Psyllid ID: psy11008
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 96 | ||||||
| 170041823 | 287 | conserved hypothetical protein [Culex qu | 0.791 | 0.264 | 0.615 | 8e-24 | |
| 312371973 | 253 | hypothetical protein AND_20775 [Anophele | 0.791 | 0.300 | 0.615 | 1e-23 | |
| 380024518 | 290 | PREDICTED: DDRGK domain-containing prote | 0.791 | 0.262 | 0.593 | 5e-22 | |
| 260828191 | 298 | hypothetical protein BRAFLDRAFT_114851 [ | 0.802 | 0.258 | 0.597 | 5e-22 | |
| 242006420 | 279 | conserved hypothetical protein [Pediculu | 0.791 | 0.272 | 0.593 | 6e-22 | |
| 66525595 | 290 | PREDICTED: DDRGK domain-containing prote | 0.791 | 0.262 | 0.593 | 7e-22 | |
| 225703086 | 289 | DDRGK domain-containing protein 1 precur | 0.791 | 0.262 | 0.593 | 8e-22 | |
| 383860848 | 290 | PREDICTED: DDRGK domain-containing prote | 0.791 | 0.262 | 0.604 | 2e-21 | |
| 195498433 | 312 | GE25716 [Drosophila yakuba] gi|290463224 | 0.791 | 0.243 | 0.582 | 2e-21 | |
| 194899552 | 312 | GG24454 [Drosophila erecta] gi|290463217 | 0.791 | 0.243 | 0.582 | 2e-21 |
| >gi|170041823|ref|XP_001848649.1| conserved hypothetical protein [Culex quinquefasciatus] gi|290463215|sp|B0WIW5.1|DDRGK_CULQU RecName: Full=DDRGK domain-containing protein 1; Flags: Precursor gi|167865408|gb|EDS28791.1| conserved hypothetical protein [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
Score = 114 bits (285), Expect = 8e-24, Method: Compositional matrix adjust.
Identities = 56/91 (61%), Positives = 67/91 (73%), Gaps = 15/91 (16%)
Query: 1 MEDLAALFRMKTQSVIDRIVELQKTGALTGVIDDRGKFIYISQEELNSVATFIKQRGREE 60
+EDLA F++KTQ+ IDRIVELQK G L+GVIDDRGKFIYIS+EELN+VA FIKQR
Sbjct: 208 LEDLAVQFKLKTQAAIDRIVELQKDGRLSGVIDDRGKFIYISEEELNAVAKFIKQR---- 263
Query: 61 LNSVATFIKQKGRVSVSELVENSNQLVTLIP 91
GRVS++EL ENSN L+ L+P
Sbjct: 264 -----------GRVSITELAENSNNLINLVP 283
|
Source: Culex quinquefasciatus Species: Culex quinquefasciatus Genus: Culex Family: Culicidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|312371973|gb|EFR20028.1| hypothetical protein AND_20775 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
| >gi|380024518|ref|XP_003696042.1| PREDICTED: DDRGK domain-containing protein 1-like isoform 1 [Apis florea] gi|380024520|ref|XP_003696043.1| PREDICTED: DDRGK domain-containing protein 1-like isoform 2 [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|260828191|ref|XP_002609047.1| hypothetical protein BRAFLDRAFT_114851 [Branchiostoma floridae] gi|290463213|sp|C3Y431.1|DDRGK_BRAFL RecName: Full=DDRGK domain-containing protein 1; Flags: Precursor gi|229294401|gb|EEN65057.1| hypothetical protein BRAFLDRAFT_114851 [Branchiostoma floridae] | Back alignment and taxonomy information |
|---|
| >gi|242006420|ref|XP_002424048.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212507354|gb|EEB11310.1| conserved hypothetical protein [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|66525595|ref|XP_624506.1| PREDICTED: DDRGK domain-containing protein 1-like [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|225703086|ref|NP_001139535.1| DDRGK domain-containing protein 1 precursor [Bombyx mori] gi|290463212|sp|C0KYB6.1|DDRGK_BOMMO RecName: Full=DDRGK domain-containing protein 1; Flags: Precursor gi|224570310|gb|ACN56793.1| DDRGK superfamily protein [Bombyx mori] | Back alignment and taxonomy information |
|---|
| >gi|383860848|ref|XP_003705900.1| PREDICTED: DDRGK domain-containing protein 1-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|195498433|ref|XP_002096521.1| GE25716 [Drosophila yakuba] gi|290463224|sp|B4PQC4.1|DDRGK_DROYA RecName: Full=DDRGK domain-containing protein 1; Flags: Precursor gi|194182622|gb|EDW96233.1| GE25716 [Drosophila yakuba] | Back alignment and taxonomy information |
|---|
| >gi|194899552|ref|XP_001979323.1| GG24454 [Drosophila erecta] gi|290463217|sp|B3P045.1|DDRGK_DROER RecName: Full=DDRGK domain-containing protein 1; Flags: Precursor gi|190651026|gb|EDV48281.1| GG24454 [Drosophila erecta] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 96 | ||||||
| ZFIN|ZDB-GENE-040426-1050 | 300 | ddrgk1 "DDRGK domain containin | 0.802 | 0.256 | 0.521 | 1.8e-16 | |
| UNIPROTKB|E1BUR3 | 308 | DDRGK1 "Uncharacterized protei | 0.833 | 0.259 | 0.505 | 6.9e-16 | |
| UNIPROTKB|C1BL82 | 298 | ddrgk1 "DDRGK domain-containin | 0.802 | 0.258 | 0.467 | 2.8e-15 | |
| TAIR|locus:2136457 | 298 | AT4G27120 "AT4G27120" [Arabido | 0.791 | 0.255 | 0.472 | 8.5e-15 | |
| UNIPROTKB|F1S8B0 | 312 | DDRGK1 "Uncharacterized protei | 0.677 | 0.208 | 0.569 | 7.4e-14 | |
| UNIPROTKB|F1MK36 | 313 | DDRGK1 "DDRGK domain-containin | 0.677 | 0.207 | 0.569 | 7.6e-14 | |
| UNIPROTKB|Q1LZB0 | 313 | DDRGK1 "DDRGK domain-containin | 0.677 | 0.207 | 0.569 | 7.6e-14 | |
| MGI|MGI:1924256 | 315 | Ddrgk1 "DDRGK domain containin | 0.677 | 0.206 | 0.569 | 1.3e-13 | |
| UNIPROTKB|E2QZV2 | 390 | DDRGK1 "Uncharacterized protei | 0.677 | 0.166 | 0.569 | 1.6e-13 | |
| UNIPROTKB|Q96HY6 | 314 | DDRGK1 "DDRGK domain-containin | 0.677 | 0.207 | 0.553 | 2.2e-13 |
| ZFIN|ZDB-GENE-040426-1050 ddrgk1 "DDRGK domain containing 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Score = 204 (76.9 bits), Expect = 1.8e-16, P = 1.8e-16
Identities = 48/92 (52%), Positives = 61/92 (66%)
Query: 1 MEDLAALFRMKTQSVIDRIVELQKTGALTGVIDDRGKFIYISQEELNSVATFIKQRGREE 60
+EDLA+ F ++TQ I R+ +L G+LTGVIDDRGKFI+I+ EELN+VA FIKQRGR
Sbjct: 219 LEDLASQFGLRTQDAIARLQDLIADGSLTGVIDDRGKFIFITPEELNAVAQFIKQRGR-- 276
Query: 61 LNSVATFIKQKGRVSVSELVENSNQLVTLIPD 92
VS+SEL + SN L+ L PD
Sbjct: 277 -------------VSISELAQASNTLINLTPD 295
|
|
| UNIPROTKB|E1BUR3 DDRGK1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|C1BL82 ddrgk1 "DDRGK domain-containing protein 1" [Osmerus mordax (taxid:8014)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2136457 AT4G27120 "AT4G27120" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S8B0 DDRGK1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MK36 DDRGK1 "DDRGK domain-containing protein 1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q1LZB0 DDRGK1 "DDRGK domain-containing protein 1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1924256 Ddrgk1 "DDRGK domain containing 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2QZV2 DDRGK1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q96HY6 DDRGK1 "DDRGK domain-containing protein 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 96 | |||
| pfam09756 | 189 | pfam09756, DDRGK, DDRGK domain | 6e-22 |
| >gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain | Back alignment and domain information |
|---|
Score = 84.4 bits (209), Expect = 6e-22
Identities = 44/86 (51%), Positives = 60/86 (69%), Gaps = 15/86 (17%)
Query: 2 EDLAALFRMKTQSVIDRIVELQKTGALTGVIDDRGKFIYISQEELNSVATFIKQRGREEL 61
E+L+A F +KT+ VI+RI +L+ G++TGVIDDRGK+IYIS EEL +VA+FI +R
Sbjct: 118 EELSAEFGLKTEDVIERIQDLEAQGSITGVIDDRGKYIYISPEELEAVASFINKR----- 172
Query: 62 NSVATFIKQKGRVSVSELVENSNQLV 87
GRVS+SEL E SN+L+
Sbjct: 173 ----------GRVSISELAEISNKLI 188
|
This is a family of proteins of approximately 300 residues, found in plants and vertebrates. They contain a highly conserved DDRGK motif. Length = 189 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 96 | |||
| PF09756 | 188 | DDRGK: DDRGK domain; InterPro: IPR019153 This is a | 100.0 | |
| KOG3054|consensus | 299 | 100.0 | ||
| smart00418 | 66 | HTH_ARSR helix_turn_helix, Arsenical Resistance Op | 97.37 | |
| PF09743 | 272 | DUF2042: Uncharacterized conserved protein (DUF204 | 96.91 | |
| PRK14165 | 217 | winged helix-turn-helix domain-containing protein/ | 96.76 | |
| smart00753 | 88 | PAM PCI/PINT associated module. | 96.73 | |
| smart00088 | 88 | PINT motif in proteasome subunits, Int-6, Nip-1 an | 96.73 | |
| PF01399 | 105 | PCI: PCI domain; InterPro: IPR000717 A homology do | 96.22 | |
| PRK11169 | 164 | leucine-responsive transcriptional regulator; Prov | 96.03 | |
| PF13463 | 68 | HTH_27: Winged helix DNA-binding domain; PDB: 3GFL | 95.98 | |
| TIGR02337 | 118 | HpaR homoprotocatechuate degradation operon regula | 95.8 | |
| cd07377 | 66 | WHTH_GntR Winged helix-turn-helix (WHTH) DNA-bindi | 95.55 | |
| smart00347 | 101 | HTH_MARR helix_turn_helix multiple antibiotic resi | 95.47 | |
| PLN03083 | 803 | E3 UFM1-protein ligase 1 homolog; Provisional | 95.45 | |
| smart00344 | 108 | HTH_ASNC helix_turn_helix ASNC type. AsnC: an auto | 95.29 | |
| COG1522 | 154 | Lrp Transcriptional regulators [Transcription] | 95.25 | |
| smart00345 | 60 | HTH_GNTR helix_turn_helix gluconate operon transcr | 95.19 | |
| PRK06266 | 178 | transcription initiation factor E subunit alpha; V | 95.05 | |
| cd00090 | 78 | HTH_ARSR Arsenical Resistance Operon Repressor and | 94.88 | |
| PRK03573 | 144 | transcriptional regulator SlyA; Provisional | 94.51 | |
| TIGR01889 | 109 | Staph_reg_Sar staphylococcal accessory regulator f | 94.01 | |
| PRK11179 | 153 | DNA-binding transcriptional regulator AsnC; Provis | 93.93 | |
| cd04761 | 49 | HTH_MerR-SF Helix-Turn-Helix DNA binding domain of | 93.92 | |
| PF13545 | 76 | HTH_Crp_2: Crp-like helix-turn-helix domain; PDB: | 93.88 | |
| PRK11512 | 144 | DNA-binding transcriptional repressor MarR; Provis | 93.82 | |
| TIGR01884 | 203 | cas_HTH CRISPR locus-related DNA-binding protein. | 93.72 | |
| TIGR02944 | 130 | suf_reg_Xantho FeS assembly SUF system regulator, | 93.2 | |
| smart00419 | 48 | HTH_CRP helix_turn_helix, cAMP Regulatory protein. | 93.05 | |
| PRK10870 | 176 | transcriptional repressor MprA; Provisional | 92.95 | |
| PF13551 | 112 | HTH_29: Winged helix-turn helix | 92.83 | |
| TIGR01764 | 49 | excise DNA binding domain, excisionase family. An | 92.79 | |
| PRK09391 | 230 | fixK transcriptional regulator FixK; Provisional | 92.45 | |
| PF09743 | 272 | DUF2042: Uncharacterized conserved protein (DUF204 | 92.35 | |
| PF01978 | 68 | TrmB: Sugar-specific transcriptional regulator Trm | 92.27 | |
| smart00529 | 96 | HTH_DTXR Helix-turn-helix diphteria tox regulatory | 92.13 | |
| PRK03902 | 142 | manganese transport transcriptional regulator; Pro | 92.02 | |
| COG1339 | 214 | Transcriptional regulator of a riboflavin/FAD bios | 91.89 | |
| PRK13918 | 202 | CRP/FNR family transcriptional regulator; Provisio | 91.75 | |
| PF13404 | 42 | HTH_AsnC-type: AsnC-type helix-turn-helix domain; | 91.65 | |
| cd00092 | 67 | HTH_CRP helix_turn_helix, cAMP Regulatory protein | 91.49 | |
| TIGR00122 | 69 | birA_repr_reg BirA biotin operon repressor domain. | 91.39 | |
| PRK04172 | 489 | pheS phenylalanyl-tRNA synthetase subunit alpha; P | 91.11 | |
| PF13412 | 48 | HTH_24: Winged helix-turn-helix DNA-binding; PDB: | 90.98 | |
| PF13518 | 52 | HTH_28: Helix-turn-helix domain | 90.94 | |
| PF01726 | 65 | LexA_DNA_bind: LexA DNA binding domain; InterPro: | 90.84 | |
| PF09012 | 69 | FeoC: FeoC like transcriptional regulator; InterPr | 90.65 | |
| smart00346 | 91 | HTH_ICLR helix_turn_helix isocitrate lyase regulat | 90.64 | |
| TIGR03697 | 193 | NtcA_cyano global nitrogen regulator NtcA, cyanoba | 90.59 | |
| COG1846 | 126 | MarR Transcriptional regulators [Transcription] | 90.49 | |
| TIGR03338 | 212 | phnR_burk phosphonate utilization associated trans | 90.37 | |
| COG3140 | 60 | Uncharacterized protein conserved in bacteria [Fun | 90.3 | |
| PRK10402 | 226 | DNA-binding transcriptional activator YeiL; Provis | 90.04 | |
| PF09012 | 69 | FeoC: FeoC like transcriptional regulator; InterPr | 89.89 | |
| cd04764 | 67 | HTH_MlrA-like_sg1 Helix-Turn-Helix DNA binding dom | 89.61 | |
| PRK10141 | 117 | DNA-binding transcriptional repressor ArsR; Provis | 89.6 | |
| PF13730 | 55 | HTH_36: Helix-turn-helix domain | 89.6 | |
| PF12728 | 51 | HTH_17: Helix-turn-helix domain | 89.44 | |
| PRK13777 | 185 | transcriptional regulator Hpr; Provisional | 89.41 | |
| PF12419 | 141 | DUF3670: SNF2 Helicase protein ; InterPro: IPR0221 | 89.36 | |
| PF08220 | 57 | HTH_DeoR: DeoR-like helix-turn-helix domain; Inter | 89.0 | |
| smart00422 | 70 | HTH_MERR helix_turn_helix, mercury resistance. | 88.87 | |
| PRK09392 | 236 | ftrB transcriptional activator FtrB; Provisional | 88.85 | |
| smart00420 | 53 | HTH_DEOR helix_turn_helix, Deoxyribose operon repr | 88.51 | |
| PRK10512 | 614 | selenocysteinyl-tRNA-specific translation factor; | 88.31 | |
| PF08279 | 55 | HTH_11: HTH domain; InterPro: IPR013196 Winged hel | 88.25 | |
| PRK11414 | 221 | colanic acid/biofilm transcriptional regulator; Pr | 88.21 | |
| PRK00215 | 205 | LexA repressor; Validated | 87.3 | |
| TIGR00498 | 199 | lexA SOS regulatory protein LexA. LexA acts as a h | 87.18 | |
| PF13411 | 69 | MerR_1: MerR HTH family regulatory protein; PDB: 2 | 86.64 | |
| PF12840 | 61 | HTH_20: Helix-turn-helix domain; PDB: 1ULY_A 2CWE_ | 86.63 | |
| TIGR02698 | 130 | CopY_TcrY copper transport repressor, CopY/TcrY fa | 86.61 | |
| PF00392 | 64 | GntR: Bacterial regulatory proteins, gntR family; | 86.25 | |
| TIGR02702 | 203 | SufR_cyano iron-sulfur cluster biosynthesis transc | 86.25 | |
| PF12802 | 62 | MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP | 86.02 | |
| TIGR02787 | 251 | codY_Gpos GTP-sensing transcriptional pleiotropic | 85.62 | |
| cd04762 | 49 | HTH_MerR-trunc Helix-Turn-Helix DNA binding domain | 85.43 | |
| TIGR02812 | 235 | fadR_gamma fatty acid metabolism transcriptional r | 85.33 | |
| PRK09954 | 362 | putative kinase; Provisional | 84.82 | |
| TIGR02051 | 124 | MerR Hg(II)-responsive transcriptional regulator. | 84.67 | |
| PF01402 | 39 | RHH_1: Ribbon-helix-helix protein, copG family; In | 84.34 | |
| PRK11161 | 235 | fumarate/nitrate reduction transcriptional regulat | 83.96 | |
| PRK11050 | 152 | manganese transport regulator MntR; Provisional | 83.85 | |
| PF00325 | 32 | Crp: Bacterial regulatory proteins, crp family; In | 83.76 | |
| TIGR00373 | 158 | conserved hypothetical protein TIGR00373. This fam | 83.69 | |
| PF14493 | 91 | HTH_40: Helix-turn-helix domain | 83.57 | |
| PF01325 | 60 | Fe_dep_repress: Iron dependent repressor, N-termin | 83.42 | |
| smart00342 | 84 | HTH_ARAC helix_turn_helix, arabinose operon contro | 83.26 | |
| PRK04984 | 239 | fatty acid metabolism regulator; Provisional | 82.66 | |
| PRK10421 | 253 | DNA-binding transcriptional repressor LldR; Provis | 82.42 | |
| PRK11534 | 224 | DNA-binding transcriptional regulator CsiR; Provis | 82.21 | |
| COG1654 | 79 | BirA Biotin operon repressor [Transcription] | 82.06 | |
| COG1349 | 253 | GlpR Transcriptional regulators of sugar metabolis | 82.03 | |
| PRK00135 | 188 | scpB segregation and condensation protein B; Revie | 81.77 | |
| PF14947 | 77 | HTH_45: Winged helix-turn-helix; PDB: 1XSX_B 1R7J_ | 81.77 | |
| smart00351 | 125 | PAX Paired Box domain. | 81.73 | |
| PF08784 | 102 | RPA_C: Replication protein A C terminal; InterPro: | 81.73 | |
| PF13601 | 80 | HTH_34: Winged helix DNA-binding domain; PDB: 1UB9 | 81.24 | |
| cd04768 | 96 | HTH_BmrR-like Helix-Turn-Helix DNA binding domain | 80.99 | |
| cd00131 | 128 | PAX Paired Box domain | 80.86 | |
| KOG2235|consensus | 776 | 80.72 | ||
| PRK11523 | 253 | DNA-binding transcriptional repressor ExuR; Provis | 80.69 | |
| PRK09464 | 254 | pdhR transcriptional regulator PdhR; Reviewed | 80.35 | |
| PRK09990 | 251 | DNA-binding transcriptional regulator GlcC; Provis | 80.17 |
| >PF09756 DDRGK: DDRGK domain; InterPro: IPR019153 This is a family of proteins of approximately 300 residues | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.5e-38 Score=236.14 Aligned_cols=73 Identities=67% Similarity=1.022 Sum_probs=33.4
Q ss_pred ChhhhhhhCCChHHHHHHHHHHHHcCCccEEeeCCCceEEEcHHHHHHHHHHHHhhchhchhhhhhhhccccceeHHHHH
Q psy11008 1 MEDLAALFRMKTQSVIDRIVELQKTGALTGVIDDRGKFIYISQEELNSVATFIKQRGREELNSVATFIKQKGRVSVSELV 80 (96)
Q Consensus 1 ledLAa~F~lktq~vI~RI~eL~~~g~ltGViDDRGKfIyIs~eEl~~Va~fI~~rgr~~~~~~~~~~~~~GRVsi~eL~ 80 (96)
|+|||++|||+|++||+||++|+++|+|||||||||||||||++||++||+||++| ||||++||+
T Consensus 116 ledla~~f~l~t~~~i~ri~~L~~~g~ltGv~DdrGkfIyIs~eE~~~va~fi~~r---------------GRvsi~el~ 180 (188)
T PF09756_consen 116 LEDLAAEFGLRTQDVINRIQELEAEGRLTGVIDDRGKFIYISEEEMEAVAKFIKQR---------------GRVSISELA 180 (188)
T ss_dssp HHHHHHHH-S-HHHHHHHHHHHHHHSSS-EEE-TT--EEE----------------------------------------
T ss_pred HHHHHHHcCCCHHHHHHHHHHHHHCCCceeeEcCCCCeEEecHHHHHHHHHHHHHc---------------CCccHHHHH
Confidence 58999999999999999999999999999999999999999999999999999999 999999999
Q ss_pred Hhccccee
Q psy11008 81 ENSNQLVT 88 (96)
Q Consensus 81 ~~sN~lI~ 88 (96)
++||+||+
T Consensus 181 ~~~N~~i~ 188 (188)
T PF09756_consen 181 QESNRLIN 188 (188)
T ss_dssp --------
T ss_pred HHHHhhcC
Confidence 99999996
|
They contain a highly conserved DDRGK motif. The function is unknown. ; PDB: 1WI9_A. |
| >KOG3054|consensus | Back alignment and domain information |
|---|
| >smart00418 HTH_ARSR helix_turn_helix, Arsenical Resistance Operon Repressor | Back alignment and domain information |
|---|
| >PF09743 DUF2042: Uncharacterized conserved protein (DUF2042); InterPro: IPR018611 The ubiquitin fold modifier 1 (Ufm1) is the most recently discovered ubiquitin-like modifier whose conjugation (ufmylation) system is conserved in multicellular organisms | Back alignment and domain information |
|---|
| >PRK14165 winged helix-turn-helix domain-containing protein/riboflavin kinase; Provisional | Back alignment and domain information |
|---|
| >smart00753 PAM PCI/PINT associated module | Back alignment and domain information |
|---|
| >smart00088 PINT motif in proteasome subunits, Int-6, Nip-1 and TRIP-15 | Back alignment and domain information |
|---|
| >PF01399 PCI: PCI domain; InterPro: IPR000717 A homology domain of unclear function, occurs in the C-terminal region of several regulatory components of the 26S proteasome as well as in other proteins | Back alignment and domain information |
|---|
| >PRK11169 leucine-responsive transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >PF13463 HTH_27: Winged helix DNA-binding domain; PDB: 3GFL_A 2YR2_B 3GFM_A 3GFJ_A 3GF2_A 3GEZ_A 2GXG_A 3GFI_A 2EB7_A | Back alignment and domain information |
|---|
| >TIGR02337 HpaR homoprotocatechuate degradation operon regulator, HpaR | Back alignment and domain information |
|---|
| >cd07377 WHTH_GntR Winged helix-turn-helix (WHTH) DNA-binding domain of the GntR family of transcriptional regulators | Back alignment and domain information |
|---|
| >smart00347 HTH_MARR helix_turn_helix multiple antibiotic resistance protein | Back alignment and domain information |
|---|
| >PLN03083 E3 UFM1-protein ligase 1 homolog; Provisional | Back alignment and domain information |
|---|
| >smart00344 HTH_ASNC helix_turn_helix ASNC type | Back alignment and domain information |
|---|
| >COG1522 Lrp Transcriptional regulators [Transcription] | Back alignment and domain information |
|---|
| >smart00345 HTH_GNTR helix_turn_helix gluconate operon transcriptional repressor | Back alignment and domain information |
|---|
| >PRK06266 transcription initiation factor E subunit alpha; Validated | Back alignment and domain information |
|---|
| >cd00090 HTH_ARSR Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors | Back alignment and domain information |
|---|
| >PRK03573 transcriptional regulator SlyA; Provisional | Back alignment and domain information |
|---|
| >TIGR01889 Staph_reg_Sar staphylococcal accessory regulator family | Back alignment and domain information |
|---|
| >PRK11179 DNA-binding transcriptional regulator AsnC; Provisional | Back alignment and domain information |
|---|
| >cd04761 HTH_MerR-SF Helix-Turn-Helix DNA binding domain of transcription regulators from the MerR superfamily | Back alignment and domain information |
|---|
| >PF13545 HTH_Crp_2: Crp-like helix-turn-helix domain; PDB: 3LA2_A 3LA3_B 3LA7_A 3B02_A 3E97_A 2H6C_B 1OMI_A 2BGC_H 2BEO_A 2GAU_A | Back alignment and domain information |
|---|
| >PRK11512 DNA-binding transcriptional repressor MarR; Provisional | Back alignment and domain information |
|---|
| >TIGR01884 cas_HTH CRISPR locus-related DNA-binding protein | Back alignment and domain information |
|---|
| >TIGR02944 suf_reg_Xantho FeS assembly SUF system regulator, gammaproteobacterial | Back alignment and domain information |
|---|
| >smart00419 HTH_CRP helix_turn_helix, cAMP Regulatory protein | Back alignment and domain information |
|---|
| >PRK10870 transcriptional repressor MprA; Provisional | Back alignment and domain information |
|---|
| >PF13551 HTH_29: Winged helix-turn helix | Back alignment and domain information |
|---|
| >TIGR01764 excise DNA binding domain, excisionase family | Back alignment and domain information |
|---|
| >PRK09391 fixK transcriptional regulator FixK; Provisional | Back alignment and domain information |
|---|
| >PF09743 DUF2042: Uncharacterized conserved protein (DUF2042); InterPro: IPR018611 The ubiquitin fold modifier 1 (Ufm1) is the most recently discovered ubiquitin-like modifier whose conjugation (ufmylation) system is conserved in multicellular organisms | Back alignment and domain information |
|---|
| >PF01978 TrmB: Sugar-specific transcriptional regulator TrmB; InterPro: IPR002831 TrmB, is a protein of 38,800 apparent molecular weight, that is involved in the maltose-specific regulation of the trehalose/maltose ABC transport operon in Thermococcus litoralis | Back alignment and domain information |
|---|
| >smart00529 HTH_DTXR Helix-turn-helix diphteria tox regulatory element | Back alignment and domain information |
|---|
| >PRK03902 manganese transport transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >COG1339 Transcriptional regulator of a riboflavin/FAD biosynthetic operon [Transcription / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK13918 CRP/FNR family transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >PF13404 HTH_AsnC-type: AsnC-type helix-turn-helix domain; PDB: 2ZNY_E 2ZNZ_G 1RI7_A 2CYY_A 2E1C_A 2VC1_B 2QZ8_A 2W29_C 2IVM_B 2VBX_B | Back alignment and domain information |
|---|
| >cd00092 HTH_CRP helix_turn_helix, cAMP Regulatory protein C-terminus; DNA binding domain of prokaryotic regulatory proteins belonging to the catabolite activator protein family | Back alignment and domain information |
|---|
| >TIGR00122 birA_repr_reg BirA biotin operon repressor domain | Back alignment and domain information |
|---|
| >PRK04172 pheS phenylalanyl-tRNA synthetase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PF13412 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 1I1G_B 2IA0_B 3I4P_A 2GQQ_A 2L4A_A 2CFX_B 2DBB_B 2EFO_A 2EFQ_A 2PN6_A | Back alignment and domain information |
|---|
| >PF13518 HTH_28: Helix-turn-helix domain | Back alignment and domain information |
|---|
| >PF01726 LexA_DNA_bind: LexA DNA binding domain; InterPro: IPR006199 This is the DNA binding domain of the LexA SOS regulon repressor which prevents expression of DNA repair proteins in bacteria | Back alignment and domain information |
|---|
| >PF09012 FeoC: FeoC like transcriptional regulator; InterPro: IPR015102 This entry contains several transcriptional regulators, including FeoC, which contain a HTH motif | Back alignment and domain information |
|---|
| >smart00346 HTH_ICLR helix_turn_helix isocitrate lyase regulation | Back alignment and domain information |
|---|
| >TIGR03697 NtcA_cyano global nitrogen regulator NtcA, cyanobacterial | Back alignment and domain information |
|---|
| >COG1846 MarR Transcriptional regulators [Transcription] | Back alignment and domain information |
|---|
| >TIGR03338 phnR_burk phosphonate utilization associated transcriptional regulator | Back alignment and domain information |
|---|
| >COG3140 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PRK10402 DNA-binding transcriptional activator YeiL; Provisional | Back alignment and domain information |
|---|
| >PF09012 FeoC: FeoC like transcriptional regulator; InterPro: IPR015102 This entry contains several transcriptional regulators, including FeoC, which contain a HTH motif | Back alignment and domain information |
|---|
| >cd04764 HTH_MlrA-like_sg1 Helix-Turn-Helix DNA binding domain of putative MlrA-like transcription regulators | Back alignment and domain information |
|---|
| >PRK10141 DNA-binding transcriptional repressor ArsR; Provisional | Back alignment and domain information |
|---|
| >PF13730 HTH_36: Helix-turn-helix domain | Back alignment and domain information |
|---|
| >PF12728 HTH_17: Helix-turn-helix domain | Back alignment and domain information |
|---|
| >PRK13777 transcriptional regulator Hpr; Provisional | Back alignment and domain information |
|---|
| >PF12419 DUF3670: SNF2 Helicase protein ; InterPro: IPR022138 This domain family is found in bacteria, archaea and eukaryotes, and is approximately 140 amino acids in length | Back alignment and domain information |
|---|
| >PF08220 HTH_DeoR: DeoR-like helix-turn-helix domain; InterPro: IPR001034 The deoR-type HTH domain is a DNA-binding, helix-turn-helix (HTH) domain of about 50-60 amino acids present in transcription regulators of the deoR family, involved in sugar catabolism | Back alignment and domain information |
|---|
| >smart00422 HTH_MERR helix_turn_helix, mercury resistance | Back alignment and domain information |
|---|
| >PRK09392 ftrB transcriptional activator FtrB; Provisional | Back alignment and domain information |
|---|
| >smart00420 HTH_DEOR helix_turn_helix, Deoxyribose operon repressor | Back alignment and domain information |
|---|
| >PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional | Back alignment and domain information |
|---|
| >PF08279 HTH_11: HTH domain; InterPro: IPR013196 Winged helix DNA-binding proteins share a related winged helix-turn-helix DNA-binding motif, where the "wings", or loops, are small beta-sheets | Back alignment and domain information |
|---|
| >PRK11414 colanic acid/biofilm transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >PRK00215 LexA repressor; Validated | Back alignment and domain information |
|---|
| >TIGR00498 lexA SOS regulatory protein LexA | Back alignment and domain information |
|---|
| >PF13411 MerR_1: MerR HTH family regulatory protein; PDB: 2JML_A 3GP4_A 3GPV_B | Back alignment and domain information |
|---|
| >PF12840 HTH_20: Helix-turn-helix domain; PDB: 1ULY_A 2CWE_A 1Y0U_B 2QUF_B 2QLZ_C 2OQG_B 2ZKZ_C 3PQK_A 3PQJ_D 3F6O_B | Back alignment and domain information |
|---|
| >TIGR02698 CopY_TcrY copper transport repressor, CopY/TcrY family | Back alignment and domain information |
|---|
| >PF00392 GntR: Bacterial regulatory proteins, gntR family; InterPro: IPR000524 Many bacterial transcription regulation proteins bind DNA through a helix-turn-helix (HTH) motif, which can be classified into subfamilies on the basis of sequence similarities | Back alignment and domain information |
|---|
| >TIGR02702 SufR_cyano iron-sulfur cluster biosynthesis transcriptional regulator SufR | Back alignment and domain information |
|---|
| >PF12802 MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP4_B 3KP2_A 3KP5_A 3KP3_B 3KP7_A 3NQO_B 3K0L_B | Back alignment and domain information |
|---|
| >TIGR02787 codY_Gpos GTP-sensing transcriptional pleiotropic repressor CodY | Back alignment and domain information |
|---|
| >cd04762 HTH_MerR-trunc Helix-Turn-Helix DNA binding domain of truncated MerR-like proteins | Back alignment and domain information |
|---|
| >TIGR02812 fadR_gamma fatty acid metabolism transcriptional regulator FadR | Back alignment and domain information |
|---|
| >PRK09954 putative kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02051 MerR Hg(II)-responsive transcriptional regulator | Back alignment and domain information |
|---|
| >PF01402 RHH_1: Ribbon-helix-helix protein, copG family; InterPro: IPR002145 CopG, also known as RepA, is responsible for the regulation of plasmid copy number | Back alignment and domain information |
|---|
| >PRK11161 fumarate/nitrate reduction transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >PRK11050 manganese transport regulator MntR; Provisional | Back alignment and domain information |
|---|
| >PF00325 Crp: Bacterial regulatory proteins, crp family; InterPro: IPR001808 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif | Back alignment and domain information |
|---|
| >TIGR00373 conserved hypothetical protein TIGR00373 | Back alignment and domain information |
|---|
| >PF14493 HTH_40: Helix-turn-helix domain | Back alignment and domain information |
|---|
| >PF01325 Fe_dep_repress: Iron dependent repressor, N-terminal DNA binding domain; InterPro: IPR022687 The DtxR-type HTH domain is a DNA-binding, winged helix-turn-helix (wHTH) domain of about 65 residues present in metalloregulators of the DtxR/MntR family | Back alignment and domain information |
|---|
| >smart00342 HTH_ARAC helix_turn_helix, arabinose operon control protein | Back alignment and domain information |
|---|
| >PRK04984 fatty acid metabolism regulator; Provisional | Back alignment and domain information |
|---|
| >PRK10421 DNA-binding transcriptional repressor LldR; Provisional | Back alignment and domain information |
|---|
| >PRK11534 DNA-binding transcriptional regulator CsiR; Provisional | Back alignment and domain information |
|---|
| >COG1654 BirA Biotin operon repressor [Transcription] | Back alignment and domain information |
|---|
| >COG1349 GlpR Transcriptional regulators of sugar metabolism [Transcription / Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK00135 scpB segregation and condensation protein B; Reviewed | Back alignment and domain information |
|---|
| >PF14947 HTH_45: Winged helix-turn-helix; PDB: 1XSX_B 1R7J_A | Back alignment and domain information |
|---|
| >smart00351 PAX Paired Box domain | Back alignment and domain information |
|---|
| >PF08784 RPA_C: Replication protein A C terminal; InterPro: IPR014892 This protein corresponds to the C-terminal of the single stranded DNA binding protein RPA (replication protein A) | Back alignment and domain information |
|---|
| >PF13601 HTH_34: Winged helix DNA-binding domain; PDB: 1UB9_A | Back alignment and domain information |
|---|
| >cd04768 HTH_BmrR-like Helix-Turn-Helix DNA binding domain of BmrR-like transcription regulators | Back alignment and domain information |
|---|
| >cd00131 PAX Paired Box domain | Back alignment and domain information |
|---|
| >KOG2235|consensus | Back alignment and domain information |
|---|
| >PRK11523 DNA-binding transcriptional repressor ExuR; Provisional | Back alignment and domain information |
|---|
| >PRK09464 pdhR transcriptional regulator PdhR; Reviewed | Back alignment and domain information |
|---|
| >PRK09990 DNA-binding transcriptional regulator GlcC; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 96 | ||||
| 1wi9_A | 72 | Solution Structure Of The Pci Domain From Mouse Hyp | 5e-08 |
| >pdb|1WI9|A Chain A, Solution Structure Of The Pci Domain From Mouse Hypothetical Protein Aah51541 Length = 72 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 96 | |||
| 1wi9_A | 72 | Protein C20ORF116 homolog; helix-turn-helix motif, | 8e-17 |
| >1wi9_A Protein C20ORF116 homolog; helix-turn-helix motif, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: a.4.5.47 Length = 72 | Back alignment and structure |
|---|
Score = 67.6 bits (165), Expect = 8e-17
Identities = 25/43 (58%), Positives = 31/43 (72%)
Query: 1 MEDLAALFRMKTQSVIDRIVELQKTGALTGVIDDRGKFIYISQ 43
+EDLA ++TQ I+RI +L G LTGVIDDRGKFIYI+
Sbjct: 24 LEDLAFQMGLRTQDAINRIQDLLTEGTLTGVIDDRGKFIYITP 66
|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 96 | |||
| 1wi9_A | 72 | Protein C20ORF116 homolog; helix-turn-helix motif, | 99.94 | |
| 1ub9_A | 100 | Hypothetical protein PH1061; helix-turn-helix moti | 97.46 | |
| 3cuo_A | 99 | Uncharacterized HTH-type transcriptional regulato; | 97.44 | |
| 2kko_A | 108 | Possible transcriptional regulatory protein (possi | 97.23 | |
| 3jth_A | 98 | Transcription activator HLYU; transcription factor | 97.1 | |
| 3f6v_A | 151 | Possible transcriptional regulator, ARSR family pr | 97.03 | |
| 3f6o_A | 118 | Probable transcriptional regulator, ARSR family pr | 96.93 | |
| 2oqg_A | 114 | Possible transcriptional regulator, ARSR family P; | 96.91 | |
| 1r1u_A | 106 | CZRA, repressor protein; zinc, DNA binding, transc | 96.83 | |
| 3pqk_A | 102 | Biofilm growth-associated repressor; helix-turn-he | 96.78 | |
| 1tbx_A | 99 | ORF F-93, hypothetical 11.0 kDa protein; sulfolobu | 96.75 | |
| 1u2w_A | 122 | CADC repressor, cadmium efflux system accessory pr | 96.67 | |
| 2cg4_A | 152 | Regulatory protein ASNC; DNA binding, FFRP, LRP fa | 96.66 | |
| 2pn6_A | 150 | ST1022, 150AA long hypothetical transcriptional re | 96.6 | |
| 2qvo_A | 95 | Uncharacterized protein AF_1382; PSI, structural g | 96.6 | |
| 3df8_A | 111 | Possible HXLR family transcriptional factor; APC89 | 96.47 | |
| 3tgn_A | 146 | ADC operon repressor ADCR; helix-turn-helix, trans | 96.47 | |
| 2hzt_A | 107 | Putative HTH-type transcriptional regulator YTCD; | 96.4 | |
| 1q1h_A | 110 | TFE, transcription factor E, TFE; TFIIE, transcrip | 96.39 | |
| 2hr3_A | 147 | Probable transcriptional regulator; MCSG, structur | 96.38 | |
| 3oop_A | 143 | LIN2960 protein; protein structure initiative, PSI | 96.37 | |
| 2jsc_A | 118 | Transcriptional regulator RV1994C/MT2050; cadmium, | 96.36 | |
| 1lj9_A | 144 | Transcriptional regulator SLYA; HTH DNA binding pr | 96.33 | |
| 1r1t_A | 122 | Transcriptional repressor SMTB; zinc, transcriptio | 96.31 | |
| 2dbb_A | 151 | Putative HTH-type transcriptional regulator PH006; | 96.26 | |
| 2pjp_A | 121 | Selenocysteine-specific elongation factor; SELB, p | 96.2 | |
| 3eco_A | 139 | MEPR; mutlidrug efflux pump regulator winged helix | 96.11 | |
| 3s2w_A | 159 | Transcriptional regulator, MARR family; structural | 96.11 | |
| 1sfx_A | 109 | Conserved hypothetical protein AF2008; structural | 96.1 | |
| 1jgs_A | 138 | Multiple antibiotic resistance protein MARR; trans | 96.08 | |
| 2heo_A | 67 | Z-DNA binding protein 1; protein DLM1-Z-DNA comple | 96.05 | |
| 2p5v_A | 162 | Transcriptional regulator, LRP/ASNC family; NMB057 | 96.03 | |
| 3k0l_A | 162 | Repressor protein; helix-turn-helix, structural ge | 96.01 | |
| 2nnn_A | 140 | Probable transcriptional regulator; structural gen | 96.01 | |
| 3bdd_A | 142 | Regulatory protein MARR; putative multiple antibio | 95.98 | |
| 2lkp_A | 119 | Transcriptional regulator, ARSR family; symmetric | 95.97 | |
| 3cjn_A | 162 | Transcriptional regulator, MARR family; silicibact | 95.96 | |
| 3bja_A | 139 | Transcriptional regulator, MARR family, putative; | 95.95 | |
| 2rdp_A | 150 | Putative transcriptional regulator MARR; PFAM PF01 | 95.95 | |
| 2eth_A | 154 | Transcriptional regulator, putative, MAR family; M | 95.92 | |
| 3bj6_A | 152 | Transcriptional regulator, MARR family; helix-turn | 95.91 | |
| 2bv6_A | 142 | MGRA, HTH-type transcriptional regulator MGRA; mul | 95.89 | |
| 2w25_A | 150 | Probable transcriptional regulatory protein; trans | 95.88 | |
| 3bro_A | 141 | Transcriptional regulator; helix_TURN_helix, multi | 95.88 | |
| 2fbi_A | 142 | Probable transcriptional regulator; MARR, APC5816, | 95.86 | |
| 2gxg_A | 146 | 146AA long hypothetical transcriptional regulator; | 95.84 | |
| 3hsr_A | 140 | HTH-type transcriptional regulator SARZ; helix-tur | 95.81 | |
| 2a61_A | 145 | Transcriptional regulator TM0710; APC4350, MCSG, m | 95.77 | |
| 2htj_A | 81 | P fimbrial regulatory protein KS71A; winged helix- | 95.74 | |
| 2e1c_A | 171 | Putative HTH-type transcriptional regulator PH151; | 95.74 | |
| 1s3j_A | 155 | YUSO protein; structural genomics, MARR transcript | 95.74 | |
| 1z7u_A | 112 | Hypothetical protein EF0647; winged-helix-turn-hel | 95.74 | |
| 2pg4_A | 95 | Uncharacterized protein; structural genomics, join | 95.73 | |
| 3nrv_A | 148 | Putative transcriptional regulator (MARR/EMRR FAM; | 95.73 | |
| 2cyy_A | 151 | Putative HTH-type transcriptional regulator PH151; | 95.68 | |
| 3deu_A | 166 | Transcriptional regulator SLYA; MARR, WING-helix, | 95.67 | |
| 2fbh_A | 146 | Transcriptional regulator PA3341; MARR, transcript | 95.66 | |
| 2nyx_A | 168 | Probable transcriptional regulatory protein, RV14; | 95.64 | |
| 1i1g_A | 141 | Transcriptional regulator LRPA; helix-turn-helix, | 95.64 | |
| 2cfx_A | 144 | HTH-type transcriptional regulator LRPC; transcrip | 95.62 | |
| 3e6m_A | 161 | MARR family transcriptional regulator; APC88769, s | 95.62 | |
| 2fsw_A | 107 | PG_0823 protein; alpha-beta structure, helix-turn- | 95.61 | |
| 3f3x_A | 144 | Transcriptional regulator, MARR family, putative; | 95.59 | |
| 3b73_A | 111 | PHIH1 repressor-like protein; winged-helix-turn-he | 95.59 | |
| 3g3z_A | 145 | NMB1585, transcriptional regulator, MARR family; t | 95.56 | |
| 1ufm_A | 84 | COP9 complex subunit 4; helix-turn-helix, structur | 95.53 | |
| 3kp7_A | 151 | Transcriptional regulator TCAR; multiple drug resi | 95.5 | |
| 2fa5_A | 162 | Transcriptional regulator MARR/EMRR family; multip | 95.49 | |
| 3cdh_A | 155 | Transcriptional regulator, MARR family; helix-turn | 95.46 | |
| 2pex_A | 153 | Transcriptional regulator OHRR; transcription regu | 95.43 | |
| 4hbl_A | 149 | Transcriptional regulator, MARR family; HTH, trans | 95.4 | |
| 2f2e_A | 146 | PA1607; transcription factor, helix-TRUN-helix, AP | 95.35 | |
| 3fm5_A | 150 | Transcriptional regulator; MCSG, PF04017, PSI, MAR | 95.35 | |
| 2d1h_A | 109 | ST1889, 109AA long hypothetical transcriptional re | 95.33 | |
| 2b0l_A | 102 | GTP-sensing transcriptional pleiotropic repressor; | 95.33 | |
| 2frh_A | 127 | SARA, staphylococcal accessory regulator A; winged | 95.31 | |
| 3nqo_A | 189 | MARR-family transcriptional regulator; structural | 95.29 | |
| 3jw4_A | 148 | Transcriptional regulator, MARR/EMRR family; DNA-b | 95.29 | |
| 3bpv_A | 138 | Transcriptional regulator; MARR, DNA binding, tran | 95.28 | |
| 2ia0_A | 171 | Putative HTH-type transcriptional regulator PF086; | 95.26 | |
| 3ech_A | 142 | MEXR, multidrug resistance operon repressor; winge | 95.26 | |
| 3boq_A | 160 | Transcriptional regulator, MARR family; MARR famil | 95.25 | |
| 2zkz_A | 99 | Transcriptional repressor PAGR; protein-DNA, HTH m | 95.23 | |
| 1yyv_A | 131 | Putative transcriptional regulator; reductive meth | 95.19 | |
| 2qww_A | 154 | Transcriptional regulator, MARR family; YP_013417. | 95.04 | |
| 1qgp_A | 77 | Protein (double stranded RNA adenosine deaminase); | 95.02 | |
| 1z91_A | 147 | Organic hydroperoxide resistance transcriptional; | 94.94 | |
| 1on2_A | 142 | Transcriptional regulator MNTR; helix-turn-helix, | 94.94 | |
| 4ev0_A | 216 | Transcription regulator, CRP family; CAMP binding, | 94.85 | |
| 3u2r_A | 168 | Regulatory protein MARR; structural genomics, PSI- | 94.83 | |
| 3r0a_A | 123 | Putative transcriptional regulator; structural gen | 94.78 | |
| 3i4p_A | 162 | Transcriptional regulator, ASNC family; PSI, struc | 94.52 | |
| 1ku9_A | 152 | Hypothetical protein MJ223; putative transcription | 94.41 | |
| 2fxa_A | 207 | Protease production regulatory protein HPR; protea | 94.3 | |
| 2h09_A | 155 | Transcriptional regulator MNTR; transcription regu | 93.97 | |
| 4aik_A | 151 | Transcriptional regulator SLYA; transcription, tra | 93.94 | |
| 4b8x_A | 147 | SCO5413, possible MARR-transcriptional regulator; | 93.88 | |
| 2x4h_A | 139 | Hypothetical protein SSO2273; transcription; 2.30A | 93.85 | |
| 3dv8_A | 220 | Transcriptional regulator, CRP/FNR family; cyclic | 93.75 | |
| 1lva_A | 258 | Selenocysteine-specific elongation factor; winged- | 93.74 | |
| 3hrs_A | 214 | Metalloregulator SCAR; DTXR/MNTR family member, tr | 93.72 | |
| 3txn_A | 394 | 26S proteasome regulatory complex subunit P42B; PC | 93.38 | |
| 3tqn_A | 113 | Transcriptional regulator, GNTR family; regulatory | 93.06 | |
| 3d0s_A | 227 | Transcriptional regulatory protein; CAMP receptor | 93.03 | |
| 2zcw_A | 202 | TTHA1359, transcriptional regulator, FNR/CRP famil | 92.9 | |
| 2fbk_A | 181 | Transcriptional regulator, MARR family; winged-hel | 92.86 | |
| 3fx3_A | 237 | Cyclic nucleotide-binding protein; helix_TURN_heli | 92.73 | |
| 1j5y_A | 187 | Transcriptional regulator, biotin repressor famil; | 92.64 | |
| 1ft9_A | 222 | Carbon monoxide oxidation system transcription reg | 92.45 | |
| 2qq9_A | 226 | Diphtheria toxin repressor; regulator, DTXR, helix | 92.29 | |
| 3e6c_C | 250 | CPRK, cyclic nucleotide-binding protein; CPRK, hal | 92.23 | |
| 4b4t_R | 429 | RPN7, 26S proteasome regulatory subunit RPN7; hydr | 92.15 | |
| 1p4x_A | 250 | Staphylococcal accessory regulator A homologue; wi | 92.0 | |
| 4a5n_A | 131 | Uncharacterized HTH-type transcriptional regulato; | 91.91 | |
| 1sd4_A | 126 | Penicillinase repressor; BLAI, MECI, methicillin, | 91.9 | |
| 1okr_A | 123 | MECI, methicillin resistance regulatory protein ME | 91.78 | |
| 2bgc_A | 238 | PRFA; bacterial infection, human pathogen, transcr | 91.72 | |
| 3b02_A | 195 | Transcriptional regulator, CRP family; structural | 91.65 | |
| 3ic7_A | 126 | Putative transcriptional regulator; helix-turn-hel | 91.58 | |
| 3l7w_A | 108 | Putative uncharacterized protein SMU.1704; PADR, t | 91.49 | |
| 2gau_A | 232 | Transcriptional regulator, CRP/FNR family; structu | 91.42 | |
| 3e97_A | 231 | Transcriptional regulator, CRP/FNR family; YP_6044 | 91.3 | |
| 1qbj_A | 81 | Protein (double-stranded RNA specific adenosine D | 91.28 | |
| 1uly_A | 192 | Hypothetical protein PH1932; helix-turn-helix, str | 91.2 | |
| 2wte_A | 244 | CSA3; antiviral protein, viral resistance, winged | 91.14 | |
| 3cta_A | 230 | Riboflavin kinase; structural genomics, transferas | 91.04 | |
| 3iuo_A | 122 | ATP-dependent DNA helicase RECQ; C-terminal, GI PS | 90.86 | |
| 2v7f_A | 150 | RPS19, RPS19E SSU ribosomal protein S19E; diamond | 90.78 | |
| 4b4t_O | 393 | 26S proteasome regulatory subunit RPN9; hydrolase, | 90.68 | |
| 4b4t_Q | 434 | 26S proteasome regulatory subunit RPN6; hydrolase, | 90.58 | |
| 2co5_A | 99 | Viral protein F93; viral protein-winged helix comp | 90.54 | |
| 1y0u_A | 96 | Arsenical resistance operon repressor, putative; s | 90.38 | |
| 2esh_A | 118 | Conserved hypothetical protein TM0937; APC5794, st | 90.14 | |
| 1fx7_A | 230 | Iron-dependent repressor IDER; DTXR, iron-dependen | 90.07 | |
| 2v79_A | 135 | DNA replication protein DNAD; primosome, DNA-bindi | 90.03 | |
| 2fmy_A | 220 | COOA, carbon monoxide oxidation system transcripti | 90.0 | |
| 1oyi_A | 82 | Double-stranded RNA-binding protein; (alpha+beta) | 89.91 | |
| 4b4t_P | 445 | 26S proteasome regulatory subunit RPN5; hydrolase, | 89.8 | |
| 2jt1_A | 77 | PEFI protein; solution structure, winged helix-tur | 89.72 | |
| 3k2z_A | 196 | LEXA repressor; winged helix-turn-helix, SOS syste | 89.55 | |
| 4fx0_A | 148 | Probable transcriptional repressor protein; helix- | 89.46 | |
| 3neu_A | 125 | LIN1836 protein; structural genomics, PSI-2, prote | 89.08 | |
| 1xn7_A | 78 | Hypothetical protein YHGG; alpha+beta, GFT structu | 89.01 | |
| 2g9w_A | 138 | Conserved hypothetical protein; DNA-binding domain | 88.95 | |
| 2ba3_A | 51 | NIKA; dimer, bacterial conjugation, relaxase, DNA | 88.89 | |
| 2dk8_A | 81 | DNA-directed RNA polymerase III 39 kDa polypeptide | 88.7 | |
| 2k9i_A | 55 | Plasmid PRN1, complete sequence; plasmid COPY cont | 88.44 | |
| 2k02_A | 87 | Ferrous iron transport protein C; FEOC, iron-sulfu | 87.79 | |
| 3ihu_A | 222 | Transcriptional regulator, GNTR family; YP_298823. | 87.64 | |
| 1hsj_A | 487 | Fusion protein consisting of staphylococcus access | 87.39 | |
| 3lmm_A | 583 | Uncharacterized protein; multi-domained alpha-beta | 87.34 | |
| 1xmk_A | 79 | Double-stranded RNA-specific adenosine deaminase; | 87.15 | |
| 2hs5_A | 239 | Putative transcriptional regulator GNTR; APC6050, | 86.95 | |
| 1bia_A | 321 | BIRA bifunctional protein; transcription regulatio | 86.43 | |
| 2fu4_A | 83 | Ferric uptake regulation protein; DNA binding doma | 86.31 | |
| 3by6_A | 126 | Predicted transcriptional regulator; structural ge | 86.24 | |
| 3la7_A | 243 | Global nitrogen regulator; activator, DNA-binding, | 86.05 | |
| 3hhh_A | 116 | Transcriptional regulator, PADR family; PF03551, s | 85.77 | |
| 4ham_A | 134 | LMO2241 protein; structural genomics, PSI-biology, | 85.68 | |
| 2vn2_A | 128 | DNAD, chromosome replication initiation protein; D | 85.45 | |
| 4esf_A | 117 | PADR-like transcriptional regulator; PADR family, | 85.39 | |
| 1xma_A | 145 | Predicted transcriptional regulator; southea colla | 84.93 | |
| 1mkm_A | 249 | ICLR transcriptional regulator; structural genomic | 84.81 | |
| 2gqq_A | 163 | Leucine-responsive regulatory protein; helix-turn- | 84.32 | |
| 1yg2_A | 179 | Gene activator APHA; virulence factor, winged heli | 84.1 | |
| 3tdu_C | 77 | Cullin-1, CUL-1; E2:E3, ligase-protein binding com | 83.9 | |
| 3ri2_A | 123 | Transcriptional regulator, PADR-like family; PSI-b | 83.72 | |
| 3f8m_A | 248 | GNTR-family protein transcriptional regulator; PHN | 83.35 | |
| 1iuy_A | 92 | Cullin-3 homologue; winged helix, structural genom | 82.75 | |
| 2xvc_A | 59 | ESCRT-III, SSO0910; cell cycle, cell division, cyt | 82.44 | |
| 3rkx_A | 323 | Biotin-[acetyl-COA-carboxylase] ligase; biotin pro | 82.42 | |
| 1pdn_C | 128 | Protein (PRD paired); protein-DNA complex, double | 81.74 | |
| 3ryp_A | 210 | Catabolite gene activator; CAMP receptor protein ( | 81.59 | |
| 1hw1_A | 239 | FADR, fatty acid metabolism regulator protein; hel | 81.5 | |
| 1p4x_A | 250 | Staphylococcal accessory regulator A homologue; wi | 81.24 | |
| 3o2p_E | 88 | Cell division control protein 53; ligase, cell cyc | 80.72 | |
| 2cpg_A | 45 | REPA protein, transcriptional repressor COPG; DNA- | 80.32 | |
| 2ek5_A | 129 | Predicted transcriptional regulators; helix-turn-h | 80.06 | |
| 2p4w_A | 202 | Transcriptional regulatory protein ARSR family; ar | 80.03 |
| >1wi9_A Protein C20ORF116 homolog; helix-turn-helix motif, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: a.4.5.47 | Back alignment and structure |
|---|
Probab=99.94 E-value=4.1e-28 Score=160.89 Aligned_cols=48 Identities=54% Similarity=0.832 Sum_probs=46.3
Q ss_pred ChhhhhhhCCChHHHHHHHHHHHHcCCccEEeeCCCceEEEcHHHHHH
Q psy11008 1 MEDLAALFRMKTQSVIDRIVELQKTGALTGVIDDRGKFIYISQEELNS 48 (96)
Q Consensus 1 ledLAa~F~lktq~vI~RI~eL~~~g~ltGViDDRGKfIyIs~eEl~~ 48 (96)
|||||++|||+||+||+||++|+++|+|||||||||||||||++||++
T Consensus 24 LedLA~~F~l~t~~~i~RI~~Le~~g~ltGViDDRGKfIyIs~eE~~a 71 (72)
T 1wi9_A 24 LEDLAFQMGLRTQDAINRIQDLLTEGTLTGVIDDRGKFIYITPSGPSS 71 (72)
T ss_dssp HHHHHHHHCSCHHHHHHHHHHHHHHSSSCEEECTTCCEEECCCSSCCC
T ss_pred HHHHHHHhCCChHHHHHHHHHHHHCCCeEEEEeCCCCEEEecHHHhhc
Confidence 589999999999999999999999999999999999999999999864
|
| >1ub9_A Hypothetical protein PH1061; helix-turn-helix motif, winged helix motif, structural genom transcription; 2.05A {Pyrococcus horikoshii} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >3cuo_A Uncharacterized HTH-type transcriptional regulato; DNA-binding transcriptional regulator, structural genomics, MCSG; 2.00A {Escherichia coli K12} | Back alignment and structure |
|---|
| >2kko_A Possible transcriptional regulatory protein (possibly ARSR-family); NESG, DNA-binding, transcription regulation, WHTH, homodimer; NMR {Mycobacterium bovis} PDB: 3gw2_A | Back alignment and structure |
|---|
| >3jth_A Transcription activator HLYU; transcription factor, RTXA, DNA-binding, transcription regulation; 2.00A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >3f6v_A Possible transcriptional regulator, ARSR family protein; probable transcriptional repressor ARSR family, structural genomics, PSI-2; 1.48A {Rhodococcus SP} | Back alignment and structure |
|---|
| >3f6o_A Probable transcriptional regulator, ARSR family protein; transcriptional regulator,RHA00566,MCSG, structural genomics, PSI-2; 1.90A {Rhodococcus SP} | Back alignment and structure |
|---|
| >2oqg_A Possible transcriptional regulator, ARSR family P; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 1.54A {Rhodococcus SP} | Back alignment and structure |
|---|
| >1r1u_A CZRA, repressor protein; zinc, DNA binding, transcriptional regulation, winged HTH protein, transcription repressor; 2.00A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 1r1v_A 2kjb_A 2kjc_A | Back alignment and structure |
|---|
| >3pqk_A Biofilm growth-associated repressor; helix-turn-helix motif, winged-helix fold, transcriptional R DNA binding, transcription; 2.09A {Xylella fastidiosa} PDB: 3pqj_A | Back alignment and structure |
|---|
| >1tbx_A ORF F-93, hypothetical 11.0 kDa protein; sulfolobus spindle virus, winged helix, fusellovirus; 2.70A {Sulfolobus virus 1} SCOP: a.4.5.48 | Back alignment and structure |
|---|
| >1u2w_A CADC repressor, cadmium efflux system accessory protein; LEAD, SOFT metal ION resistance, ARSR/SM family, DNA binding protein; 1.90A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 3f72_A | Back alignment and structure |
|---|
| >2cg4_A Regulatory protein ASNC; DNA binding, FFRP, LRP family, transcription, DNA- binding, transcription regulation; 2.4A {Escherichia coli} SCOP: a.4.5.32 d.58.4.2 | Back alignment and structure |
|---|
| >2pn6_A ST1022, 150AA long hypothetical transcriptional regulator; LRP/ASNC family Gln binding, structural genomics, NPPSFA; HET: GLN; 1.44A {Sulfolobus tokodaii} PDB: 2efn_A* 2e7x_A* 2e7w_A* 2yx4_A* 2efq_A* 2pmh_A* 2yx7_A* 2efp_A* 2efo_A* | Back alignment and structure |
|---|
| >2qvo_A Uncharacterized protein AF_1382; PSI, structural genomics, southeast collaboratory for structural genomics; 1.85A {Archaeoglobus fulgidus dsm 4304} PDB: 3o3k_A 3ov8_A | Back alignment and structure |
|---|
| >3df8_A Possible HXLR family transcriptional factor; APC89000, structural genomics, midwest center for structural genomics, MCSG; 1.65A {Thermoplasma volcanium} SCOP: a.4.5.0 | Back alignment and structure |
|---|
| >3tgn_A ADC operon repressor ADCR; helix-turn-helix, transcriptional regulator, transcription; 2.00A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >2hzt_A Putative HTH-type transcriptional regulator YTCD; DNA-binding protein, HTH-type transcription regulators, structural genomics, PSI-2; HET: CSU MSE; 2.00A {Bacillus subtilis} SCOP: a.4.5.69 | Back alignment and structure |
|---|
| >1q1h_A TFE, transcription factor E, TFE; TFIIE, transcription initiation, preinitiation complex, RNA polymerase II, transcription bubble; 2.90A {Sulfolobus solfataricus} SCOP: a.4.5.41 | Back alignment and structure |
|---|
| >2hr3_A Probable transcriptional regulator; MCSG, structural genomics, PSI-2, protein structure initiati midwest center for structural genomics; 2.40A {Pseudomonas aeruginosa} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >3oop_A LIN2960 protein; protein structure initiative, PSI-2, structural genomics, MI center for structural genomics, MCSG, unknown function; 1.78A {Listeria innocua} | Back alignment and structure |
|---|
| >1lj9_A Transcriptional regulator SLYA; HTH DNA binding protein, structural genomics, PSI, protein structure initiative; 1.60A {Enterococcus faecalis} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >1r1t_A Transcriptional repressor SMTB; zinc, transcriptional regulation, winged HTH protein, DNA binding, transcription repressor; 1.70A {Synechococcus elongatus pcc 7942} SCOP: a.4.5.5 PDB: 1r23_A 1smt_A 1r22_A | Back alignment and structure |
|---|
| >2dbb_A Putative HTH-type transcriptional regulator PH006; ASNC family, helix-turn-helix (HTH) domain, structural genom NPPSFA; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2pjp_A Selenocysteine-specific elongation factor; SELB, protein-RNA complex, elongation factor, winged- helix, bulge, translation/RNA complex; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >3eco_A MEPR; mutlidrug efflux pump regulator winged helix-turn-helix motif, DNA-binding, transcription, transcription regulation; 2.40A {Staphylococcus aureus} SCOP: a.4.5.0 | Back alignment and structure |
|---|
| >3s2w_A Transcriptional regulator, MARR family; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 2.45A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >1sfx_A Conserved hypothetical protein AF2008; structural genomics, HTH MOT protein structure initiative, midwest center for structural genomics; 1.55A {Archaeoglobus fulgidus} SCOP: a.4.5.50 | Back alignment and structure |
|---|
| >1jgs_A Multiple antibiotic resistance protein MARR; transcription regulation, DNA-binding, repressor, transcription; HET: SAL; 2.30A {Escherichia coli} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >2heo_A Z-DNA binding protein 1; protein DLM1-Z-DNA complex, immune system-DNA complex; 1.70A {Mus musculus} PDB: 1j75_A | Back alignment and structure |
|---|
| >2p5v_A Transcriptional regulator, LRP/ASNC family; NMB0573, structu genomics; 1.99A {Neisseria meningitidis} PDB: 2p6s_A 2p6t_A | Back alignment and structure |
|---|
| >3k0l_A Repressor protein; helix-turn-helix, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.35A {Acinetobacter SP} | Back alignment and structure |
|---|
| >2nnn_A Probable transcriptional regulator; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3bdd_A Regulatory protein MARR; putative multiple antibiotic-resistance repressor, structura genomics, joint center for structural genomics, JCSG; 2.20A {Streptococcus suis} | Back alignment and structure |
|---|
| >2lkp_A Transcriptional regulator, ARSR family; symmetric homodimer, NI(II) binding protein, DNA binding Pro transcription regulator; NMR {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3cjn_A Transcriptional regulator, MARR family; silicibacter pomeroy structural genomics, PSI-2, protein structure initiative; 1.95A {Silicibacter pomeroyi dss-3} | Back alignment and structure |
|---|
| >3bja_A Transcriptional regulator, MARR family, putative; NP_978771.1, putative MARR-like transcription regulator, MAR structural genomics; 2.38A {Bacillus cereus} | Back alignment and structure |
|---|
| >2rdp_A Putative transcriptional regulator MARR; PFAM PF01047, winged-helix binding motif, structural genomics, PSI-2; 2.30A {Geobacillus stearothermophilus} | Back alignment and structure |
|---|
| >2eth_A Transcriptional regulator, putative, MAR family; MARR family, structural genomics, joint center for structura genomics, JCSG; 2.30A {Thermotoga maritima} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >3bj6_A Transcriptional regulator, MARR family; helix-turn-helix, trasnscription regulator, STR genomics, PSI-2, protein structure initiative; 2.01A {Silicibacter pomeroyi dss-3} | Back alignment and structure |
|---|
| >2bv6_A MGRA, HTH-type transcriptional regulator MGRA; multidrug resistance regulator, virulence determinant, transcriptional factors; 2.8A {Staphylococcus aureus} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >2w25_A Probable transcriptional regulatory protein; transcription regulation, mutant, RV3291C, Glu104Ala, DNA-binding; 2.15A {Mycobacterium tuberculosis} PDB: 2vbw_A* 2vbx_A* 2vby_A* 2vbz_A* 2vc0_A 2vc1_A 2w24_A 2ivm_A 2w29_A 2qz8_A | Back alignment and structure |
|---|
| >3bro_A Transcriptional regulator; helix_TURN_helix, multiple antibiotic resistance protein (MA structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.04A {Oenococcus oeni} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >2fbi_A Probable transcriptional regulator; MARR, APC5816, structural genomic protein structure initiative; 2.10A {Pseudomonas aeruginosa} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >2gxg_A 146AA long hypothetical transcriptional regulator; winged helix; 1.45A {Sulfolobus tokodaii} PDB: 2eb7_A 2yr2_A 3gez_A 3gf2_A* 3gfi_A 3gfm_A 3gfj_A 3gfl_A | Back alignment and structure |
|---|
| >3hsr_A HTH-type transcriptional regulator SARZ; helix-turn-helix, cysteine disulfide, MARR-family transcript regulator, DNA-binding; 1.90A {Staphylococcus aureus subsp} PDB: 3hse_A 3hrm_A 4gxo_A | Back alignment and structure |
|---|
| >2a61_A Transcriptional regulator TM0710; APC4350, MCSG, midwest center for structural genomics, PSI, protein structure initiative, MARR; 1.80A {Thermotoga maritima} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >2htj_A P fimbrial regulatory protein KS71A; winged helix-turn-helix, PAP PILI, transcription activator; NMR {Escherichia coli} SCOP: a.4.5.73 | Back alignment and structure |
|---|
| >1s3j_A YUSO protein; structural genomics, MARR transcriptional regulator family, PSI, protein structure initiative; HET: MSE; 2.25A {Bacillus subtilis} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >1z7u_A Hypothetical protein EF0647; winged-helix-turn-helix, MARR, structural genomics, PSI, Pro structure initiative; 2.20A {Enterococcus faecalis} SCOP: a.4.5.69 | Back alignment and structure |
|---|
| >2pg4_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, DNA binding protein; HET: MSE CIT; 2.21A {Aeropyrum pernix} SCOP: a.4.5.48 | Back alignment and structure |
|---|
| >3nrv_A Putative transcriptional regulator (MARR/EMRR FAM; PSI-2, protein structure initiati structural genomics; HET: MSE; 2.00A {Acinetobacter SP} | Back alignment and structure |
|---|
| >2cyy_A Putative HTH-type transcriptional regulator PH151; structural genomics, pyrococcus horikosii OT3, NPPSFA; HET: MSE GLN; 1.80A {Pyrococcus horikoshii} SCOP: a.4.5.32 d.58.4.2 | Back alignment and structure |
|---|
| >3deu_A Transcriptional regulator SLYA; MARR, WING-helix, transcription regulator, activator, DNA-binding, repressor; HET: SAL; 2.30A {Salmonella typhimurium} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >2fbh_A Transcriptional regulator PA3341; MARR, transcription regulator, APC5857, structural genomics, protein structure initiative; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >2nyx_A Probable transcriptional regulatory protein, RV14; alpha/beta, structural genomics, PSI-2; 2.30A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1i1g_A Transcriptional regulator LRPA; helix-turn-helix, LRP/ASNC family; 2.90A {Pyrococcus furiosus} SCOP: a.4.5.32 d.58.4.2 | Back alignment and structure |
|---|
| >2cfx_A HTH-type transcriptional regulator LRPC; transcriptional regulation, DNA binding, FFRP; 2.4A {Bacillus subtilis} SCOP: a.4.5.32 d.58.4.2 | Back alignment and structure |
|---|
| >3e6m_A MARR family transcriptional regulator; APC88769, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; 2.20A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >2fsw_A PG_0823 protein; alpha-beta structure, helix-turn-helix, winged-helix-turn-HE structural genomics, PSI, protein structure initiative; HET: MSE; 2.16A {Porphyromonas gingivalis} SCOP: a.4.5.69 | Back alignment and structure |
|---|
| >3f3x_A Transcriptional regulator, MARR family, putative; DNA binding protein, DNA-binding, transcription regulation; 1.90A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3b73_A PHIH1 repressor-like protein; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 2.12A {Haloarcula marismortui atcc 43049} | Back alignment and structure |
|---|
| >3g3z_A NMB1585, transcriptional regulator, MARR family; transcription factor, structur genomics, oxford protein production facility; 2.10A {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >1ufm_A COP9 complex subunit 4; helix-turn-helix, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: a.4.5.47 | Back alignment and structure |
|---|
| >3kp7_A Transcriptional regulator TCAR; multiple drug resistance, biofilm, transcription regulation, binding, transcription regulator; 2.30A {Staphylococcus epidermidis RP62A} PDB: 3kp3_A* 3kp4_A* 3kp5_A* 3kp2_A* 3kp6_A | Back alignment and structure |
|---|
| >2fa5_A Transcriptional regulator MARR/EMRR family; multiple antibiotics resistance repressor, XCC structural genomics, X-RAY diffraction; 1.80A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >3cdh_A Transcriptional regulator, MARR family; helix-turn-hleix, structura genomics, PSI-2, protein structure initiative; 2.69A {Silicibacter pomeroyi dss-3} | Back alignment and structure |
|---|
| >2pex_A Transcriptional regulator OHRR; transcription regulator; 1.90A {Xanthomonas campestris} PDB: 2pfb_A | Back alignment and structure |
|---|
| >4hbl_A Transcriptional regulator, MARR family; HTH, transcription factor, DNA binding; 2.50A {Staphylococcus epidermidis} | Back alignment and structure |
|---|
| >2f2e_A PA1607; transcription factor, helix-TRUN-helix, APC5613, structural genomics, PSI, protein structure initiative; HET: GLC; 1.85A {Pseudomonas aeruginosa} SCOP: a.4.5.69 | Back alignment and structure |
|---|
| >3fm5_A Transcriptional regulator; MCSG, PF04017, PSI, MARR, structu genomics, protein structure initiative, midwest center for structural genomics; HET: GOL; 2.00A {Rhodococcus jostii} | Back alignment and structure |
|---|
| >2d1h_A ST1889, 109AA long hypothetical transcriptional regulator; helix-turn-helix, intermolecular and intramolecular S-S bond structural genomics; 2.05A {Sulfolobus tokodaii} SCOP: a.4.5.50 | Back alignment and structure |
|---|
| >2b0l_A GTP-sensing transcriptional pleiotropic repressor; CODY, DNA-binding, nucleotide-binding, transcript regulation, winged HTH motif.; 2.90A {Bacillus subtilis} SCOP: a.4.5.66 | Back alignment and structure |
|---|
| >2frh_A SARA, staphylococcal accessory regulator A; winged-helix protein, divalent metal binding, transcription; 2.50A {Staphylococcus aureus} SCOP: a.4.5.28 PDB: 2fnp_A 1fzp_D | Back alignment and structure |
|---|
| >3nqo_A MARR-family transcriptional regulator; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE PG4; 2.20A {Clostridium difficile} | Back alignment and structure |
|---|
| >3jw4_A Transcriptional regulator, MARR/EMRR family; DNA-binding protein, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.10A {Clostridium acetobutylicum} SCOP: a.4.5.0 | Back alignment and structure |
|---|
| >3bpv_A Transcriptional regulator; MARR, DNA binding, transcription factor, winged helix motif, DNA-binding; 1.40A {Methanobacterium thermoautotrophicum} PDB: 3bpx_A* | Back alignment and structure |
|---|
| >2ia0_A Putative HTH-type transcriptional regulator PF086; ASNC, PSI, structural genomics, southeast collaboratory for structural genomics; 2.37A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3ech_A MEXR, multidrug resistance operon repressor; winged helix, helix-turn-helix, protein-peptide complex; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.28 PDB: 1lnw_A 3mex_A | Back alignment and structure |
|---|
| >3boq_A Transcriptional regulator, MARR family; MARR famil structural genomics, PSI-2, protein structure initiative; 2.39A {Silicibacter pomeroyi dss-3} | Back alignment and structure |
|---|
| >2zkz_A Transcriptional repressor PAGR; protein-DNA, HTH motif, dimer, DN binding, transcription regulation; 2.00A {Bacillus anthracis} | Back alignment and structure |
|---|
| >1yyv_A Putative transcriptional regulator; reductive methylation, D lysine, structural genomics, PSI; HET: MLY; 2.35A {Salmonella typhimurium} SCOP: a.4.5.69 | Back alignment and structure |
|---|
| >2qww_A Transcriptional regulator, MARR family; YP_013417.1, multiple antibiotic-resistance repressor (MARR) structural genomics; HET: MSE; 2.07A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >1qgp_A Protein (double stranded RNA adenosine deaminase); Z-alpha-Z-DNA binding domain, RNA-editing, Z-DNA recognition, ADAR1, helix- turn-helix; NMR {Homo sapiens} SCOP: a.4.5.19 | Back alignment and structure |
|---|
| >1z91_A Organic hydroperoxide resistance transcriptional; OHRR, MARR family, bacterial transcription factor, DNA bindi protein; 2.50A {Bacillus subtilis} SCOP: a.4.5.28 PDB: 1z9c_A* | Back alignment and structure |
|---|
| >1on2_A Transcriptional regulator MNTR; helix-turn-helix, DNA-binding protein, metalloregulatory protein; 1.61A {Bacillus subtilis} SCOP: a.4.5.24 a.76.1.1 PDB: 2ev0_A 1on1_A 2ev5_A 2ev6_A* 2f5c_A 2f5d_A 2f5e_A 2f5f_A 2hyf_A* 2hyg_D 3r60_A* 3r61_A* | Back alignment and structure |
|---|
| >4ev0_A Transcription regulator, CRP family; CAMP binding, winged helix-turn-helix motif, DNA binding, transcription activator; HET: CMP; 2.40A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3u2r_A Regulatory protein MARR; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, helix-turn-helix; 2.20A {Planctomyces limnophilus} | Back alignment and structure |
|---|
| >3r0a_A Putative transcriptional regulator; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.31A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3i4p_A Transcriptional regulator, ASNC family; PSI, structural genom protein structure initiative, midwest center for structural genomics; 2.30A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >1ku9_A Hypothetical protein MJ223; putative transcription factor, homodimeric winged-helix fold, structural genomics, PSI; 2.80A {Methanocaldococcus jannaschii} SCOP: a.4.5.36 | Back alignment and structure |
|---|
| >2fxa_A Protease production regulatory protein HPR; protease porduction, regulation, STR genomics, PSI, protein structure initiative; HET: PGE P6G 1PE; 2.40A {Bacillus subtilis} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >2h09_A Transcriptional regulator MNTR; transcription regulator, diphtheria toxin, manganese transport, structural genomics, NPPSFA; 2.10A {Escherichia coli} | Back alignment and structure |
|---|
| >4aik_A Transcriptional regulator SLYA; transcription, transcription factor; 1.85A {Yersinia pseudotuberculosis} PDB: 4aih_A 4aij_A 3qpt_A* 3q5f_A* | Back alignment and structure |
|---|
| >4b8x_A SCO5413, possible MARR-transcriptional regulator; winged helix motif; HET: CME; 1.25A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >2x4h_A Hypothetical protein SSO2273; transcription; 2.30A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3dv8_A Transcriptional regulator, CRP/FNR family; cyclic nucleotide-binding domain, structural genomics, joint for structural genomics; 2.55A {Eubacterium rectale atcc 33656} | Back alignment and structure |
|---|
| >1lva_A Selenocysteine-specific elongation factor; winged-helix, translation; 2.12A {Moorella thermoacetica} SCOP: a.4.5.35 a.4.5.35 a.4.5.35 a.4.5.35 PDB: 2uwm_A 2ply_A 1wsu_A | Back alignment and structure |
|---|
| >3hrs_A Metalloregulator SCAR; DTXR/MNTR family member, transcription; 2.70A {Streptococcus gordonii} PDB: 3hrt_A 3hru_A | Back alignment and structure |
|---|
| >3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A | Back alignment and structure |
|---|
| >3tqn_A Transcriptional regulator, GNTR family; regulatory functions; 2.80A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3d0s_A Transcriptional regulatory protein; CAMP receptor protein (CRP), dimer, inactive(APO, unliganded allostery, DNA binding, cyclic AMP; 2.00A {Mycobacterium tuberculosis} PDB: 3i54_A* 3i59_A* 3mzh_A* 3h3u_A* 3r6s_A* | Back alignment and structure |
|---|
| >2zcw_A TTHA1359, transcriptional regulator, FNR/CRP family; stationary phase, DNA-binding, transcription regulation; 1.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2fbk_A Transcriptional regulator, MARR family; winged-helix-turn-helix; 2.30A {Deinococcus radiodurans} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >3fx3_A Cyclic nucleotide-binding protein; helix_TURN_helix, CAMP regulatory protein, structural genomi 2, protein structure initiative; 2.20A {Ruegeria pomeroyi} PDB: 3h3z_A* | Back alignment and structure |
|---|
| >1j5y_A Transcriptional regulator, biotin repressor famil; structural genomics, TM1602, BIOT repressor family, JCSG, conserved hypothetical protein; 2.30A {Thermotoga maritima} SCOP: a.4.5.1 d.94.2.1 | Back alignment and structure |
|---|
| >1ft9_A Carbon monoxide oxidation system transcription regulator; heme sensor, catabolite gene activator protein; HET: HEM; 2.60A {Rhodospirillum rubrum} SCOP: a.4.5.4 b.82.3.1 | Back alignment and structure |
|---|
| >2qq9_A Diphtheria toxin repressor; regulator, DTXR, helix-turn-helix, metal ION, ACT DNA-binding, ferrous iron, transcription; 1.71A {Corynebacterium diphtheriae} PDB: 2tdx_A 1ddn_A 1g3t_A 1g3s_A 1g3w_A 2qqa_A 2qqb_A 2dtr_A 1bi0_A 1bi2_A 1bi3_A 1dpr_A 1bi1_A 1fwz_A 1g3y_A 1c0w_A* 3glx_A 1p92_A 1xcv_A 1f5t_A ... | Back alignment and structure |
|---|
| >3e6c_C CPRK, cyclic nucleotide-binding protein; CPRK, halorespiration; HET: DNA 3C4; 1.80A {Desulfitobacterium hafniense} SCOP: a.4.5.4 b.82.3.2 PDB: 3e6b_A* 3e5u_C* 3e6d_A 3e5x_A* 3e5q_A 2h6b_A* 2h6c_A | Back alignment and structure |
|---|
| >4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1p4x_A Staphylococcal accessory regulator A homologue; winged-helix protein, transcription; 2.20A {Staphylococcus aureus} SCOP: a.4.5.28 a.4.5.28 | Back alignment and structure |
|---|
| >4a5n_A Uncharacterized HTH-type transcriptional regulato; activator, DNA binding, MARR-like; 1.81A {Bacillus subtilis} PDB: 4a5m_A | Back alignment and structure |
|---|
| >1sd4_A Penicillinase repressor; BLAI, MECI, methicillin, B-lactam, DNA binding PR; 2.00A {Staphylococcus aureus} SCOP: a.4.5.39 PDB: 1xsd_A | Back alignment and structure |
|---|
| >1okr_A MECI, methicillin resistance regulatory protein MECI; bacterial antibiotic resistance, MECI protein, transcriptional regulatory element; 2.4A {Staphylococcus aureus} SCOP: a.4.5.39 PDB: 1sax_A 1sd7_A 2d45_A 1sd6_A | Back alignment and structure |
|---|
| >2bgc_A PRFA; bacterial infection, human pathogen, transcriptional regulat transcription; HET: PR3; 2.3A {Listeria monocytogenes} SCOP: a.4.5.4 b.82.3.3 PDB: 2beo_A* 1omi_A | Back alignment and structure |
|---|
| >3b02_A Transcriptional regulator, CRP family; structural genomics, riken structural genomics/proteomics in RSGI; 1.92A {Thermus thermophilus} PDB: 2zdb_A | Back alignment and structure |
|---|
| >3ic7_A Putative transcriptional regulator; helix-turn-helix, structural genomics, PSI-2, protein struct initiative; 2.82A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3l7w_A Putative uncharacterized protein SMU.1704; PADR, transcriptional factor, transcription; HET: MSE; 2.20A {Streptococcus mutans} SCOP: a.4.5.0 | Back alignment and structure |
|---|
| >2gau_A Transcriptional regulator, CRP/FNR family; structural genomics, porphyromona gingivalis, PSI, protein structure initiative; 1.90A {Porphyromonas gingivalis} SCOP: a.4.5.4 b.82.3.2 | Back alignment and structure |
|---|
| >3e97_A Transcriptional regulator, CRP/FNR family; YP_604437.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.86A {Deinococcus geothermalis dsm 11300} | Back alignment and structure |
|---|
| >1qbj_A Protein (double-stranded RNA specific adenosine D (ADAR1)); protein-Z-DNA complex, hydrolase-DNA complex; HET: DNA; 2.10A {Homo sapiens} SCOP: a.4.5.19 PDB: 3f21_A* 3f22_A* 3f23_A* 3irr_A* 3irq_D* 2gxb_A 2acj_A 2l54_A | Back alignment and structure |
|---|
| >1uly_A Hypothetical protein PH1932; helix-turn-helix, structural genomics, DNA binding protein; 2.50A {Pyrococcus horikoshii} SCOP: a.4.5.58 PDB: 2cwe_A | Back alignment and structure |
|---|
| >2wte_A CSA3; antiviral protein, viral resistance, winged helix-turn-helix prnai nucleotide-binding domain; HET: MSE; 1.80A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3cta_A Riboflavin kinase; structural genomics, transferase, PSI-2, protein structure initiative; 2.20A {Thermoplasma acidophilum dsm 1728} SCOP: a.4.5.28 b.43.5.2 | Back alignment and structure |
|---|
| >3iuo_A ATP-dependent DNA helicase RECQ; C-terminal, GI PSI, MCSG, structural genomics, midwest center for structur genomics; 1.60A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >2v7f_A RPS19, RPS19E SSU ribosomal protein S19E; diamond blackfan anemia small ribosomal subunit; 1.15A {Pyrococcus abyssi} SCOP: a.4.5.84 | Back alignment and structure |
|---|
| >4b4t_O 26S proteasome regulatory subunit RPN9; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2co5_A Viral protein F93; viral protein-winged helix complex, winged helix, DNA-bindin WHTH, disulfide bond, STIV; 2.2A {Sulfolobus turreted icosahedral virus} SCOP: a.4.5.48 | Back alignment and structure |
|---|
| >1y0u_A Arsenical resistance operon repressor, putative; structural genomics, protein structure initiative, PSI; HET: MSE; 1.60A {Archaeoglobus fulgidus} SCOP: a.4.5.5 | Back alignment and structure |
|---|
| >2esh_A Conserved hypothetical protein TM0937; APC5794, structural genomics, PSI, protein structure initiative; 2.30A {Thermotoga maritima} SCOP: a.4.5.61 | Back alignment and structure |
|---|
| >1fx7_A Iron-dependent repressor IDER; DTXR, iron-dependent regulator, signaling protein; 2.00A {Mycobacterium tuberculosis} SCOP: a.4.5.24 a.76.1.1 b.34.1.2 PDB: 1u8r_A | Back alignment and structure |
|---|
| >2v79_A DNA replication protein DNAD; primosome, DNA-binding protein; HET: DNA; 2.00A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2fmy_A COOA, carbon monoxide oxidation system transcription RE COOA-1; DNA transcription regulator, DNA binding protein; HET: HEM; 2.20A {Carboxydothermus hydrogenoformans} PDB: 2hkx_A* | Back alignment and structure |
|---|
| >1oyi_A Double-stranded RNA-binding protein; (alpha+beta) helix-turn-helix, viral protein; NMR {Vaccinia virus} SCOP: a.4.5.19 | Back alignment and structure |
|---|
| >4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2jt1_A PEFI protein; solution structure, winged helix-turn-helix, transcripti regulatory protein, structural genomics, PSI-2; NMR {Salmonella typhimurium LT2} | Back alignment and structure |
|---|
| >3k2z_A LEXA repressor; winged helix-turn-helix, SOS system, autoca cleavage, DNA damage, DNA repair, DNA replication, DNA-BIND hydrolase; 1.37A {Thermotoga maritima} | Back alignment and structure |
|---|
| >4fx0_A Probable transcriptional repressor protein; helix-turn-helix, DNA binding, transcription regulator; 2.70A {Mycobacterium tuberculosis} PDB: 4fx4_A* | Back alignment and structure |
|---|
| >3neu_A LIN1836 protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, unknown function; 1.58A {Listeria innocua} | Back alignment and structure |
|---|
| >1xn7_A Hypothetical protein YHGG; alpha+beta, GFT structural genomics, protein structure initiative, PSI, NESG; NMR {Escherichia coli} SCOP: a.4.5.62 | Back alignment and structure |
|---|
| >2g9w_A Conserved hypothetical protein; DNA-binding domain, bacterial transcription repressor, DNA B protein; 1.80A {Mycobacterium tuberculosis} SCOP: a.4.5.39 | Back alignment and structure |
|---|
| >2ba3_A NIKA; dimer, bacterial conjugation, relaxase, DNA binding, ribbon- helix-helix, DNA binding protein; NMR {Plasmid R64} | Back alignment and structure |
|---|
| >2dk8_A DNA-directed RNA polymerase III 39 kDa polypeptide; structural genomics, RNA_POL_RPC34 domain, RNA polymerase III C39 subunit, NPPSFA; NMR {Mus musculus} SCOP: a.4.5.85 | Back alignment and structure |
|---|
| >2k9i_A Plasmid PRN1, complete sequence; plasmid COPY control protein, ribbon helix helix protein, DNA binding protein; NMR {Sulfolobus islandicus} PDB: 3ft7_A | Back alignment and structure |
|---|
| >2k02_A Ferrous iron transport protein C; FEOC, iron-sulfur, metal-binding, metal binding protein; NMR {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3ihu_A Transcriptional regulator, GNTR family; YP_298823.1, DNA binding protein, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.92A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >1hsj_A Fusion protein consisting of staphylococcus accessary regulator protein R and maltose...; novel fold for DNA binding; HET: GLC; 2.30A {Escherichia coli} SCOP: a.4.5.28 c.94.1.1 | Back alignment and structure |
|---|
| >3lmm_A Uncharacterized protein; multi-domained alpha-beta protein, structural genomics, PSI- 2, protein structure initiative; 3.00A {Corynebacterium diphtheriae} | Back alignment and structure |
|---|
| >1xmk_A Double-stranded RNA-specific adenosine deaminase; winged helix-turn-helix, RNA editing, interferon, ADAR1, hydrolase; 0.97A {Homo sapiens} SCOP: a.4.5.19 | Back alignment and structure |
|---|
| >2hs5_A Putative transcriptional regulator GNTR; APC6050, rhodococcus SP. RH structural genomics, PSI-2, protein structure initiative; 2.20A {Rhodococcus SP} SCOP: a.4.5.6 a.78.1.1 | Back alignment and structure |
|---|
| >1bia_A BIRA bifunctional protein; transcription regulation; 2.30A {Escherichia coli} SCOP: a.4.5.1 b.34.1.1 d.104.1.2 PDB: 1bib_A* 1hxd_A* 2ewn_A* | Back alignment and structure |
|---|
| >2fu4_A Ferric uptake regulation protein; DNA binding domain, helix-turn-helix, DNA binding protein; 1.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3by6_A Predicted transcriptional regulator; structural genomics, PSI-2, MCSG, structure initiative, midwest center for structural genomic binding; 2.20A {Oenococcus oeni} | Back alignment and structure |
|---|
| >3la7_A Global nitrogen regulator; activator, DNA-binding, transcription, transcription regulation; HET: BOG; 1.90A {Anabaena} PDB: 3la2_A* 3la3_A* 2xko_A* 2xgx_A* 2xhk_A* 2xkp_A* | Back alignment and structure |
|---|
| >3hhh_A Transcriptional regulator, PADR family; PF03551, structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 2.70A {Enterococcus faecalis} SCOP: a.4.5.0 | Back alignment and structure |
|---|
| >4ham_A LMO2241 protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, winged helix-turn-helix, four helix bundle; 1.91A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2vn2_A DNAD, chromosome replication initiation protein; DNA replication, primosome; 2.3A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >4esf_A PADR-like transcriptional regulator; PADR family, DNA binding protein, HTH fold; 2.20A {Bacillus cereus} | Back alignment and structure |
|---|
| >1xma_A Predicted transcriptional regulator; southea collaboratory for structural genomics, secsg, protein struc initiative, PSI; 2.30A {Clostridium thermocellum} SCOP: a.4.5.61 | Back alignment and structure |
|---|
| >1mkm_A ICLR transcriptional regulator; structural genomics, winged helix-turn-helix, PSI, protein structure initiative; 2.20A {Thermotoga maritima} SCOP: a.4.5.33 d.110.2.2 | Back alignment and structure |
|---|
| >2gqq_A Leucine-responsive regulatory protein; helix-turn-helix, transcription; 3.20A {Escherichia coli} PDB: 2l4a_A | Back alignment and structure |
|---|
| >1yg2_A Gene activator APHA; virulence factor, winged helix, transcripti factor, transcription; 2.20A {Vibrio cholerae} SCOP: a.4.5.61 | Back alignment and structure |
|---|
| >3tdu_C Cullin-1, CUL-1; E2:E3, ligase-protein binding complex; 1.50A {Homo sapiens} PDB: 3tdz_C | Back alignment and structure |
|---|
| >3f8m_A GNTR-family protein transcriptional regulator; PHNF, HUTC, winged helix-TUR UTRA, DNA-binding, transcription regulation; 1.80A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >1iuy_A Cullin-3 homologue; winged helix, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: a.4.5.34 | Back alignment and structure |
|---|
| >2xvc_A ESCRT-III, SSO0910; cell cycle, cell division, cytokinesis, winged-helix; 2.15A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3rkx_A Biotin-[acetyl-COA-carboxylase] ligase; biotin protein ligase, 3 domains, enzyme DNA binding, biotin coupling domains; 2.10A {Staphylococcus aureus} PDB: 3rir_A* 3rkw_A 3rky_A* 3v7c_A* 3v7s_A* 3v8j_A 3v7r_A 3v8k_A* 3v8l_A* 4dq2_A* | Back alignment and structure |
|---|
| >1pdn_C Protein (PRD paired); protein-DNA complex, double helix, PAX, paired domain, DNA-binding protein, gene regulation/DNA complex; HET: DNA; 2.50A {Drosophila melanogaster} SCOP: a.4.1.5 | Back alignment and structure |
|---|
| >3ryp_A Catabolite gene activator; CAMP receptor protein (CRP), allostery, DNA binding cyclic A transcription regulator; HET: CMP; 1.60A {Escherichia coli} PDB: 2cgp_A* 3hif_A 1g6n_A* 3ryr_A* 1i5z_A* 1j59_A* 1lb2_A* 1run_A* 1zrc_A* 1zrd_A* 1zre_A* 1zrf_A* 2gzw_A* 2wc2_A 3iyd_G* 3n4m_A* 3qop_A* 3rdi_A* 3rou_A* 3rpq_A* ... | Back alignment and structure |
|---|
| >1hw1_A FADR, fatty acid metabolism regulator protein; helix-turn-helix, helix bundle, transcription; 1.50A {Escherichia coli} SCOP: a.4.5.6 a.78.1.1 PDB: 1hw2_A 1e2x_A 1h9g_A* 1h9t_A | Back alignment and structure |
|---|
| >1p4x_A Staphylococcal accessory regulator A homologue; winged-helix protein, transcription; 2.20A {Staphylococcus aureus} SCOP: a.4.5.28 a.4.5.28 | Back alignment and structure |
|---|
| >3o2p_E Cell division control protein 53; ligase, cell cycle; 2.23A {Saccharomyces cerevisiae} PDB: 3o6b_B | Back alignment and structure |
|---|
| >2cpg_A REPA protein, transcriptional repressor COPG; DNA-binding protein, plasmid, gene regulation; 1.60A {Streptococcus agalactiae} SCOP: a.43.1.3 PDB: 1b01_A* 1ea4_A* | Back alignment and structure |
|---|
| >2ek5_A Predicted transcriptional regulators; helix-turn-helix, interwined alpha helices; 2.20A {Corynebacterium glutamicum atcc 13032} PDB: 2du9_A | Back alignment and structure |
|---|
| >2p4w_A Transcriptional regulatory protein ARSR family; archaea, PHR, heat shock, transcriptional regulation, winged DNA binding; 2.60A {Pyrococcus furiosus} SCOP: a.4.5.64 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 96 | ||||
| d1wi9a_ | 72 | a.4.5.47 (A:) Hypothetical protein C20orf116 homol | 1e-17 |
| >d1wi9a_ a.4.5.47 (A:) Hypothetical protein C20orf116 homolog {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: "Winged helix" DNA-binding domain family: PCI domain (PINT motif) domain: Hypothetical protein C20orf116 homolog species: Mouse (Mus musculus) [TaxId: 10090]
Score = 68.2 bits (167), Expect = 1e-17
Identities = 25/43 (58%), Positives = 31/43 (72%)
Query: 1 MEDLAALFRMKTQSVIDRIVELQKTGALTGVIDDRGKFIYISQ 43
+EDLA ++TQ I+RI +L G LTGVIDDRGKFIYI+
Sbjct: 24 LEDLAFQMGLRTQDAINRIQDLLTEGTLTGVIDDRGKFIYITP 66
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 96 | |||
| d1wi9a_ | 72 | Hypothetical protein C20orf116 homolog {Mouse (Mus | 99.91 | |
| d1ufma_ | 84 | COP9 signalosome complex subunit 4, GSN4 {Mouse (M | 96.67 | |
| d3ctaa1 | 85 | Ta1064 (RFK), N-terminal domain {Thermoplasma acid | 96.64 | |
| d1ub9a_ | 100 | Hypothetical protein PH1061 {Archaeon Pyrococcus h | 96.41 | |
| d2cfxa1 | 63 | Transcriptional regulator LrpC {Bacillus subtilis | 96.41 | |
| d2cg4a1 | 63 | Regulatory protein AsnC {Escherichia coli [TaxId: | 96.37 | |
| d2cyya1 | 60 | Putative transcriptional regulator PH1519 {Archaeo | 96.02 | |
| d1i1ga1 | 60 | LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 95.95 | |
| d2fbia1 | 136 | Probable transcriptional regulator PA4135 {Pseudom | 95.48 | |
| d2gaua1 | 81 | Transcriptional regulator PG0396, C-terminal domai | 95.48 | |
| d1p4xa1 | 125 | Staphylococcal accessory regulator A homolog, SarS | 95.38 | |
| d2bgca1 | 100 | Listeriolysin regulatory protein PrfA, C-terminal | 95.35 | |
| d2etha1 | 140 | Putative transcriptional regulator TM0816 {Thermot | 95.26 | |
| d1ft9a1 | 80 | CO-sensing protein CooA, C-terminal domain {Rhodos | 95.13 | |
| d1hsja1 | 115 | Staphylococcal accessory regulator A homolog, SarR | 94.87 | |
| d2frha1 | 115 | Pleiotropic regulator of virulence genes, SarA {St | 94.85 | |
| d2a61a1 | 139 | Transcriptional regulator TM0710 {Thermotoga marit | 94.82 | |
| d2d1ha1 | 109 | Hypothetical transcriptional regulator ST1889 {Sul | 94.79 | |
| d1p4xa2 | 125 | Staphylococcal accessory regulator A homolog, SarS | 94.78 | |
| d3broa1 | 135 | Transcriptional regulator OEOE1854 {Oenococcus oen | 94.77 | |
| d2hr3a1 | 145 | Probable transcriptional regulator PA3067 {Pseudom | 94.75 | |
| d3deua1 | 140 | Transcriptional regulator SlyA {Salmonella typhimu | 94.1 | |
| d1s3ja_ | 143 | Putative transcriptional regulator YusO {Bacillus | 93.95 | |
| d1biaa1 | 63 | Biotin repressor, N-terminal domain {Escherichia c | 93.72 | |
| d2bv6a1 | 136 | Transcriptional regulator MgrA {Staphylococcus aur | 93.45 | |
| d3e5ua1 | 80 | Chlorophenol reduction protein CprK {Desulfitobact | 93.41 | |
| d1sfxa_ | 109 | Hypothetical protein AF2008 {Archaeoglobus fulgidu | 93.35 | |
| d1z91a1 | 137 | Organic hydroperoxide resistance transcriptional r | 93.05 | |
| d1ku9a_ | 151 | DNA-binding protein Mj223 {Archaeon Methanococcus | 92.95 | |
| d1jgsa_ | 138 | Multiple antibiotic resistance repressor, MarR {Es | 92.94 | |
| d1lnwa_ | 141 | MexR repressor {Pseudomonas aeruginosa [TaxId: 287 | 92.77 | |
| d2fbha1 | 137 | Transcriptional regulator PA3341 {Pseudomonas aeru | 92.58 | |
| d1i5za1 | 69 | Catabolite gene activator protein (CAP), C-termina | 92.48 | |
| d1r1ta_ | 98 | SmtB repressor {Cyanobacteria (Synechococcus), pcc | 92.04 | |
| d1zyba1 | 73 | Probable transcription regulator BT4300, C-termina | 91.84 | |
| d1lj9a_ | 144 | Transcriptional regulator SlyA {Enterococcus faeca | 91.54 | |
| d2zcwa1 | 82 | Transcriptional regulator TTHA1359, C-terminal dom | 90.95 | |
| d2fxaa1 | 162 | Protease production regulatory protein Hpr {Bacill | 90.22 | |
| d1jhfa1 | 71 | LexA repressor, N-terminal DNA-binding domain {Esc | 90.13 | |
| d1ldja1 | 90 | Anaphase promoting complex (APC) {Human (Homo sapi | 90.03 | |
| d2hs5a1 | 69 | Putative transcriptional regulator RHA1_ro03477 {R | 89.82 | |
| d2ev0a1 | 61 | Manganese transport regulator MntR {Bacillus subti | 89.51 | |
| d2p4wa1 | 194 | Transcriptional regulatory protein PF1790 {Pyrococ | 88.07 | |
| d1r1ua_ | 94 | Metal-sensing transcriptional repressor CzrA {Stap | 88.01 | |
| d1z05a1 | 71 | Transcriptional regulator VC2007 N-terminal domain | 87.89 | |
| d1j5ya1 | 65 | Putative transcriptional regulator TM1602, N-termi | 87.62 | |
| d3bwga1 | 78 | Transcriptional regulator YydK {Bacillus subtilis | 87.06 | |
| d1iuya_ | 92 | Cullin-3 homologue {Mouse (Mus musculus) [TaxId: 1 | 86.7 | |
| d1u2wa1 | 108 | Cadmium efflux system accessory protein CadC {Stap | 86.6 | |
| d1mkma1 | 75 | Transcriptional regulator IclR, N-terminal domain | 85.57 | |
| d2fbka1 | 172 | Transcriptional regulator DR1159 {Deinococcus radi | 85.27 | |
| d2isya1 | 63 | Iron-dependent regulator IdeR {Mycobacterium tuber | 84.22 |
| >d1wi9a_ a.4.5.47 (A:) Hypothetical protein C20orf116 homolog {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: "Winged helix" DNA-binding domain family: PCI domain (PINT motif) domain: Hypothetical protein C20orf116 homolog species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.91 E-value=4.1e-26 Score=150.30 Aligned_cols=44 Identities=57% Similarity=0.908 Sum_probs=42.7
Q ss_pred ChhhhhhhCCChHHHHHHHHHHHHcCCccEEeeCCCceEEEcHH
Q psy11008 1 MEDLAALFRMKTQSVIDRIVELQKTGALTGVIDDRGKFIYISQE 44 (96)
Q Consensus 1 ledLAa~F~lktq~vI~RI~eL~~~g~ltGViDDRGKfIyIs~e 44 (96)
|||||++|+|+||++|+||++|+++|+||||||||||||||||.
T Consensus 24 LedLAa~F~lktqd~i~RIq~Le~~g~ltGViDDRGKfIyIS~s 67 (72)
T d1wi9a_ 24 LEDLAFQMGLRTQDAINRIQDLLTEGTLTGVIDDRGKFIYITPS 67 (72)
T ss_dssp HHHHHHHHCSCHHHHHHHHHHHHHHSSSCEEECTTCCEEECCCS
T ss_pred HHHHHHHcCCcHHHHHHHHHHHHHCCCeeeEEcCCCCEEEEcCC
Confidence 58999999999999999999999999999999999999999984
|
| >d1ufma_ a.4.5.47 (A:) COP9 signalosome complex subunit 4, GSN4 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3ctaa1 a.4.5.28 (A:5-89) Ta1064 (RFK), N-terminal domain {Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1ub9a_ a.4.5.28 (A:) Hypothetical protein PH1061 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2cfxa1 a.4.5.32 (A:1-63) Transcriptional regulator LrpC {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2cg4a1 a.4.5.32 (A:4-66) Regulatory protein AsnC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2cyya1 a.4.5.32 (A:5-64) Putative transcriptional regulator PH1519 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1i1ga1 a.4.5.32 (A:2-61) LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2fbia1 a.4.5.28 (A:5-140) Probable transcriptional regulator PA4135 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2gaua1 a.4.5.4 (A:152-232) Transcriptional regulator PG0396, C-terminal domain {Porphyromonas gingivalis [TaxId: 837]} | Back information, alignment and structure |
|---|
| >d1p4xa1 a.4.5.28 (A:1-125) Staphylococcal accessory regulator A homolog, SarS {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2bgca1 a.4.5.4 (A:138-237) Listeriolysin regulatory protein PrfA, C-terminal domain {Bacteria (Listeria monocytogenes) [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2etha1 a.4.5.28 (A:1-140) Putative transcriptional regulator TM0816 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ft9a1 a.4.5.4 (A:134-213) CO-sensing protein CooA, C-terminal domain {Rhodospirillum rubrum [TaxId: 1085]} | Back information, alignment and structure |
|---|
| >d1hsja1 a.4.5.28 (A:373-487) Staphylococcal accessory regulator A homolog, SarR {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2frha1 a.4.5.28 (A:102-216) Pleiotropic regulator of virulence genes, SarA {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2a61a1 a.4.5.28 (A:5-143) Transcriptional regulator TM0710 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2d1ha1 a.4.5.50 (A:1-109) Hypothetical transcriptional regulator ST1889 {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d1p4xa2 a.4.5.28 (A:126-250) Staphylococcal accessory regulator A homolog, SarS {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d3broa1 a.4.5.28 (A:3-137) Transcriptional regulator OEOE1854 {Oenococcus oeni [TaxId: 1247]} | Back information, alignment and structure |
|---|
| >d2hr3a1 a.4.5.28 (A:2-146) Probable transcriptional regulator PA3067 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d3deua1 a.4.5.28 (A:2-141) Transcriptional regulator SlyA {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1s3ja_ a.4.5.28 (A:) Putative transcriptional regulator YusO {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1biaa1 a.4.5.1 (A:1-63) Biotin repressor, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bv6a1 a.4.5.28 (A:5-140) Transcriptional regulator MgrA {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d3e5ua1 a.4.5.4 (A:148-227) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]} | Back information, alignment and structure |
|---|
| >d1sfxa_ a.4.5.50 (A:) Hypothetical protein AF2008 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1z91a1 a.4.5.28 (A:8-144) Organic hydroperoxide resistance transcriptional regulator OhrR {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ku9a_ a.4.5.36 (A:) DNA-binding protein Mj223 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1jgsa_ a.4.5.28 (A:) Multiple antibiotic resistance repressor, MarR {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lnwa_ a.4.5.28 (A:) MexR repressor {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2fbha1 a.4.5.28 (A:8-144) Transcriptional regulator PA3341 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1i5za1 a.4.5.4 (A:138-206) Catabolite gene activator protein (CAP), C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r1ta_ a.4.5.5 (A:) SmtB repressor {Cyanobacteria (Synechococcus), pcc7942 [TaxId: 1129]} | Back information, alignment and structure |
|---|
| >d1zyba1 a.4.5.4 (A:148-220) Probable transcription regulator BT4300, C-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1lj9a_ a.4.5.28 (A:) Transcriptional regulator SlyA {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2fxaa1 a.4.5.28 (A:6-167) Protease production regulatory protein Hpr {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1jhfa1 a.4.5.2 (A:2-72) LexA repressor, N-terminal DNA-binding domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ldja1 a.4.5.34 (A:687-776) Anaphase promoting complex (APC) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hs5a1 a.4.5.6 (A:25-93) Putative transcriptional regulator RHA1_ro03477 {Rhodococcus sp. RHA1 [TaxId: 101510]} | Back information, alignment and structure |
|---|
| >d2ev0a1 a.4.5.24 (A:2-62) Manganese transport regulator MntR {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2p4wa1 a.4.5.64 (A:1-194) Transcriptional regulatory protein PF1790 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1r1ua_ a.4.5.5 (A:) Metal-sensing transcriptional repressor CzrA {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1z05a1 a.4.5.63 (A:10-80) Transcriptional regulator VC2007 N-terminal domain {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1j5ya1 a.4.5.1 (A:3-67) Putative transcriptional regulator TM1602, N-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d3bwga1 a.4.5.6 (A:5-82) Transcriptional regulator YydK {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1iuya_ a.4.5.34 (A:) Cullin-3 homologue {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1u2wa1 a.4.5.5 (A:12-119) Cadmium efflux system accessory protein CadC {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1mkma1 a.4.5.33 (A:1-75) Transcriptional regulator IclR, N-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2fbka1 a.4.5.28 (A:8-179) Transcriptional regulator DR1159 {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d2isya1 a.4.5.24 (A:2-64) Iron-dependent regulator IdeR {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|