81.24
3o2p_E88 Cell division control protein 53; ligase, cell cyc 80.72
2cpg_A45 REPA protein, transcriptional repressor COPG; DNA- 80.32
2ek5_A129 Predicted transcriptional regulators; helix-turn-h 80.06
2p4w_A202 Transcriptional regulatory protein ARSR family; ar 80.03
>1wi9_A Protein C20ORF116 homolog; helix-turn-helix motif, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: a.4.5.47 Back     alignment and structure
Probab=99.94  E-value=4.1e-28  Score=160.89  Aligned_cols=48  Identities=54%  Similarity=0.832  Sum_probs=46.3

Q ss_pred             ChhhhhhhCCChHHHHHHHHHHHHcCCccEEeeCCCceEEEcHHHHHH
Q psy11008          1 MEDLAALFRMKTQSVIDRIVELQKTGALTGVIDDRGKFIYISQEELNS   48 (96)
Q Consensus         1 ledLAa~F~lktq~vI~RI~eL~~~g~ltGViDDRGKfIyIs~eEl~~   48 (96)
                      |||||++|||+||+||+||++|+++|+|||||||||||||||++||++
T Consensus        24 LedLA~~F~l~t~~~i~RI~~Le~~g~ltGViDDRGKfIyIs~eE~~a   71 (72)
T 1wi9_A           24 LEDLAFQMGLRTQDAINRIQDLLTEGTLTGVIDDRGKFIYITPSGPSS   71 (72)
T ss_dssp             HHHHHHHHCSCHHHHHHHHHHHHHHSSSCEEECTTCCEEECCCSSCCC
T ss_pred             HHHHHHHhCCChHHHHHHHHHHHHCCCeEEEEeCCCCEEEecHHHhhc
Confidence            589999999999999999999999999999999999999999999864



>1ub9_A Hypothetical protein PH1061; helix-turn-helix motif, winged helix motif, structural genom transcription; 2.05A {Pyrococcus horikoshii} SCOP: a.4.5.28 Back     alignment and structure
>3cuo_A Uncharacterized HTH-type transcriptional regulato; DNA-binding transcriptional regulator, structural genomics, MCSG; 2.00A {Escherichia coli K12} Back     alignment and structure
>2kko_A Possible transcriptional regulatory protein (possibly ARSR-family); NESG, DNA-binding, transcription regulation, WHTH, homodimer; NMR {Mycobacterium bovis} PDB: 3gw2_A Back     alignment and structure
>3jth_A Transcription activator HLYU; transcription factor, RTXA, DNA-binding, transcription regulation; 2.00A {Vibrio vulnificus} Back     alignment and structure
>3f6v_A Possible transcriptional regulator, ARSR family protein; probable transcriptional repressor ARSR family, structural genomics, PSI-2; 1.48A {Rhodococcus SP} Back     alignment and structure
>3f6o_A Probable transcriptional regulator, ARSR family protein; transcriptional regulator,RHA00566,MCSG, structural genomics, PSI-2; 1.90A {Rhodococcus SP} Back     alignment and structure
>2oqg_A Possible transcriptional regulator, ARSR family P; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 1.54A {Rhodococcus SP} Back     alignment and structure
>1r1u_A CZRA, repressor protein; zinc, DNA binding, transcriptional regulation, winged HTH protein, transcription repressor; 2.00A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 1r1v_A 2kjb_A 2kjc_A Back     alignment and structure
>3pqk_A Biofilm growth-associated repressor; helix-turn-helix motif, winged-helix fold, transcriptional R DNA binding, transcription; 2.09A {Xylella fastidiosa} PDB: 3pqj_A Back     alignment and structure
>1tbx_A ORF F-93, hypothetical 11.0 kDa protein; sulfolobus spindle virus, winged helix, fusellovirus; 2.70A {Sulfolobus virus 1} SCOP: a.4.5.48 Back     alignment and structure
>1u2w_A CADC repressor, cadmium efflux system accessory protein; LEAD, SOFT metal ION resistance, ARSR/SM family, DNA binding protein; 1.90A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 3f72_A Back     alignment and structure
>2cg4_A Regulatory protein ASNC; DNA binding, FFRP, LRP family, transcription, DNA- binding, transcription regulation; 2.4A {Escherichia coli} SCOP: a.4.5.32 d.58.4.2 Back     alignment and structure
>2pn6_A ST1022, 150AA long hypothetical transcriptional regulator; LRP/ASNC family Gln binding, structural genomics, NPPSFA; HET: GLN; 1.44A {Sulfolobus tokodaii} PDB: 2efn_A* 2e7x_A* 2e7w_A* 2yx4_A* 2efq_A* 2pmh_A* 2yx7_A* 2efp_A* 2efo_A* Back     alignment and structure
>2qvo_A Uncharacterized protein AF_1382; PSI, structural genomics, southeast collaboratory for structural genomics; 1.85A {Archaeoglobus fulgidus dsm 4304} PDB: 3o3k_A 3ov8_A Back     alignment and structure
>3df8_A Possible HXLR family transcriptional factor; APC89000, structural genomics, midwest center for structural genomics, MCSG; 1.65A {Thermoplasma volcanium} SCOP: a.4.5.0 Back     alignment and structure
>3tgn_A ADC operon repressor ADCR; helix-turn-helix, transcriptional regulator, transcription; 2.00A {Streptococcus pneumoniae} Back     alignment and structure
>2hzt_A Putative HTH-type transcriptional regulator YTCD; DNA-binding protein, HTH-type transcription regulators, structural genomics, PSI-2; HET: CSU MSE; 2.00A {Bacillus subtilis} SCOP: a.4.5.69 Back     alignment and structure
>1q1h_A TFE, transcription factor E, TFE; TFIIE, transcription initiation, preinitiation complex, RNA polymerase II, transcription bubble; 2.90A {Sulfolobus solfataricus} SCOP: a.4.5.41 Back     alignment and structure
>2hr3_A Probable transcriptional regulator; MCSG, structural genomics, PSI-2, protein structure initiati midwest center for structural genomics; 2.40A {Pseudomonas aeruginosa} SCOP: a.4.5.28 Back     alignment and structure
>3oop_A LIN2960 protein; protein structure initiative, PSI-2, structural genomics, MI center for structural genomics, MCSG, unknown function; 1.78A {Listeria innocua} Back     alignment and structure
>1lj9_A Transcriptional regulator SLYA; HTH DNA binding protein, structural genomics, PSI, protein structure initiative; 1.60A {Enterococcus faecalis} SCOP: a.4.5.28 Back     alignment and structure
>1r1t_A Transcriptional repressor SMTB; zinc, transcriptional regulation, winged HTH protein, DNA binding, transcription repressor; 1.70A {Synechococcus elongatus pcc 7942} SCOP: a.4.5.5 PDB: 1r23_A 1smt_A 1r22_A Back     alignment and structure
>2dbb_A Putative HTH-type transcriptional regulator PH006; ASNC family, helix-turn-helix (HTH) domain, structural genom NPPSFA; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2pjp_A Selenocysteine-specific elongation factor; SELB, protein-RNA complex, elongation factor, winged- helix, bulge, translation/RNA complex; 2.30A {Escherichia coli} Back     alignment and structure
>3eco_A MEPR; mutlidrug efflux pump regulator winged helix-turn-helix motif, DNA-binding, transcription, transcription regulation; 2.40A {Staphylococcus aureus} SCOP: a.4.5.0 Back     alignment and structure
>3s2w_A Transcriptional regulator, MARR family; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 2.45A {Methanosarcina mazei} Back     alignment and structure
>1sfx_A Conserved hypothetical protein AF2008; structural genomics, HTH MOT protein structure initiative, midwest center for structural genomics; 1.55A {Archaeoglobus fulgidus} SCOP: a.4.5.50 Back     alignment and structure
>1jgs_A Multiple antibiotic resistance protein MARR; transcription regulation, DNA-binding, repressor, transcription; HET: SAL; 2.30A {Escherichia coli} SCOP: a.4.5.28 Back     alignment and structure
>2heo_A Z-DNA binding protein 1; protein DLM1-Z-DNA complex, immune system-DNA complex; 1.70A {Mus musculus} PDB: 1j75_A Back     alignment and structure
>2p5v_A Transcriptional regulator, LRP/ASNC family; NMB0573, structu genomics; 1.99A {Neisseria meningitidis} PDB: 2p6s_A 2p6t_A Back     alignment and structure
>3k0l_A Repressor protein; helix-turn-helix, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.35A {Acinetobacter SP} Back     alignment and structure
>2nnn_A Probable transcriptional regulator; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>3bdd_A Regulatory protein MARR; putative multiple antibiotic-resistance repressor, structura genomics, joint center for structural genomics, JCSG; 2.20A {Streptococcus suis} Back     alignment and structure
>2lkp_A Transcriptional regulator, ARSR family; symmetric homodimer, NI(II) binding protein, DNA binding Pro transcription regulator; NMR {Mycobacterium tuberculosis} Back     alignment and structure
>3cjn_A Transcriptional regulator, MARR family; silicibacter pomeroy structural genomics, PSI-2, protein structure initiative; 1.95A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3bja_A Transcriptional regulator, MARR family, putative; NP_978771.1, putative MARR-like transcription regulator, MAR structural genomics; 2.38A {Bacillus cereus} Back     alignment and structure
>2rdp_A Putative transcriptional regulator MARR; PFAM PF01047, winged-helix binding motif, structural genomics, PSI-2; 2.30A {Geobacillus stearothermophilus} Back     alignment and structure
>2eth_A Transcriptional regulator, putative, MAR family; MARR family, structural genomics, joint center for structura genomics, JCSG; 2.30A {Thermotoga maritima} SCOP: a.4.5.28 Back     alignment and structure
>3bj6_A Transcriptional regulator, MARR family; helix-turn-helix, trasnscription regulator, STR genomics, PSI-2, protein structure initiative; 2.01A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>2bv6_A MGRA, HTH-type transcriptional regulator MGRA; multidrug resistance regulator, virulence determinant, transcriptional factors; 2.8A {Staphylococcus aureus} SCOP: a.4.5.28 Back     alignment and structure
>2w25_A Probable transcriptional regulatory protein; transcription regulation, mutant, RV3291C, Glu104Ala, DNA-binding; 2.15A {Mycobacterium tuberculosis} PDB: 2vbw_A* 2vbx_A* 2vby_A* 2vbz_A* 2vc0_A 2vc1_A 2w24_A 2ivm_A 2w29_A 2qz8_A Back     alignment and structure
>3bro_A Transcriptional regulator; helix_TURN_helix, multiple antibiotic resistance protein (MA structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.04A {Oenococcus oeni} SCOP: a.4.5.28 Back     alignment and structure
>2fbi_A Probable transcriptional regulator; MARR, APC5816, structural genomic protein structure initiative; 2.10A {Pseudomonas aeruginosa} SCOP: a.4.5.28 Back     alignment and structure
>2gxg_A 146AA long hypothetical transcriptional regulator; winged helix; 1.45A {Sulfolobus tokodaii} PDB: 2eb7_A 2yr2_A 3gez_A 3gf2_A* 3gfi_A 3gfm_A 3gfj_A 3gfl_A Back     alignment and structure
>3hsr_A HTH-type transcriptional regulator SARZ; helix-turn-helix, cysteine disulfide, MARR-family transcript regulator, DNA-binding; 1.90A {Staphylococcus aureus subsp} PDB: 3hse_A 3hrm_A 4gxo_A Back     alignment and structure
>2a61_A Transcriptional regulator TM0710; APC4350, MCSG, midwest center for structural genomics, PSI, protein structure initiative, MARR; 1.80A {Thermotoga maritima} SCOP: a.4.5.28 Back     alignment and structure
>2htj_A P fimbrial regulatory protein KS71A; winged helix-turn-helix, PAP PILI, transcription activator; NMR {Escherichia coli} SCOP: a.4.5.73 Back     alignment and structure
>1s3j_A YUSO protein; structural genomics, MARR transcriptional regulator family, PSI, protein structure initiative; HET: MSE; 2.25A {Bacillus subtilis} SCOP: a.4.5.28 Back     alignment and structure
>1z7u_A Hypothetical protein EF0647; winged-helix-turn-helix, MARR, structural genomics, PSI, Pro structure initiative; 2.20A {Enterococcus faecalis} SCOP: a.4.5.69 Back     alignment and structure
>2pg4_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, DNA binding protein; HET: MSE CIT; 2.21A {Aeropyrum pernix} SCOP: a.4.5.48 Back     alignment and structure
>3nrv_A Putative transcriptional regulator (MARR/EMRR FAM; PSI-2, protein structure initiati structural genomics; HET: MSE; 2.00A {Acinetobacter SP} Back     alignment and structure
>2cyy_A Putative HTH-type transcriptional regulator PH151; structural genomics, pyrococcus horikosii OT3, NPPSFA; HET: MSE GLN; 1.80A {Pyrococcus horikoshii} SCOP: a.4.5.32 d.58.4.2 Back     alignment and structure
>3deu_A Transcriptional regulator SLYA; MARR, WING-helix, transcription regulator, activator, DNA-binding, repressor; HET: SAL; 2.30A {Salmonella typhimurium} SCOP: a.4.5.28 Back     alignment and structure
>2fbh_A Transcriptional regulator PA3341; MARR, transcription regulator, APC5857, structural genomics, protein structure initiative; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.28 Back     alignment and structure
>2nyx_A Probable transcriptional regulatory protein, RV14; alpha/beta, structural genomics, PSI-2; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>1i1g_A Transcriptional regulator LRPA; helix-turn-helix, LRP/ASNC family; 2.90A {Pyrococcus furiosus} SCOP: a.4.5.32 d.58.4.2 Back     alignment and structure
>2cfx_A HTH-type transcriptional regulator LRPC; transcriptional regulation, DNA binding, FFRP; 2.4A {Bacillus subtilis} SCOP: a.4.5.32 d.58.4.2 Back     alignment and structure
>3e6m_A MARR family transcriptional regulator; APC88769, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; 2.20A {Silicibacter pomeroyi} Back     alignment and structure
>2fsw_A PG_0823 protein; alpha-beta structure, helix-turn-helix, winged-helix-turn-HE structural genomics, PSI, protein structure initiative; HET: MSE; 2.16A {Porphyromonas gingivalis} SCOP: a.4.5.69 Back     alignment and structure
>3f3x_A Transcriptional regulator, MARR family, putative; DNA binding protein, DNA-binding, transcription regulation; 1.90A {Sulfolobus solfataricus} Back     alignment and structure
>3b73_A PHIH1 repressor-like protein; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 2.12A {Haloarcula marismortui atcc 43049} Back     alignment and structure
>3g3z_A NMB1585, transcriptional regulator, MARR family; transcription factor, structur genomics, oxford protein production facility; 2.10A {Neisseria meningitidis serogroup B} Back     alignment and structure
>1ufm_A COP9 complex subunit 4; helix-turn-helix, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: a.4.5.47 Back     alignment and structure
>3kp7_A Transcriptional regulator TCAR; multiple drug resistance, biofilm, transcription regulation, binding, transcription regulator; 2.30A {Staphylococcus epidermidis RP62A} PDB: 3kp3_A* 3kp4_A* 3kp5_A* 3kp2_A* 3kp6_A Back     alignment and structure
>2fa5_A Transcriptional regulator MARR/EMRR family; multiple antibiotics resistance repressor, XCC structural genomics, X-RAY diffraction; 1.80A {Xanthomonas campestris} Back     alignment and structure
>3cdh_A Transcriptional regulator, MARR family; helix-turn-hleix, structura genomics, PSI-2, protein structure initiative; 2.69A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>2pex_A Transcriptional regulator OHRR; transcription regulator; 1.90A {Xanthomonas campestris} PDB: 2pfb_A Back     alignment and structure
>4hbl_A Transcriptional regulator, MARR family; HTH, transcription factor, DNA binding; 2.50A {Staphylococcus epidermidis} Back     alignment and structure
>2f2e_A PA1607; transcription factor, helix-TRUN-helix, APC5613, structural genomics, PSI, protein structure initiative; HET: GLC; 1.85A {Pseudomonas aeruginosa} SCOP: a.4.5.69 Back     alignment and structure
>3fm5_A Transcriptional regulator; MCSG, PF04017, PSI, MARR, structu genomics, protein structure initiative, midwest center for structural genomics; HET: GOL; 2.00A {Rhodococcus jostii} Back     alignment and structure
>2d1h_A ST1889, 109AA long hypothetical transcriptional regulator; helix-turn-helix, intermolecular and intramolecular S-S bond structural genomics; 2.05A {Sulfolobus tokodaii} SCOP: a.4.5.50 Back     alignment and structure
>2b0l_A GTP-sensing transcriptional pleiotropic repressor; CODY, DNA-binding, nucleotide-binding, transcript regulation, winged HTH motif.; 2.90A {Bacillus subtilis} SCOP: a.4.5.66 Back     alignment and structure
>2frh_A SARA, staphylococcal accessory regulator A; winged-helix protein, divalent metal binding, transcription; 2.50A {Staphylococcus aureus} SCOP: a.4.5.28 PDB: 2fnp_A 1fzp_D Back     alignment and structure
>3nqo_A MARR-family transcriptional regulator; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE PG4; 2.20A {Clostridium difficile} Back     alignment and structure
>3jw4_A Transcriptional regulator, MARR/EMRR family; DNA-binding protein, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.10A {Clostridium acetobutylicum} SCOP: a.4.5.0 Back     alignment and structure
>3bpv_A Transcriptional regulator; MARR, DNA binding, transcription factor, winged helix motif, DNA-binding; 1.40A {Methanobacterium thermoautotrophicum} PDB: 3bpx_A* Back     alignment and structure
>2ia0_A Putative HTH-type transcriptional regulator PF086; ASNC, PSI, structural genomics, southeast collaboratory for structural genomics; 2.37A {Pyrococcus furiosus} Back     alignment and structure
>3ech_A MEXR, multidrug resistance operon repressor; winged helix, helix-turn-helix, protein-peptide complex; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.28 PDB: 1lnw_A 3mex_A Back     alignment and structure
>3boq_A Transcriptional regulator, MARR family; MARR famil structural genomics, PSI-2, protein structure initiative; 2.39A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>2zkz_A Transcriptional repressor PAGR; protein-DNA, HTH motif, dimer, DN binding, transcription regulation; 2.00A {Bacillus anthracis} Back     alignment and structure
>1yyv_A Putative transcriptional regulator; reductive methylation, D lysine, structural genomics, PSI; HET: MLY; 2.35A {Salmonella typhimurium} SCOP: a.4.5.69 Back     alignment and structure
>2qww_A Transcriptional regulator, MARR family; YP_013417.1, multiple antibiotic-resistance repressor (MARR) structural genomics; HET: MSE; 2.07A {Listeria monocytogenes str} Back     alignment and structure
>1qgp_A Protein (double stranded RNA adenosine deaminase); Z-alpha-Z-DNA binding domain, RNA-editing, Z-DNA recognition, ADAR1, helix- turn-helix; NMR {Homo sapiens} SCOP: a.4.5.19 Back     alignment and structure
>1z91_A Organic hydroperoxide resistance transcriptional; OHRR, MARR family, bacterial transcription factor, DNA bindi protein; 2.50A {Bacillus subtilis} SCOP: a.4.5.28 PDB: 1z9c_A* Back     alignment and structure
>1on2_A Transcriptional regulator MNTR; helix-turn-helix, DNA-binding protein, metalloregulatory protein; 1.61A {Bacillus subtilis} SCOP: a.4.5.24 a.76.1.1 PDB: 2ev0_A 1on1_A 2ev5_A 2ev6_A* 2f5c_A 2f5d_A 2f5e_A 2f5f_A 2hyf_A* 2hyg_D 3r60_A* 3r61_A* Back     alignment and structure
>4ev0_A Transcription regulator, CRP family; CAMP binding, winged helix-turn-helix motif, DNA binding, transcription activator; HET: CMP; 2.40A {Thermus thermophilus} Back     alignment and structure
>3u2r_A Regulatory protein MARR; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, helix-turn-helix; 2.20A {Planctomyces limnophilus} Back     alignment and structure
>3r0a_A Putative transcriptional regulator; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.31A {Methanosarcina mazei} Back     alignment and structure
>3i4p_A Transcriptional regulator, ASNC family; PSI, structural genom protein structure initiative, midwest center for structural genomics; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>1ku9_A Hypothetical protein MJ223; putative transcription factor, homodimeric winged-helix fold, structural genomics, PSI; 2.80A {Methanocaldococcus jannaschii} SCOP: a.4.5.36 Back     alignment and structure
>2fxa_A Protease production regulatory protein HPR; protease porduction, regulation, STR genomics, PSI, protein structure initiative; HET: PGE P6G 1PE; 2.40A {Bacillus subtilis} SCOP: a.4.5.28 Back     alignment and structure
>2h09_A Transcriptional regulator MNTR; transcription regulator, diphtheria toxin, manganese transport, structural genomics, NPPSFA; 2.10A {Escherichia coli} Back     alignment and structure
>4aik_A Transcriptional regulator SLYA; transcription, transcription factor; 1.85A {Yersinia pseudotuberculosis} PDB: 4aih_A 4aij_A 3qpt_A* 3q5f_A* Back     alignment and structure
>4b8x_A SCO5413, possible MARR-transcriptional regulator; winged helix motif; HET: CME; 1.25A {Streptomyces coelicolor} Back     alignment and structure
>2x4h_A Hypothetical protein SSO2273; transcription; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>3dv8_A Transcriptional regulator, CRP/FNR family; cyclic nucleotide-binding domain, structural genomics, joint for structural genomics; 2.55A {Eubacterium rectale atcc 33656} Back     alignment and structure
>1lva_A Selenocysteine-specific elongation factor; winged-helix, translation; 2.12A {Moorella thermoacetica} SCOP: a.4.5.35 a.4.5.35 a.4.5.35 a.4.5.35 PDB: 2uwm_A 2ply_A 1wsu_A Back     alignment and structure
>3hrs_A Metalloregulator SCAR; DTXR/MNTR family member, transcription; 2.70A {Streptococcus gordonii} PDB: 3hrt_A 3hru_A Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>3tqn_A Transcriptional regulator, GNTR family; regulatory functions; 2.80A {Coxiella burnetii} Back     alignment and structure
>3d0s_A Transcriptional regulatory protein; CAMP receptor protein (CRP), dimer, inactive(APO, unliganded allostery, DNA binding, cyclic AMP; 2.00A {Mycobacterium tuberculosis} PDB: 3i54_A* 3i59_A* 3mzh_A* 3h3u_A* 3r6s_A* Back     alignment and structure
>2zcw_A TTHA1359, transcriptional regulator, FNR/CRP family; stationary phase, DNA-binding, transcription regulation; 1.50A {Thermus thermophilus} Back     alignment and structure
>2fbk_A Transcriptional regulator, MARR family; winged-helix-turn-helix; 2.30A {Deinococcus radiodurans} SCOP: a.4.5.28 Back     alignment and structure
>3fx3_A Cyclic nucleotide-binding protein; helix_TURN_helix, CAMP regulatory protein, structural genomi 2, protein structure initiative; 2.20A {Ruegeria pomeroyi} PDB: 3h3z_A* Back     alignment and structure
>1j5y_A Transcriptional regulator, biotin repressor famil; structural genomics, TM1602, BIOT repressor family, JCSG, conserved hypothetical protein; 2.30A {Thermotoga maritima} SCOP: a.4.5.1 d.94.2.1 Back     alignment and structure
>1ft9_A Carbon monoxide oxidation system transcription regulator; heme sensor, catabolite gene activator protein; HET: HEM; 2.60A {Rhodospirillum rubrum} SCOP: a.4.5.4 b.82.3.1 Back     alignment and structure
>2qq9_A Diphtheria toxin repressor; regulator, DTXR, helix-turn-helix, metal ION, ACT DNA-binding, ferrous iron, transcription; 1.71A {Corynebacterium diphtheriae} PDB: 2tdx_A 1ddn_A 1g3t_A 1g3s_A 1g3w_A 2qqa_A 2qqb_A 2dtr_A 1bi0_A 1bi2_A 1bi3_A 1dpr_A 1bi1_A 1fwz_A 1g3y_A 1c0w_A* 3glx_A 1p92_A 1xcv_A 1f5t_A ... Back     alignment and structure
>3e6c_C CPRK, cyclic nucleotide-binding protein; CPRK, halorespiration; HET: DNA 3C4; 1.80A {Desulfitobacterium hafniense} SCOP: a.4.5.4 b.82.3.2 PDB: 3e6b_A* 3e5u_C* 3e6d_A 3e5x_A* 3e5q_A 2h6b_A* 2h6c_A Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1p4x_A Staphylococcal accessory regulator A homologue; winged-helix protein, transcription; 2.20A {Staphylococcus aureus} SCOP: a.4.5.28 a.4.5.28 Back     alignment and structure
>4a5n_A Uncharacterized HTH-type transcriptional regulato; activator, DNA binding, MARR-like; 1.81A {Bacillus subtilis} PDB: 4a5m_A Back     alignment and structure
>1sd4_A Penicillinase repressor; BLAI, MECI, methicillin, B-lactam, DNA binding PR; 2.00A {Staphylococcus aureus} SCOP: a.4.5.39 PDB: 1xsd_A Back     alignment and structure
>1okr_A MECI, methicillin resistance regulatory protein MECI; bacterial antibiotic resistance, MECI protein, transcriptional regulatory element; 2.4A {Staphylococcus aureus} SCOP: a.4.5.39 PDB: 1sax_A 1sd7_A 2d45_A 1sd6_A Back     alignment and structure
>2bgc_A PRFA; bacterial infection, human pathogen, transcriptional regulat transcription; HET: PR3; 2.3A {Listeria monocytogenes} SCOP: a.4.5.4 b.82.3.3 PDB: 2beo_A* 1omi_A Back     alignment and structure
>3b02_A Transcriptional regulator, CRP family; structural genomics, riken structural genomics/proteomics in RSGI; 1.92A {Thermus thermophilus} PDB: 2zdb_A Back     alignment and structure
>3ic7_A Putative transcriptional regulator; helix-turn-helix, structural genomics, PSI-2, protein struct initiative; 2.82A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3l7w_A Putative uncharacterized protein SMU.1704; PADR, transcriptional factor, transcription; HET: MSE; 2.20A {Streptococcus mutans} SCOP: a.4.5.0 Back     alignment and structure
>2gau_A Transcriptional regulator, CRP/FNR family; structural genomics, porphyromona gingivalis, PSI, protein structure initiative; 1.90A {Porphyromonas gingivalis} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>3e97_A Transcriptional regulator, CRP/FNR family; YP_604437.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.86A {Deinococcus geothermalis dsm 11300} Back     alignment and structure
>1qbj_A Protein (double-stranded RNA specific adenosine D (ADAR1)); protein-Z-DNA complex, hydrolase-DNA complex; HET: DNA; 2.10A {Homo sapiens} SCOP: a.4.5.19 PDB: 3f21_A* 3f22_A* 3f23_A* 3irr_A* 3irq_D* 2gxb_A 2acj_A 2l54_A Back     alignment and structure
>1uly_A Hypothetical protein PH1932; helix-turn-helix, structural genomics, DNA binding protein; 2.50A {Pyrococcus horikoshii} SCOP: a.4.5.58 PDB: 2cwe_A Back     alignment and structure
>2wte_A CSA3; antiviral protein, viral resistance, winged helix-turn-helix prnai nucleotide-binding domain; HET: MSE; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>3cta_A Riboflavin kinase; structural genomics, transferase, PSI-2, protein structure initiative; 2.20A {Thermoplasma acidophilum dsm 1728} SCOP: a.4.5.28 b.43.5.2 Back     alignment and structure
>3iuo_A ATP-dependent DNA helicase RECQ; C-terminal, GI PSI, MCSG, structural genomics, midwest center for structur genomics; 1.60A {Porphyromonas gingivalis} Back     alignment and structure
>2v7f_A RPS19, RPS19E SSU ribosomal protein S19E; diamond blackfan anemia small ribosomal subunit; 1.15A {Pyrococcus abyssi} SCOP: a.4.5.84 Back     alignment and structure
>4b4t_O 26S proteasome regulatory subunit RPN9; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2co5_A Viral protein F93; viral protein-winged helix complex, winged helix, DNA-bindin WHTH, disulfide bond, STIV; 2.2A {Sulfolobus turreted icosahedral virus} SCOP: a.4.5.48 Back     alignment and structure
>1y0u_A Arsenical resistance operon repressor, putative; structural genomics, protein structure initiative, PSI; HET: MSE; 1.60A {Archaeoglobus fulgidus} SCOP: a.4.5.5 Back     alignment and structure
>2esh_A Conserved hypothetical protein TM0937; APC5794, structural genomics, PSI, protein structure initiative; 2.30A {Thermotoga maritima} SCOP: a.4.5.61 Back     alignment and structure
>1fx7_A Iron-dependent repressor IDER; DTXR, iron-dependent regulator, signaling protein; 2.00A {Mycobacterium tuberculosis} SCOP: a.4.5.24 a.76.1.1 b.34.1.2 PDB: 1u8r_A Back     alignment and structure
>2v79_A DNA replication protein DNAD; primosome, DNA-binding protein; HET: DNA; 2.00A {Bacillus subtilis} Back     alignment and structure
>2fmy_A COOA, carbon monoxide oxidation system transcription RE COOA-1; DNA transcription regulator, DNA binding protein; HET: HEM; 2.20A {Carboxydothermus hydrogenoformans} PDB: 2hkx_A* Back     alignment and structure
>1oyi_A Double-stranded RNA-binding protein; (alpha+beta) helix-turn-helix, viral protein; NMR {Vaccinia virus} SCOP: a.4.5.19 Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2jt1_A PEFI protein; solution structure, winged helix-turn-helix, transcripti regulatory protein, structural genomics, PSI-2; NMR {Salmonella typhimurium LT2} Back     alignment and structure
>3k2z_A LEXA repressor; winged helix-turn-helix, SOS system, autoca cleavage, DNA damage, DNA repair, DNA replication, DNA-BIND hydrolase; 1.37A {Thermotoga maritima} Back     alignment and structure
>4fx0_A Probable transcriptional repressor protein; helix-turn-helix, DNA binding, transcription regulator; 2.70A {Mycobacterium tuberculosis} PDB: 4fx4_A* Back     alignment and structure
>3neu_A LIN1836 protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, unknown function; 1.58A {Listeria innocua} Back     alignment and structure
>1xn7_A Hypothetical protein YHGG; alpha+beta, GFT structural genomics, protein structure initiative, PSI, NESG; NMR {Escherichia coli} SCOP: a.4.5.62 Back     alignment and structure
>2g9w_A Conserved hypothetical protein; DNA-binding domain, bacterial transcription repressor, DNA B protein; 1.80A {Mycobacterium tuberculosis} SCOP: a.4.5.39 Back     alignment and structure
>2ba3_A NIKA; dimer, bacterial conjugation, relaxase, DNA binding, ribbon- helix-helix, DNA binding protein; NMR {Plasmid R64} Back     alignment and structure
>2dk8_A DNA-directed RNA polymerase III 39 kDa polypeptide; structural genomics, RNA_POL_RPC34 domain, RNA polymerase III C39 subunit, NPPSFA; NMR {Mus musculus} SCOP: a.4.5.85 Back     alignment and structure
>2k9i_A Plasmid PRN1, complete sequence; plasmid COPY control protein, ribbon helix helix protein, DNA binding protein; NMR {Sulfolobus islandicus} PDB: 3ft7_A Back     alignment and structure
>2k02_A Ferrous iron transport protein C; FEOC, iron-sulfur, metal-binding, metal binding protein; NMR {Klebsiella pneumoniae subsp} Back     alignment and structure
>3ihu_A Transcriptional regulator, GNTR family; YP_298823.1, DNA binding protein, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.92A {Ralstonia eutropha} Back     alignment and structure
>1hsj_A Fusion protein consisting of staphylococcus accessary regulator protein R and maltose...; novel fold for DNA binding; HET: GLC; 2.30A {Escherichia coli} SCOP: a.4.5.28 c.94.1.1 Back     alignment and structure
>3lmm_A Uncharacterized protein; multi-domained alpha-beta protein, structural genomics, PSI- 2, protein structure initiative; 3.00A {Corynebacterium diphtheriae} Back     alignment and structure
>1xmk_A Double-stranded RNA-specific adenosine deaminase; winged helix-turn-helix, RNA editing, interferon, ADAR1, hydrolase; 0.97A {Homo sapiens} SCOP: a.4.5.19 Back     alignment and structure
>2hs5_A Putative transcriptional regulator GNTR; APC6050, rhodococcus SP. RH structural genomics, PSI-2, protein structure initiative; 2.20A {Rhodococcus SP} SCOP: a.4.5.6 a.78.1.1 Back     alignment and structure
>1bia_A BIRA bifunctional protein; transcription regulation; 2.30A {Escherichia coli} SCOP: a.4.5.1 b.34.1.1 d.104.1.2 PDB: 1bib_A* 1hxd_A* 2ewn_A* Back     alignment and structure
>2fu4_A Ferric uptake regulation protein; DNA binding domain, helix-turn-helix, DNA binding protein; 1.80A {Escherichia coli} Back     alignment and structure
>3by6_A Predicted transcriptional regulator; structural genomics, PSI-2, MCSG, structure initiative, midwest center for structural genomic binding; 2.20A {Oenococcus oeni} Back     alignment and structure
>3la7_A Global nitrogen regulator; activator, DNA-binding, transcription, transcription regulation; HET: BOG; 1.90A {Anabaena} PDB: 3la2_A* 3la3_A* 2xko_A* 2xgx_A* 2xhk_A* 2xkp_A* Back     alignment and structure
>3hhh_A Transcriptional regulator, PADR family; PF03551, structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 2.70A {Enterococcus faecalis} SCOP: a.4.5.0 Back     alignment and structure
>4ham_A LMO2241 protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, winged helix-turn-helix, four helix bundle; 1.91A {Listeria monocytogenes} Back     alignment and structure
>2vn2_A DNAD, chromosome replication initiation protein; DNA replication, primosome; 2.3A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>4esf_A PADR-like transcriptional regulator; PADR family, DNA binding protein, HTH fold; 2.20A {Bacillus cereus} Back     alignment and structure
>1xma_A Predicted transcriptional regulator; southea collaboratory for structural genomics, secsg, protein struc initiative, PSI; 2.30A {Clostridium thermocellum} SCOP: a.4.5.61 Back     alignment and structure
>1mkm_A ICLR transcriptional regulator; structural genomics, winged helix-turn-helix, PSI, protein structure initiative; 2.20A {Thermotoga maritima} SCOP: a.4.5.33 d.110.2.2 Back     alignment and structure
>2gqq_A Leucine-responsive regulatory protein; helix-turn-helix, transcription; 3.20A {Escherichia coli} PDB: 2l4a_A Back     alignment and structure
>1yg2_A Gene activator APHA; virulence factor, winged helix, transcripti factor, transcription; 2.20A {Vibrio cholerae} SCOP: a.4.5.61 Back     alignment and structure
>3tdu_C Cullin-1, CUL-1; E2:E3, ligase-protein binding complex; 1.50A {Homo sapiens} PDB: 3tdz_C Back     alignment and structure
>3f8m_A GNTR-family protein transcriptional regulator; PHNF, HUTC, winged helix-TUR UTRA, DNA-binding, transcription regulation; 1.80A {Mycobacterium smegmatis} Back     alignment and structure
>1iuy_A Cullin-3 homologue; winged helix, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: a.4.5.34 Back     alignment and structure
>2xvc_A ESCRT-III, SSO0910; cell cycle, cell division, cytokinesis, winged-helix; 2.15A {Sulfolobus solfataricus} Back     alignment and structure
>3rkx_A Biotin-[acetyl-COA-carboxylase] ligase; biotin protein ligase, 3 domains, enzyme DNA binding, biotin coupling domains; 2.10A {Staphylococcus aureus} PDB: 3rir_A* 3rkw_A 3rky_A* 3v7c_A* 3v7s_A* 3v8j_A 3v7r_A 3v8k_A* 3v8l_A* 4dq2_A* Back     alignment and structure
>1pdn_C Protein (PRD paired); protein-DNA complex, double helix, PAX, paired domain, DNA-binding protein, gene regulation/DNA complex; HET: DNA; 2.50A {Drosophila melanogaster} SCOP: a.4.1.5 Back     alignment and structure
>3ryp_A Catabolite gene activator; CAMP receptor protein (CRP), allostery, DNA binding cyclic A transcription regulator; HET: CMP; 1.60A {Escherichia coli} PDB: 2cgp_A* 3hif_A 1g6n_A* 3ryr_A* 1i5z_A* 1j59_A* 1lb2_A* 1run_A* 1zrc_A* 1zrd_A* 1zre_A* 1zrf_A* 2gzw_A* 2wc2_A 3iyd_G* 3n4m_A* 3qop_A* 3rdi_A* 3rou_A* 3rpq_A* ... Back     alignment and structure
>1hw1_A FADR, fatty acid metabolism regulator protein; helix-turn-helix, helix bundle, transcription; 1.50A {Escherichia coli} SCOP: a.4.5.6 a.78.1.1 PDB: 1hw2_A 1e2x_A 1h9g_A* 1h9t_A Back     alignment and structure
>1p4x_A Staphylococcal accessory regulator A homologue; winged-helix protein, transcription; 2.20A {Staphylococcus aureus} SCOP: a.4.5.28 a.4.5.28 Back     alignment and structure
>3o2p_E Cell division control protein 53; ligase, cell cycle; 2.23A {Saccharomyces cerevisiae} PDB: 3o6b_B Back     alignment and structure
>2cpg_A REPA protein, transcriptional repressor COPG; DNA-binding protein, plasmid, gene regulation; 1.60A {Streptococcus agalactiae} SCOP: a.43.1.3 PDB: 1b01_A* 1ea4_A* Back     alignment and structure
>2ek5_A Predicted transcriptional regulators; helix-turn-helix, interwined alpha helices; 2.20A {Corynebacterium glutamicum atcc 13032} PDB: 2du9_A Back     alignment and structure
>2p4w_A Transcriptional regulatory protein ARSR family; archaea, PHR, heat shock, transcriptional regulation, winged DNA binding; 2.60A {Pyrococcus furiosus} SCOP: a.4.5.64 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 96
d1wi9a_72 a.4.5.47 (A:) Hypothetical protein C20orf116 homol 1e-17
>d1wi9a_ a.4.5.47 (A:) Hypothetical protein C20orf116 homolog {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: PCI domain (PINT motif)
domain: Hypothetical protein C20orf116 homolog
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 68.2 bits (167), Expect = 1e-17
 Identities = 25/43 (58%), Positives = 31/43 (72%)

Query: 1  MEDLAALFRMKTQSVIDRIVELQKTGALTGVIDDRGKFIYISQ 43
          +EDLA    ++TQ  I+RI +L   G LTGVIDDRGKFIYI+ 
Sbjct: 24 LEDLAFQMGLRTQDAINRIQDLLTEGTLTGVIDDRGKFIYITP 66


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query96
d1wi9a_72 Hypothetical protein C20orf116 homolog {Mouse (Mus 99.91
d1ufma_84 COP9 signalosome complex subunit 4, GSN4 {Mouse (M 96.67
d3ctaa185 Ta1064 (RFK), N-terminal domain {Thermoplasma acid 96.64
d1ub9a_100 Hypothetical protein PH1061 {Archaeon Pyrococcus h 96.41
d2cfxa163 Transcriptional regulator LrpC {Bacillus subtilis 96.41
d2cg4a163 Regulatory protein AsnC {Escherichia coli [TaxId: 96.37
d2cyya160 Putative transcriptional regulator PH1519 {Archaeo 96.02
d1i1ga160 LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} 95.95
d2fbia1136 Probable transcriptional regulator PA4135 {Pseudom 95.48
d2gaua181 Transcriptional regulator PG0396, C-terminal domai 95.48
d1p4xa1125 Staphylococcal accessory regulator A homolog, SarS 95.38
d2bgca1100 Listeriolysin regulatory protein PrfA, C-terminal 95.35
d2etha1140 Putative transcriptional regulator TM0816 {Thermot 95.26
d1ft9a180 CO-sensing protein CooA, C-terminal domain {Rhodos 95.13
d1hsja1115 Staphylococcal accessory regulator A homolog, SarR 94.87
d2frha1115 Pleiotropic regulator of virulence genes, SarA {St 94.85
d2a61a1139 Transcriptional regulator TM0710 {Thermotoga marit 94.82
d2d1ha1109 Hypothetical transcriptional regulator ST1889 {Sul 94.79
d1p4xa2125 Staphylococcal accessory regulator A homolog, SarS 94.78
d3broa1135 Transcriptional regulator OEOE1854 {Oenococcus oen 94.77
d2hr3a1145 Probable transcriptional regulator PA3067 {Pseudom 94.75
d3deua1140 Transcriptional regulator SlyA {Salmonella typhimu 94.1
d1s3ja_143 Putative transcriptional regulator YusO {Bacillus 93.95
d1biaa163 Biotin repressor, N-terminal domain {Escherichia c 93.72
d2bv6a1136 Transcriptional regulator MgrA {Staphylococcus aur 93.45
d3e5ua180 Chlorophenol reduction protein CprK {Desulfitobact 93.41
d1sfxa_109 Hypothetical protein AF2008 {Archaeoglobus fulgidu 93.35
d1z91a1137 Organic hydroperoxide resistance transcriptional r 93.05
d1ku9a_151 DNA-binding protein Mj223 {Archaeon Methanococcus 92.95
d1jgsa_138 Multiple antibiotic resistance repressor, MarR {Es 92.94
d1lnwa_141 MexR repressor {Pseudomonas aeruginosa [TaxId: 287 92.77
d2fbha1137 Transcriptional regulator PA3341 {Pseudomonas aeru 92.58
d1i5za169 Catabolite gene activator protein (CAP), C-termina 92.48
d1r1ta_98 SmtB repressor {Cyanobacteria (Synechococcus), pcc 92.04
d1zyba173 Probable transcription regulator BT4300, C-termina 91.84
d1lj9a_144 Transcriptional regulator SlyA {Enterococcus faeca 91.54
d2zcwa182 Transcriptional regulator TTHA1359, C-terminal dom 90.95
d2fxaa1162 Protease production regulatory protein Hpr {Bacill 90.22
d1jhfa171 LexA repressor, N-terminal DNA-binding domain {Esc 90.13
d1ldja190 Anaphase promoting complex (APC) {Human (Homo sapi 90.03
d2hs5a169 Putative transcriptional regulator RHA1_ro03477 {R 89.82
d2ev0a161 Manganese transport regulator MntR {Bacillus subti 89.51
d2p4wa1194 Transcriptional regulatory protein PF1790 {Pyrococ 88.07
d1r1ua_94 Metal-sensing transcriptional repressor CzrA {Stap 88.01
d1z05a171 Transcriptional regulator VC2007 N-terminal domain 87.89
d1j5ya165 Putative transcriptional regulator TM1602, N-termi 87.62
d3bwga178 Transcriptional regulator YydK {Bacillus subtilis 87.06
d1iuya_92 Cullin-3 homologue {Mouse (Mus musculus) [TaxId: 1 86.7
d1u2wa1108 Cadmium efflux system accessory protein CadC {Stap 86.6
d1mkma175 Transcriptional regulator IclR, N-terminal domain 85.57
d2fbka1172 Transcriptional regulator DR1159 {Deinococcus radi 85.27
d2isya163 Iron-dependent regulator IdeR {Mycobacterium tuber 84.22
>d1wi9a_ a.4.5.47 (A:) Hypothetical protein C20orf116 homolog {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: PCI domain (PINT motif)
domain: Hypothetical protein C20orf116 homolog
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.91  E-value=4.1e-26  Score=150.30  Aligned_cols=44  Identities=57%  Similarity=0.908  Sum_probs=42.7

Q ss_pred             ChhhhhhhCCChHHHHHHHHHHHHcCCccEEeeCCCceEEEcHH
Q psy11008          1 MEDLAALFRMKTQSVIDRIVELQKTGALTGVIDDRGKFIYISQE   44 (96)
Q Consensus         1 ledLAa~F~lktq~vI~RI~eL~~~g~ltGViDDRGKfIyIs~e   44 (96)
                      |||||++|+|+||++|+||++|+++|+||||||||||||||||.
T Consensus        24 LedLAa~F~lktqd~i~RIq~Le~~g~ltGViDDRGKfIyIS~s   67 (72)
T d1wi9a_          24 LEDLAFQMGLRTQDAINRIQDLLTEGTLTGVIDDRGKFIYITPS   67 (72)
T ss_dssp             HHHHHHHHCSCHHHHHHHHHHHHHHSSSCEEECTTCCEEECCCS
T ss_pred             HHHHHHHcCCcHHHHHHHHHHHHHCCCeeeEEcCCCCEEEEcCC
Confidence            58999999999999999999999999999999999999999984



>d1ufma_ a.4.5.47 (A:) COP9 signalosome complex subunit 4, GSN4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3ctaa1 a.4.5.28 (A:5-89) Ta1064 (RFK), N-terminal domain {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1ub9a_ a.4.5.28 (A:) Hypothetical protein PH1061 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2cfxa1 a.4.5.32 (A:1-63) Transcriptional regulator LrpC {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2cg4a1 a.4.5.32 (A:4-66) Regulatory protein AsnC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cyya1 a.4.5.32 (A:5-64) Putative transcriptional regulator PH1519 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1i1ga1 a.4.5.32 (A:2-61) LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2fbia1 a.4.5.28 (A:5-140) Probable transcriptional regulator PA4135 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2gaua1 a.4.5.4 (A:152-232) Transcriptional regulator PG0396, C-terminal domain {Porphyromonas gingivalis [TaxId: 837]} Back     information, alignment and structure
>d1p4xa1 a.4.5.28 (A:1-125) Staphylococcal accessory regulator A homolog, SarS {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2bgca1 a.4.5.4 (A:138-237) Listeriolysin regulatory protein PrfA, C-terminal domain {Bacteria (Listeria monocytogenes) [TaxId: 1639]} Back     information, alignment and structure
>d2etha1 a.4.5.28 (A:1-140) Putative transcriptional regulator TM0816 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ft9a1 a.4.5.4 (A:134-213) CO-sensing protein CooA, C-terminal domain {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1hsja1 a.4.5.28 (A:373-487) Staphylococcal accessory regulator A homolog, SarR {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2frha1 a.4.5.28 (A:102-216) Pleiotropic regulator of virulence genes, SarA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2a61a1 a.4.5.28 (A:5-143) Transcriptional regulator TM0710 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2d1ha1 a.4.5.50 (A:1-109) Hypothetical transcriptional regulator ST1889 {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1p4xa2 a.4.5.28 (A:126-250) Staphylococcal accessory regulator A homolog, SarS {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d3broa1 a.4.5.28 (A:3-137) Transcriptional regulator OEOE1854 {Oenococcus oeni [TaxId: 1247]} Back     information, alignment and structure
>d2hr3a1 a.4.5.28 (A:2-146) Probable transcriptional regulator PA3067 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d3deua1 a.4.5.28 (A:2-141) Transcriptional regulator SlyA {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1s3ja_ a.4.5.28 (A:) Putative transcriptional regulator YusO {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1biaa1 a.4.5.1 (A:1-63) Biotin repressor, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bv6a1 a.4.5.28 (A:5-140) Transcriptional regulator MgrA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d3e5ua1 a.4.5.4 (A:148-227) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]} Back     information, alignment and structure
>d1sfxa_ a.4.5.50 (A:) Hypothetical protein AF2008 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1z91a1 a.4.5.28 (A:8-144) Organic hydroperoxide resistance transcriptional regulator OhrR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ku9a_ a.4.5.36 (A:) DNA-binding protein Mj223 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1jgsa_ a.4.5.28 (A:) Multiple antibiotic resistance repressor, MarR {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lnwa_ a.4.5.28 (A:) MexR repressor {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2fbha1 a.4.5.28 (A:8-144) Transcriptional regulator PA3341 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1i5za1 a.4.5.4 (A:138-206) Catabolite gene activator protein (CAP), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r1ta_ a.4.5.5 (A:) SmtB repressor {Cyanobacteria (Synechococcus), pcc7942 [TaxId: 1129]} Back     information, alignment and structure
>d1zyba1 a.4.5.4 (A:148-220) Probable transcription regulator BT4300, C-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1lj9a_ a.4.5.28 (A:) Transcriptional regulator SlyA {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2fxaa1 a.4.5.28 (A:6-167) Protease production regulatory protein Hpr {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1jhfa1 a.4.5.2 (A:2-72) LexA repressor, N-terminal DNA-binding domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ldja1 a.4.5.34 (A:687-776) Anaphase promoting complex (APC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hs5a1 a.4.5.6 (A:25-93) Putative transcriptional regulator RHA1_ro03477 {Rhodococcus sp. RHA1 [TaxId: 101510]} Back     information, alignment and structure
>d2ev0a1 a.4.5.24 (A:2-62) Manganese transport regulator MntR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2p4wa1 a.4.5.64 (A:1-194) Transcriptional regulatory protein PF1790 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1r1ua_ a.4.5.5 (A:) Metal-sensing transcriptional repressor CzrA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1z05a1 a.4.5.63 (A:10-80) Transcriptional regulator VC2007 N-terminal domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1j5ya1 a.4.5.1 (A:3-67) Putative transcriptional regulator TM1602, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3bwga1 a.4.5.6 (A:5-82) Transcriptional regulator YydK {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1iuya_ a.4.5.34 (A:) Cullin-3 homologue {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u2wa1 a.4.5.5 (A:12-119) Cadmium efflux system accessory protein CadC {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1mkma1 a.4.5.33 (A:1-75) Transcriptional regulator IclR, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fbka1 a.4.5.28 (A:8-179) Transcriptional regulator DR1159 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2isya1 a.4.5.24 (A:2-64) Iron-dependent regulator IdeR {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure