Psyllid ID: psy11025
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 535 | ||||||
| 193290156 | 491 | nuclear protein Es2 [Nasonia vitripennis | 0.560 | 0.610 | 0.456 | 3e-60 | |
| 158302181 | 504 | AGAP001347-PA [Anopheles gambiae str. PE | 0.461 | 0.490 | 0.488 | 2e-58 | |
| 307182244 | 850 | Protein DGCR14-like protein [Camponotus | 0.465 | 0.292 | 0.453 | 4e-57 | |
| 312371095 | 503 | hypothetical protein AND_22644 [Anophele | 0.463 | 0.493 | 0.478 | 7e-57 | |
| 307209873 | 543 | Protein DGCR14-like protein [Harpegnatho | 0.459 | 0.453 | 0.453 | 1e-55 | |
| 383852117 | 987 | PREDICTED: uncharacterized protein LOC10 | 0.463 | 0.251 | 0.457 | 3e-54 | |
| 332018817 | 683 | Protein DGCR14-like protein [Acromyrmex | 0.461 | 0.361 | 0.429 | 1e-52 | |
| 380026599 | 947 | PREDICTED: uncharacterized protein LOC10 | 0.446 | 0.252 | 0.433 | 3e-52 | |
| 328789705 | 948 | PREDICTED: hypothetical protein LOC41231 | 0.444 | 0.251 | 0.428 | 1e-51 | |
| 189238578 | 454 | PREDICTED: similar to es2 protein [Tribo | 0.442 | 0.522 | 0.443 | 1e-50 |
| >gi|193290156|ref|NP_001123264.1| nuclear protein Es2 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
Score = 239 bits (609), Expect = 3e-60, Method: Compositional matrix adjust.
Identities = 153/335 (45%), Positives = 198/335 (59%), Gaps = 35/335 (10%)
Query: 1 MDVEYSRLARDLPLPSATCATPRPASIRQNAA----PSYVSPRDAEQKIAEIIERDFFPD 56
M +E ++ +DL A TPR + R A +YV +KI EII+RDFFPD
Sbjct: 20 MALETAKNMKDL----AIFKTPRGPAKRSKAKVLDEETYV------EKIGEIIQRDFFPD 69
Query: 57 LEKLHAQNDFLDAMELNDVQKLRELYAKYSNSTPYVDRCESSPATFETPEHFTSLEEAGS 116
LEKL AQN+++DA+E ND +K+REL+ KYS P +SPATFETP H +E S
Sbjct: 70 LEKLKAQNEYIDALESNDTKKMRELFEKYSFERPRTSERLASPATFETPVH----KENSS 125
Query: 117 ADHEASVRSQGSCSSKKS-TSGKYQSLNEFLSTHTSEDNQSFEDIIEHAKKKHRIKYPWL 175
D S S SC +K+ T + L+EFLST+TSEDN SFE+I+ +KKHR+KY WL
Sbjct: 126 EDTPKSTAST-SCKAKEPKTEERRVGLDEFLSTNTSEDNASFEEIVFENEKKHRLKYAWL 184
Query: 176 YCGEDE----APENTS-RFLELPSMQEQIDQAKDKDRDRRIQTWKFVNKNSAMYTPDGVE 230
Y E E A EN S R L I+ K K+R +I TW + NKN MY PDGVE
Sbjct: 185 YKTETEPNILAIENNSDRLL-------AIENGK-KNRPFQIDTWSYKNKNYIMYIPDGVE 236
Query: 231 LTKDEQIEMARNRMSINHSGTRLHVNPFDEQQSKEALHDLAKTQAISSLSGKIGVDGKEI 290
LT +E+IEMA+ R + H TRL VNPF+EQQ+KE + +LAK Q+ ++ GKIGVDGKEI
Sbjct: 237 LTTEEKIEMAKKRQEVIHYNTRLKVNPFNEQQNKETISELAKIQSKAN-DGKIGVDGKEI 295
Query: 291 TLNSTPRNREAASTVLEKGAKSLEELKPDAALTLY 325
TPR S+ E+ PD+ L +
Sbjct: 296 VRTETPRINGYTILATPTPTPSIPEI-PDSPLMTW 329
|
Source: Nasonia vitripennis Species: Nasonia vitripennis Genus: Nasonia Family: Pteromalidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|158302181|ref|XP_321797.4| AGAP001347-PA [Anopheles gambiae str. PEST] gi|157012827|gb|EAA01147.4| AGAP001347-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|307182244|gb|EFN69575.1| Protein DGCR14-like protein [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|312371095|gb|EFR19358.1| hypothetical protein AND_22644 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
| >gi|307209873|gb|EFN86652.1| Protein DGCR14-like protein [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|383852117|ref|XP_003701575.1| PREDICTED: uncharacterized protein LOC100875510 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|332018817|gb|EGI59376.1| Protein DGCR14-like protein [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|380026599|ref|XP_003697035.1| PREDICTED: uncharacterized protein LOC100863586 [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|328789705|ref|XP_395775.3| PREDICTED: hypothetical protein LOC412314 [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|189238578|ref|XP_971100.2| PREDICTED: similar to es2 protein [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 535 | ||||||
| FB|FBgn0023506 | 501 | Es2 "Es2" [Drosophila melanoga | 0.543 | 0.580 | 0.348 | 5.5e-38 | |
| UNIPROTKB|F1RK78 | 478 | DGCR14 "Uncharacterized protei | 0.519 | 0.581 | 0.343 | 2.7e-36 | |
| UNIPROTKB|E1C0J8 | 481 | DGCR14 "Uncharacterized protei | 0.517 | 0.575 | 0.333 | 1.9e-35 | |
| UNIPROTKB|Q96DF8 | 476 | DGCR14 "Protein DGCR14" [Homo | 0.521 | 0.586 | 0.336 | 5.1e-35 | |
| UNIPROTKB|A6QQU2 | 478 | DGCR14 "Uncharacterized protei | 0.523 | 0.585 | 0.335 | 1.3e-34 | |
| MGI|MGI:107854 | 479 | Dgcr14 "DiGeorge syndrome crit | 0.450 | 0.503 | 0.346 | 4.6e-34 | |
| RGD|1308218 | 480 | Dgcr14 "DiGeorge syndrome crit | 0.450 | 0.502 | 0.349 | 9.5e-34 | |
| UNIPROTKB|E2RJZ1 | 478 | DGCR14 "Uncharacterized protei | 0.517 | 0.579 | 0.328 | 1.2e-33 | |
| FB|FBgn0028552 | 302 | gammaSnap "gamma-soluble NSF a | 0.269 | 0.476 | 0.398 | 1.4e-22 | |
| FB|FBgn0037789 | 283 | CG6208 [Drosophila melanogaste | 0.394 | 0.745 | 0.264 | 1.2e-12 |
| FB|FBgn0023506 Es2 "Es2" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 407 (148.3 bits), Expect = 5.5e-38, P = 5.5e-38
Identities = 107/307 (34%), Positives = 158/307 (51%)
Query: 16 SATCATPRP-ASIRQNAAPSYVSPRDAEQKIAEIIERDFFPDLEKLHAQNDFLDAMELND 74
SA +P A +R P ++ +++++II+RDFFPDLE+L AQND+LDA D
Sbjct: 30 SALAEFKKPTAMVRHKNKPKILTEEKYIEEMSKIIQRDFFPDLERLRAQNDYLDAESRRD 89
Query: 75 -VQ--KLRELYA--KYSNSTPYVDRCES--SPATFETPEHF-----TSLEEAGSADHEAX 122
VQ ++RE Y+ + S + R + SPATFETP T L + + D
Sbjct: 90 FVQMAEIRERYSLGRISGTGRSTSRRNNAMSPATFETPVSQAKCSNTPLPNSRATDTPFS 149
Query: 123 XXXXXXXXXXXXXXXXYQSLNEFLSTHTSEDNQSFEDIIEHAKKKHRIKYPWLYCGEDEA 182
SL+ FL +TSEDNQSF++IIE A+ K R KY LY E +
Sbjct: 150 TDGSEKSDAEGRDTTAKLSLDAFLQKYTSEDNQSFQEIIETAEAKLRQKYAVLYNHEKLS 209
Query: 183 PENTSRFLELPSMQEQIDQAKDKDRDRRIQTWKFVNKNSAMYTPDGVELTKDEQIEMARN 242
E R L LPS++ Q ++ D R+I+TW + N NS MY PDGVE T++E++++A
Sbjct: 210 AEQLQRALMLPSIETQFEEP---DPLRKIETWNYTNMNSIMYVPDGVEYTEEERVQLAER 266
Query: 243 RMSINHSGTRLHVNPFDEQQSKEALHDLAKTQAISSLSGKIGVDGKEITLNSTPRNREAA 302
+ SI H+ TRL + + L+D + V G ++ + +PR EA
Sbjct: 267 KQSIQHNATRLPDEAKHREMDTKKLNDEVPQNGAGGATATPKVRGFDLLRSPSPRPGEAF 326
Query: 303 STVLEKG 309
S ++ G
Sbjct: 327 SPIMTWG 333
|
|
| UNIPROTKB|F1RK78 DGCR14 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C0J8 DGCR14 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q96DF8 DGCR14 "Protein DGCR14" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A6QQU2 DGCR14 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:107854 Dgcr14 "DiGeorge syndrome critical region gene 14" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1308218 Dgcr14 "DiGeorge syndrome critical region gene 14" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RJZ1 DGCR14 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0028552 gammaSnap "gamma-soluble NSF attachment protein" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0037789 CG6208 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 535 | |||
| pfam09751 | 390 | pfam09751, Es2, Nuclear protein Es2 | 3e-47 |
| >gnl|CDD|220380 pfam09751, Es2, Nuclear protein Es2 | Back alignment and domain information |
|---|
Score = 168 bits (428), Expect = 3e-47
Identities = 92/277 (33%), Positives = 134/277 (48%), Gaps = 30/277 (10%)
Query: 47 EIIERDFFPDLEKLHAQNDFLDAMELNDVQKLRELYAKYSNSTPYVDRCESSPATFETPE 106
+IIERDFFPDL KL AQN++LDA+E D +++RE+ K ++ E +P F TP
Sbjct: 17 KIIERDFFPDLLKLRAQNEYLDAVESGDKERIREIQRKLTSLMG--KSTEVTPGRFRTPS 74
Query: 107 ---HFTSLEEAGSADHEASVRSQG---------SCSSKKSTSGKYQ-----SLNEFLSTH 149
+ GS G S + + + SL+EF + +
Sbjct: 75 SSSGLRNTPNPGSPSTSGDHTPMGGDTPRSVVSSETEGEEEGKGKKKDDNLSLDEFQAKY 134
Query: 150 TSEDNQSFEDIIEHAKKKHRIKYPWLYCGEDEAPENTSRFLELPSMQEQIDQAK-----D 204
TSEDN SFE+++E +K R K+ WLY E E ++ L LPS++EQ +
Sbjct: 135 TSEDNASFEELLEKQNEKRREKHAWLYEAEKEHNRKIAQRLALPSIEEQTKLGIKSLAIE 194
Query: 205 KDRDRRIQTWKFVNKNSAMYTPDGVELTKDEQIEMARNRMSINHSGTRLH--VNPFDEQQ 262
+ + TWK+ KNS M+ PDGVE + E I+ A I H TR NPF +
Sbjct: 195 DNPAANLDTWKYKAKNSLMFMPDGVEDSPLETIQAAARAPEIVHKNTRFSQEYNPFPKSP 254
Query: 263 SKEALHDLAKTQAISSLSGKIGVDGKEITLNSTPRNR 299
SK A+ + +A + ++G DGK + TPR
Sbjct: 255 SKSAIQEAIAGKARAKDG-EVGEDGK---GSETPRVN 287
|
This entry is of a family of proteins of approximately 500 residues with alternating regions of low complexity and conservation where the domain similarities are strong. Apart from a predicted coiled-coil domain, no other known functional domains have been characterized. The protein appears to be expressed in the nucleus and particularly highly in the pons sub-region of the brain. The protein is clearly necessary for normal development of the nervous system. Length = 390 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 535 | |||
| PF09751 | 414 | Es2: Nuclear protein Es2; InterPro: IPR019148 This | 100.0 | |
| KOG2627|consensus | 488 | 100.0 | ||
| KOG1586|consensus | 288 | 100.0 | ||
| PF14938 | 282 | SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 | 99.96 | |
| KOG1585|consensus | 308 | 99.93 | ||
| KOG1586|consensus | 288 | 99.91 | ||
| PF14938 | 282 | SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 | 99.87 | |
| KOG1585|consensus | 308 | 99.86 | ||
| KOG4626|consensus | 966 | 97.73 | ||
| KOG1840|consensus | 508 | 97.72 | ||
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 97.52 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 97.5 | |
| PF09976 | 145 | TPR_21: Tetratricopeptide repeat; InterPro: IPR018 | 97.31 | |
| KOG1840|consensus | 508 | 97.29 | ||
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 97.18 | |
| PF09976 | 145 | TPR_21: Tetratricopeptide repeat; InterPro: IPR018 | 96.98 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 96.94 | |
| KOG4626|consensus | 966 | 96.94 | ||
| KOG2003|consensus | 840 | 96.79 | ||
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 96.69 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 96.63 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 96.62 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 96.54 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 96.53 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 96.45 | |
| COG3063 | 250 | PilF Tfp pilus assembly protein PilF [Cell motilit | 96.44 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 96.44 | |
| KOG1155|consensus | 559 | 96.42 | ||
| KOG3616|consensus | 1636 | 96.39 | ||
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 96.38 | |
| PF13525 | 203 | YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M | 96.34 | |
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 96.23 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 96.22 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 96.15 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 96.12 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 96.06 | |
| PRK10866 | 243 | outer membrane biogenesis protein BamD; Provisiona | 96.04 | |
| PF10602 | 177 | RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 | 96.02 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 96.01 | |
| KOG1155|consensus | 559 | 95.95 | ||
| PRK12370 | 553 | invasion protein regulator; Provisional | 95.93 | |
| KOG1129|consensus | 478 | 95.88 | ||
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 95.78 | |
| cd05804 | 355 | StaR_like StaR_like; a well-conserved protein foun | 95.53 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 95.34 | |
| PF10602 | 177 | RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 | 95.29 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 95.24 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 95.24 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 95.22 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 95.19 | |
| PRK02603 | 172 | photosystem I assembly protein Ycf3; Provisional | 95.13 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 95.12 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 95.09 | |
| KOG3617|consensus | 1416 | 95.02 | ||
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 94.7 | |
| KOG0553|consensus | 304 | 94.63 | ||
| CHL00033 | 168 | ycf3 photosystem I assembly protein Ycf3 | 94.61 | |
| COG3063 | 250 | PilF Tfp pilus assembly protein PilF [Cell motilit | 94.45 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 94.42 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 94.41 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 94.4 | |
| KOG1126|consensus | 638 | 94.37 | ||
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 94.35 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 94.11 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 93.98 | |
| PRK15363 | 157 | pathogenicity island 2 chaperone protein SscA; Pro | 93.96 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 93.91 | |
| CHL00033 | 168 | ycf3 photosystem I assembly protein Ycf3 | 93.78 | |
| PF11817 | 247 | Foie-gras_1: Foie gras liver health family 1; Inte | 93.75 | |
| PRK04841 | 903 | transcriptional regulator MalT; Provisional | 93.72 | |
| KOG3617|consensus | 1416 | 93.7 | ||
| PF12688 | 120 | TPR_5: Tetratrico peptide repeat | 93.52 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 93.52 | |
| cd05804 | 355 | StaR_like StaR_like; a well-conserved protein foun | 93.52 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 93.44 | |
| PRK15179 | 694 | Vi polysaccharide biosynthesis protein TviE; Provi | 93.4 | |
| PRK10866 | 243 | outer membrane biogenesis protein BamD; Provisiona | 93.38 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 93.33 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 92.9 | |
| PRK04841 | 903 | transcriptional regulator MalT; Provisional | 92.87 | |
| KOG3616|consensus | 1636 | 92.65 | ||
| COG2956 | 389 | Predicted N-acetylglucosaminyl transferase [Carboh | 92.5 | |
| PRK02603 | 172 | photosystem I assembly protein Ycf3; Provisional | 92.47 | |
| PF13525 | 203 | YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M | 92.42 | |
| PF12688 | 120 | TPR_5: Tetratrico peptide repeat | 92.4 | |
| KOG2003|consensus | 840 | 92.35 | ||
| KOG0553|consensus | 304 | 92.32 | ||
| PRK15363 | 157 | pathogenicity island 2 chaperone protein SscA; Pro | 92.26 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 91.73 | |
| PRK15179 | 694 | Vi polysaccharide biosynthesis protein TviE; Provi | 91.6 | |
| KOG2076|consensus | 895 | 91.58 | ||
| COG2976 | 207 | Uncharacterized protein conserved in bacteria [Fun | 90.84 | |
| KOG2047|consensus | 835 | 90.76 | ||
| PF13176 | 36 | TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ | 90.67 | |
| PF03704 | 146 | BTAD: Bacterial transcriptional activator domain; | 90.64 | |
| KOG2002|consensus | 1018 | 90.36 | ||
| PF09986 | 214 | DUF2225: Uncharacterized protein conserved in bact | 90.12 | |
| KOG0548|consensus | 539 | 89.94 | ||
| KOG0547|consensus | 606 | 89.75 | ||
| PF04733 | 290 | Coatomer_E: Coatomer epsilon subunit; InterPro: IP | 89.41 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 89.3 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 89.27 | |
| KOG1125|consensus | 579 | 88.64 | ||
| KOG1126|consensus | 638 | 88.4 | ||
| KOG2076|consensus | 895 | 88.25 | ||
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 88.14 | |
| PF06552 | 186 | TOM20_plant: Plant specific mitochondrial import r | 88.13 | |
| COG1729 | 262 | Uncharacterized protein conserved in bacteria [Fun | 87.87 | |
| PRK10747 | 398 | putative protoheme IX biogenesis protein; Provisio | 87.54 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 87.54 | |
| PF04190 | 260 | DUF410: Protein of unknown function (DUF410) ; Int | 87.33 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 87.23 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 86.92 | |
| PF10345 | 608 | Cohesin_load: Cohesin loading factor; InterPro: IP | 86.61 | |
| KOG0543|consensus | 397 | 86.46 | ||
| KOG0687|consensus | 393 | 86.39 | ||
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 86.32 | |
| COG2976 | 207 | Uncharacterized protein conserved in bacteria [Fun | 86.19 | |
| COG1729 | 262 | Uncharacterized protein conserved in bacteria [Fun | 85.81 | |
| PF12862 | 94 | Apc5: Anaphase-promoting complex subunit 5 | 85.56 | |
| KOG1173|consensus | 611 | 85.55 | ||
| KOG0547|consensus | 606 | 85.06 | ||
| cd02681 | 76 | MIT_calpain7_1 MIT: domain contained within Microt | 84.83 | |
| KOG0543|consensus | 397 | 84.6 | ||
| PRK14574 | 822 | hmsH outer membrane protein; Provisional | 84.42 | |
| PRK15331 | 165 | chaperone protein SicA; Provisional | 84.19 | |
| PRK10747 | 398 | putative protoheme IX biogenesis protein; Provisio | 83.32 | |
| PLN03218 | 1060 | maturation of RBCL 1; Provisional | 83.11 | |
| PF03704 | 146 | BTAD: Bacterial transcriptional activator domain; | 82.92 | |
| PRK14720 | 906 | transcript cleavage factor/unknown domain fusion p | 82.75 | |
| KOG0548|consensus | 539 | 82.54 | ||
| PF02071 | 12 | NSF: Aromatic-di-Alanine (AdAR) repeat ; InterPro: | 81.97 | |
| KOG4234|consensus | 271 | 81.88 | ||
| PF13371 | 73 | TPR_9: Tetratricopeptide repeat | 81.67 | |
| COG5187 | 412 | RPN7 26S proteasome regulatory complex component, | 81.64 | |
| PRK14720 | 906 | transcript cleavage factor/unknown domain fusion p | 81.41 | |
| PF12569 | 517 | NARP1: NMDA receptor-regulated protein 1 ; InterPr | 81.31 | |
| PF13512 | 142 | TPR_18: Tetratricopeptide repeat | 81.02 | |
| PLN03098 | 453 | LPA1 LOW PSII ACCUMULATION1; Provisional | 80.82 | |
| KOG1920|consensus | 1265 | 80.73 | ||
| KOG2002|consensus | 1018 | 80.69 |
| >PF09751 Es2: Nuclear protein Es2; InterPro: IPR019148 This entry represents a family of proteins of approximately 500 residues with alternating regions of low complexity and conservation where the domain similarities are strong | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.7e-67 Score=561.19 Aligned_cols=282 Identities=34% Similarity=0.497 Sum_probs=219.0
Q ss_pred CCCCcCChHHHHHHHHhhhhhccCCCcHHhhhhHHHHHHHhhcCHHHHHHHHHHhcC-CCCccCCCCCCCCCCCCCCCcc
Q psy11025 31 AAPSYVSPRDAEQKIAEIIERDFFPDLEKLHAQNDFLDAMELNDVQKLRELYAKYSN-STPYVDRCESSPATFETPEHFT 109 (535)
Q Consensus 31 ~~~~VLdEd~Y~~~L~~II~RDfFPdL~kl~~q~eyL~A~~s~D~~~i~~~~~~~~~-~~~~~~~~~~~p~~~~TP~~~~ 109 (535)
|+++|||||+||++|++||+|||||||++|++|+||||||++||++||++++++|.. +++.......||++++||...+
T Consensus 1 r~~~vL~Ed~Y~~~l~~II~RDfFPdL~~l~~q~eyLeA~es~D~~~ir~~~~k~~~~~~~~~~~~~~tp~~~~tp~~~~ 80 (414)
T PF09751_consen 1 RKQKVLDEDEYTEALSKIIQRDFFPDLPKLRAQNEYLEALESNDPERIREAQRKLSSRMRKSSRRSSPTPGRFRTPSSSS 80 (414)
T ss_pred CCCccccHHHHHHHHHHHHHhhhCCChHHHHHHHHHHHHHHcCCHHHHHHHHHHHHhhccCCCCcCCCCCCccCCCcccc
Confidence 578999999999999999999999999999999999999999999999999999983 3322211245777777775321
Q ss_pred cc---------ccc-------CCCCCCCcccccCCCC------CCCCCCCCCCChHHHhhhcCCccchhHHHHHHHHHHh
Q psy11025 110 SL---------EEA-------GSADHEASVRSQGSCS------SKKSTSGKYQSLNEFLSTHTSEDNQSFEDIIEHAKKK 167 (535)
Q Consensus 110 ~~---------~~~-------~~~~~p~~~~s~~~~~------~~~~~~~~~~sLd~F~~kyTSEDN~SF~~il~~~n~k 167 (535)
.. +.. ...++|+++.++.... .....++++||||+||+|||||||+||++|||++|+|
T Consensus 81 ~~~~~~~~~~~~~~~~~tp~~~~~dtp~s~~~~~~~~~~~~~~~~~~~~~~~lSLD~F~akYTSEDNaSF~eIle~~n~k 160 (414)
T PF09751_consen 81 GTPSTPPPSTPSTPGDNTPSGWGGDTPMSSASSATSDDEEGKGKKKKNYDTNLSLDAFQAKYTSEDNASFEEILEKQNQK 160 (414)
T ss_pred cCCCCCCCCCCCCCCCCCCcccCCCCCCCccccccccccccccccccccccCCCHHHHHhhccchhHHHHHHHHHHHHHH
Confidence 10 000 0123444433221111 1223358999999999999999999999999999999
Q ss_pred hhhhcccccccCCCCccchhhhhcCCchHhhhhh----hcccCCcCccccCcCccCCccccCCCCCCCCH-HHHHHHhc-
Q psy11025 168 HRIKYPWLYCGEDEAPENTSRFLELPSMQEQIDQ----AKDKDRDRRIQTWKFVNKNSAMYTPDGVELTK-DEQIEMAR- 241 (535)
Q Consensus 168 ~~~k~awl~~~e~~~~~~~~~~l~~~~~~~~~~~----~~~~~r~~~~~~W~~~~~N~LMf~P~~~~~~~-~~~~~~~~- 241 (535)
+|+||+|||+.+..++.++...+++++++.+... ...++||+.+|+|+|+++|+|||+|++++.+. ++..+...
T Consensus 161 rreKyaWl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~rp~~~d~W~~k~rN~LMf~P~~~~~~~~e~~~~~~~~ 240 (414)
T PF09751_consen 161 RREKYAWLYDNEKESNRRLAQQLALPSIEEQDKAGIRSLAIEDRPAAPDTWKYKARNSLMFPPDGVEDTPHETIEQKARA 240 (414)
T ss_pred HHHHhHHHHhcccccHHHHHHHhhcchhhhhhccccchhhhhcCCCCCccccccccccccccCCCCcccccchhhhhhhc
Confidence 9999999999877788877777777765432110 11258999999999999999999999999984 44444433
Q ss_pred --CCCceeccCCCCC------CCCCCccccHHHHHHHHhhhhhhhhcCCC---CCCCCcccCCCCccccccccccccccc
Q psy11025 242 --NRMSINHSGTRLH------VNPFDEQQSKEALHDLAKTQAISSLSGKI---GVDGKEITLNSTPRNREAASTVLEKGA 310 (535)
Q Consensus 242 --~~k~I~~~NTR~~------~~p~~~~~~~~~~~~a~~~~~~~~~~g~~---~~~g~e~~~~~~p~v~gy~fv~~~~~~ 310 (535)
+||+|+|.||||+ .+++..++++++|.+|+++++. ...|++ |.+|+++ ||+||||+||.+++|.
T Consensus 241 ~~~pk~I~~~NTR~p~~~~~~~~~~~~s~s~s~i~~a~~~~~~-~~~~~~~~~g~egk~~----tP~vnGy~fV~tpsp~ 315 (414)
T PF09751_consen 241 PSPPKEIVHANTRFPESTPDESNSFPPSPSRSAIDDAIAGRPR-PKDSEVAATGSEGKEL----TPRVNGYSFVDTPSPA 315 (414)
T ss_pred ccCcccccccccCCccccccccCCCCCCcCHHHHHHHHhcCCc-cCcccccccccccccc----CCCCCCccccCCCCCC
Confidence 4899999999995 4577878999999999999888 777777 6666655 9999999999999885
Q ss_pred -----CccccCC
Q psy11025 311 -----KSLEELK 317 (535)
Q Consensus 311 -----~sl~k~K 317 (535)
.+|+-|=
T Consensus 316 Pg~~~sPlmTWG 327 (414)
T PF09751_consen 316 PGVDESPLMTWG 327 (414)
T ss_pred CCCCCCCccccc
Confidence 5777783
|
Apart from a predicted coiled-coil domain, no other known functional domains have been characterised. May be involved in pre-mRNA splicing and has been associated with the spliceosome C complex. The protein appears to be expressed in the nucleus, particularly in the pons sub-region of the brain. It is clearly necessary for normal development of the nervous system []. |
| >KOG2627|consensus | Back alignment and domain information |
|---|
| >KOG1586|consensus | Back alignment and domain information |
|---|
| >PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A | Back alignment and domain information |
|---|
| >KOG1585|consensus | Back alignment and domain information |
|---|
| >KOG1586|consensus | Back alignment and domain information |
|---|
| >PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A | Back alignment and domain information |
|---|
| >KOG1585|consensus | Back alignment and domain information |
|---|
| >KOG4626|consensus | Back alignment and domain information |
|---|
| >KOG1840|consensus | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function | Back alignment and domain information |
|---|
| >KOG1840|consensus | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG4626|consensus | Back alignment and domain information |
|---|
| >KOG2003|consensus | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >KOG1155|consensus | Back alignment and domain information |
|---|
| >KOG3616|consensus | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >PRK10866 outer membrane biogenesis protein BamD; Provisional | Back alignment and domain information |
|---|
| >PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >KOG1155|consensus | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >KOG1129|consensus | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >PRK02603 photosystem I assembly protein Ycf3; Provisional | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >KOG3617|consensus | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >KOG0553|consensus | Back alignment and domain information |
|---|
| >CHL00033 ycf3 photosystem I assembly protein Ycf3 | Back alignment and domain information |
|---|
| >COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >KOG1126|consensus | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >CHL00033 ycf3 photosystem I assembly protein Ycf3 | Back alignment and domain information |
|---|
| >PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] | Back alignment and domain information |
|---|
| >PRK04841 transcriptional regulator MalT; Provisional | Back alignment and domain information |
|---|
| >KOG3617|consensus | Back alignment and domain information |
|---|
| >PF12688 TPR_5: Tetratrico peptide repeat | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >PRK10866 outer membrane biogenesis protein BamD; Provisional | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >PRK04841 transcriptional regulator MalT; Provisional | Back alignment and domain information |
|---|
| >KOG3616|consensus | Back alignment and domain information |
|---|
| >COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK02603 photosystem I assembly protein Ycf3; Provisional | Back alignment and domain information |
|---|
| >PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A | Back alignment and domain information |
|---|
| >PF12688 TPR_5: Tetratrico peptide repeat | Back alignment and domain information |
|---|
| >KOG2003|consensus | Back alignment and domain information |
|---|
| >KOG0553|consensus | Back alignment and domain information |
|---|
| >PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >KOG2076|consensus | Back alignment and domain information |
|---|
| >COG2976 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG2047|consensus | Back alignment and domain information |
|---|
| >PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A | Back alignment and domain information |
|---|
| >PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production | Back alignment and domain information |
|---|
| >KOG2002|consensus | Back alignment and domain information |
|---|
| >PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function | Back alignment and domain information |
|---|
| >KOG0548|consensus | Back alignment and domain information |
|---|
| >KOG0547|consensus | Back alignment and domain information |
|---|
| >PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >KOG1125|consensus | Back alignment and domain information |
|---|
| >KOG1126|consensus | Back alignment and domain information |
|---|
| >KOG2076|consensus | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins | Back alignment and domain information |
|---|
| >COG1729 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PRK10747 putative protoheme IX biogenesis protein; Provisional | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi | Back alignment and domain information |
|---|
| >KOG0543|consensus | Back alignment and domain information |
|---|
| >KOG0687|consensus | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >COG2976 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >COG1729 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF12862 Apc5: Anaphase-promoting complex subunit 5 | Back alignment and domain information |
|---|
| >KOG1173|consensus | Back alignment and domain information |
|---|
| >KOG0547|consensus | Back alignment and domain information |
|---|
| >cd02681 MIT_calpain7_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules | Back alignment and domain information |
|---|
| >KOG0543|consensus | Back alignment and domain information |
|---|
| >PRK14574 hmsH outer membrane protein; Provisional | Back alignment and domain information |
|---|
| >PRK15331 chaperone protein SicA; Provisional | Back alignment and domain information |
|---|
| >PRK10747 putative protoheme IX biogenesis protein; Provisional | Back alignment and domain information |
|---|
| >PLN03218 maturation of RBCL 1; Provisional | Back alignment and domain information |
|---|
| >PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production | Back alignment and domain information |
|---|
| >PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >KOG0548|consensus | Back alignment and domain information |
|---|
| >PF02071 NSF: Aromatic-di-Alanine (AdAR) repeat ; InterPro: IPR000744 Regulated exocytosis of neurotransmitters and hormones, as well as intracellular traffic, requires fusion of two lipid bilayers | Back alignment and domain information |
|---|
| >KOG4234|consensus | Back alignment and domain information |
|---|
| >PF13371 TPR_9: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >COG5187 RPN7 26S proteasome regulatory complex component, contains PCI domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala | Back alignment and domain information |
|---|
| >PF13512 TPR_18: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional | Back alignment and domain information |
|---|
| >KOG1920|consensus | Back alignment and domain information |
|---|
| >KOG2002|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 535 | ||||
| 2ifu_A | 307 | Crystal Structure Of A Gamma-Snap From Danio Rerio | 8e-08 |
| >pdb|2IFU|A Chain A, Crystal Structure Of A Gamma-Snap From Danio Rerio Length = 307 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 535 | |||
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 3e-17 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 7e-09 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 8e-09 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 8e-05 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 3e-08 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 1e-05 |
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 | Back alignment and structure |
|---|
Score = 81.9 bits (202), Expect = 3e-17
Identities = 49/172 (28%), Positives = 85/172 (49%), Gaps = 10/172 (5%)
Query: 300 EAASTVLEKGAKSLEELK-PDAALTLYSRAADVAHGEDNYKQAAEYISR---------NR 349
E A + A++ + A + +A + +A +YI +
Sbjct: 53 EQAKDAYLQEAEAHANNRSLFHAAKAFEQAGMMLKDLQRMPEAVQYIEKASVMYVENGTP 112
Query: 350 EAASTVLEKGAKSLEELKSDAALTLYSRAADVAHGEDNYKQAAEYISRAARMCVRVKEFD 409
+ A+ L++ K +E L A+ LY +AA V E+ +QAAE I +A+R+ VR ++FD
Sbjct: 113 DTAAMALDRAGKLMEPLDLSKAVHLYQQAAAVFENEERLRQAAELIGKASRLLVRQQKFD 172
Query: 410 KAADLIRQEIGYHQESEHLLAIGRLAVALVLVQLARGDTVAAEKAFKEWGNC 461
+AA +++E ++E E+ + +A VLVQL R D VAA+K +E +
Sbjct: 173 EAAASLQKEKSMYKEMENYPTCYKKCIAQVLVQLHRADYVAAQKCVRESYSI 224
|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292 | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 535 | |||
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 99.7 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 99.69 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 99.32 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 99.17 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 98.7 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 98.67 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 98.66 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 98.64 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 98.64 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 98.63 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 98.63 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 98.6 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 98.56 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 98.55 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 98.52 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 98.49 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 98.47 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 98.45 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 98.44 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 98.42 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 98.38 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 98.29 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 98.27 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 98.26 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 98.14 | |
| 4b4t_Q | 434 | 26S proteasome regulatory subunit RPN6; hydrolase, | 98.11 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 98.07 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 98.02 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 97.91 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 97.87 | |
| 4b4t_Q | 434 | 26S proteasome regulatory subunit RPN6; hydrolase, | 97.83 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 97.82 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 97.81 | |
| 1hz4_A | 373 | MALT regulatory protein; two-helix bundles, helix | 97.78 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 97.76 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 97.76 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 97.75 | |
| 1hz4_A | 373 | MALT regulatory protein; two-helix bundles, helix | 97.74 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 97.74 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 97.73 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 97.72 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 97.71 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 97.7 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 97.68 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 97.68 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 97.67 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 97.65 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 97.62 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 97.61 | |
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 97.58 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 97.58 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 97.57 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 97.57 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 97.57 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 97.57 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 97.57 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 97.52 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 97.5 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 97.5 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 97.49 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 97.47 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 97.38 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 97.36 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 97.35 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 97.33 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 97.32 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 97.3 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 97.29 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 97.28 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 97.24 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 97.21 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 97.19 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 97.17 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 97.15 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 97.14 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 97.14 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 97.13 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 97.13 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 97.11 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 97.11 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 97.11 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 97.08 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 97.07 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 97.05 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 97.05 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 97.05 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 97.04 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 97.03 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 97.02 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 97.01 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 96.98 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 96.96 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 96.95 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 96.94 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 96.92 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 96.91 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 96.91 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 96.9 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 96.9 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 96.89 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 96.86 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 96.85 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 96.84 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 96.83 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 96.76 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 96.76 | |
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 96.76 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 96.7 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 96.69 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 96.68 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 96.68 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 96.66 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 96.66 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 96.65 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 96.64 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 96.63 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 96.61 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 96.61 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 96.57 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 96.56 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 96.51 | |
| 3qww_A | 433 | SET and MYND domain-containing protein 2; methyltr | 96.5 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 96.49 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 96.49 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 96.46 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 96.4 | |
| 3rjv_A | 212 | Putative SEL1 repeat protein; alpha-alpha superhel | 96.4 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 96.35 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 96.32 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 96.29 | |
| 1klx_A | 138 | Cysteine rich protein B; structural genomics, heli | 96.29 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 96.27 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 96.2 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 96.19 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 96.19 | |
| 3txn_A | 394 | 26S proteasome regulatory complex subunit P42B; PC | 96.18 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 96.16 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 96.14 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 96.13 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 96.11 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 96.08 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 96.04 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 95.98 | |
| 3qwp_A | 429 | SET and MYND domain-containing protein 3; SMYD3,SE | 95.98 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 95.97 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 95.96 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 95.95 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 95.93 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 95.9 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 95.89 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 95.87 | |
| 3rjv_A | 212 | Putative SEL1 repeat protein; alpha-alpha superhel | 95.85 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 95.84 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 95.82 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 95.81 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 95.77 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 95.77 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 95.76 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 95.67 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 95.66 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 95.63 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 95.34 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 95.3 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 95.25 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 95.22 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 95.18 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 95.13 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 95.08 | |
| 3qww_A | 433 | SET and MYND domain-containing protein 2; methyltr | 95.08 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 94.9 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 94.72 | |
| 4f3v_A | 282 | ESX-1 secretion system protein ECCA1; tetratricope | 94.69 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 94.66 | |
| 3qwp_A | 429 | SET and MYND domain-containing protein 3; SMYD3,SE | 94.61 | |
| 3e4b_A | 452 | ALGK; tetratricopeptide repeat, superhelix, algina | 94.4 | |
| 1klx_A | 138 | Cysteine rich protein B; structural genomics, heli | 94.4 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 94.32 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 94.23 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 94.1 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 94.04 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 93.97 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 93.91 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 93.86 | |
| 1zu2_A | 158 | Mitochondrial import receptor subunit TOM20-3; TPR | 93.6 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 93.54 | |
| 2v5f_A | 104 | Prolyl 4-hydroxylase subunit alpha-1; endoplasmic | 93.39 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 93.15 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 93.04 | |
| 4b4t_R | 429 | RPN7, 26S proteasome regulatory subunit RPN7; hydr | 92.88 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 92.75 | |
| 1zu2_A | 158 | Mitochondrial import receptor subunit TOM20-3; TPR | 92.67 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 92.67 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 92.35 | |
| 1b89_A | 449 | Protein (clathrin heavy chain); triskelion, coated | 91.72 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 91.56 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 91.5 | |
| 4b4t_P | 445 | 26S proteasome regulatory subunit RPN5; hydrolase, | 90.96 | |
| 2wpv_A | 312 | GET4, UPF0363 protein YOR164C; golgi-ER traffickin | 90.18 | |
| 3e4b_A | 452 | ALGK; tetratricopeptide repeat, superhelix, algina | 89.96 | |
| 1b89_A | 449 | Protein (clathrin heavy chain); triskelion, coated | 89.63 | |
| 3mv2_B | 310 | Coatomer subunit epsilon; vesicular membrane coat | 89.47 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 89.46 | |
| 3lpz_A | 336 | GET4 (YOR164C homolog); protein targeting, tail-an | 89.39 | |
| 4b4t_R | 429 | RPN7, 26S proteasome regulatory subunit RPN7; hydr | 89.2 | |
| 3mv2_B | 310 | Coatomer subunit epsilon; vesicular membrane coat | 88.52 | |
| 4e6h_A | 679 | MRNA 3'-END-processing protein RNA14; HAT domain, | 87.8 | |
| 4e6h_A | 679 | MRNA 3'-END-processing protein RNA14; HAT domain, | 87.3 | |
| 4f3v_A | 282 | ESX-1 secretion system protein ECCA1; tetratricope | 85.38 | |
| 3txn_A | 394 | 26S proteasome regulatory complex subunit P42B; PC | 84.75 | |
| 1wfd_A | 93 | Hypothetical protein 1500032H18; MIT domain, struc | 84.65 | |
| 2wm9_A | 428 | Dedicator of cytokinesis protein 9; polymorphism, | 84.34 | |
| 2yin_A | 436 | DOCK2, dedicator of cytokinesis protein 2; apoptos | 83.9 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 82.96 | |
| 2v6x_A | 85 | Vacuolar protein sorting-associated protein 4; pro | 80.37 | |
| 2cpt_A | 117 | SKD1 protein, vacuolar sorting protein 4B; MIT, he | 80.02 |
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} | Back alignment and structure |
|---|
Probab=99.70 E-value=1.1e-15 Score=153.71 Aligned_cols=193 Identities=22% Similarity=0.233 Sum_probs=156.8
Q ss_pred CHHHHHHHHHHHhc-------hHHHHHHHHHHHHHHHh--CHHHHHHHHHHHHHHHHhC-CHHHHHHHHHHHHHHHhcCC
Q psy11025 317 KPDAALTLYSRAAD-------VAHGEDNYKQAAEYISR--NREAASTVLEKGAKSLEEL-KSDAALTLYSRAADVAHGED 386 (535)
Q Consensus 317 K~D~AA~lYekAA~-------~~eAa~af~kAA~~y~~--~~~~AA~~l~~AAk~~ek~-~~~eAie~y~kAaely~~eg 386 (535)
.+++|+++|.+||+ +.+|..+|.+|..++.+ .+..++.+|..++.+|... ++++|+++|++|++++...|
T Consensus 31 ~~~~A~~~~~~a~~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~a~~~~~lg~~~~~~g~~~~A~~~~~~Al~l~~~~g 110 (307)
T 2ifu_A 31 DYDSAASEYAKAAVAFKNAKQLEQAKDAYLQEAEAHANNRSLFHAAKAFEQAGMMLKDLQRMPEAVQYIEKASVMYVENG 110 (307)
T ss_dssp CHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHTTCGGGGHHHHHHHHHHHHTTT
T ss_pred CHHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHhCCCHHHHHHHHHHHHHHHHHcC
Confidence 45599999999876 68999999999999976 4567999999999999986 59999999999999999999
Q ss_pred cHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHhcCCHHHHHHHHHHhhhccCCCC
Q psy11025 387 NYKQAAEYISRAARMCVRVKEFDKAADLIRQEIGYHQESEHLLAIGRLAVALVLVQLARGDTVAAEKAFKEWGNCCEAPE 466 (535)
Q Consensus 387 r~~~Aa~~l~kaAel~e~~~~y~~Aie~ye~~~~~~~a~e~~~~a~rl~la~il~~L~~~D~vaA~~~~e~~~~~~~~~~ 466 (535)
.+..++.++..+|.++.. ++|++|++.|+++.+++...+.......++..+..++...|+...|+..|++...
T Consensus 111 ~~~~~a~~~~~lg~~~~~-g~~~~A~~~~~~Al~~~~~~~~~~~~~~~~~~lg~~~~~~g~~~~A~~~~~~al~------ 183 (307)
T 2ifu_A 111 TPDTAAMALDRAGKLMEP-LDLSKAVHLYQQAAAVFENEERLRQAAELIGKASRLLVRQQKFDEAAASLQKEKS------ 183 (307)
T ss_dssp CHHHHHHHHHHHHHHHTT-TCHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHH------
T ss_pred CHHHHHHHHHHHHHHHHc-CCHHHHHHHHHHHHHHHHhCCChhHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHH------
Confidence 999999999999999999 9999999999999999876544434444444444556667888889999987322
Q ss_pred ccccccccccccccccchhhhhhhHHHHHHHHHHHHHHHhccCCHHHHHHHHHH---hcCCCCchhhhcc
Q psy11025 467 RCESGSSSFSFSLGKAGYHQESEHLLAIGRLAVALVLVQLARGDTVAAEKAFKE---WGNCCEAPEINSH 533 (535)
Q Consensus 467 f~~sre~~~l~~L~l~ay~~~~~~~~~~~~l~l~a~lc~L~~gD~V~A~~a~~~---~~~F~~s~E~~~~ 533 (535)
+......+.......+..|+|+++.||...|...+++ .|+|..++|+..+
T Consensus 184 -----------------~~~~~~~~~~~~~~~~~~g~~~~~~g~~~~A~~~~~~al~~p~~~~~~e~~~l 236 (307)
T 2ifu_A 184 -----------------MYKEMENYPTCYKKCIAQVLVQLHRADYVAAQKCVRESYSIPGFSGSEDCAAL 236 (307)
T ss_dssp -----------------HHHHTTCHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHTTSTTSTTSHHHHHH
T ss_pred -----------------HHHHcCChhHHHHHHHHHHHHHHHcCCHHHHHHHHHHHhCCCCCCCCHHHHHH
Confidence 1112222445555678999999999999999999998 3999999987654
|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} | Back alignment and structure |
|---|
| >1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* | Back alignment and structure |
|---|
| >3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
| >1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A | Back alignment and structure |
|---|
| >3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 | Back alignment and structure |
|---|
| >3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} | Back alignment and structure |
|---|
| >4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B | Back alignment and structure |
|---|
| >4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A | Back alignment and structure |
|---|
| >4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A | Back alignment and structure |
|---|
| >4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A | Back alignment and structure |
|---|
| >1wfd_A Hypothetical protein 1500032H18; MIT domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: a.7.14.1 | Back alignment and structure |
|---|
| >2wm9_A Dedicator of cytokinesis protein 9; polymorphism, cell membrane, phosphoprotein, nucleotide-binding, alternative splicing; 2.20A {Homo sapiens} PDB: 2wmn_A* 2wmo_A* | Back alignment and structure |
|---|
| >2yin_A DOCK2, dedicator of cytokinesis protein 2; apoptosis, DOCK, DOCK guanine nucleotide exchange factors; 2.70A {Homo sapiens} PDB: 3b13_A | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
| >2v6x_A Vacuolar protein sorting-associated protein 4; protein transport, vacuole, endosome, transport, ESCRT-III, VPS2, VPS4, SKD1, VPS4B, VPS4A; 1.98A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2cpt_A SKD1 protein, vacuolar sorting protein 4B; MIT, helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.7.14.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 535 | |||
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 99.78 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 99.35 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 97.62 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 97.61 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 97.57 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 97.44 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 97.43 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 97.39 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 97.32 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 97.21 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 97.16 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 97.1 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 97.08 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 97.05 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 97.01 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 96.86 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 96.72 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 96.7 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 96.67 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 96.67 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 96.64 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 96.63 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 96.59 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 96.55 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 96.5 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 96.3 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 96.29 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 96.28 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 96.25 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 96.23 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 96.21 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 95.54 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 94.9 | |
| d1klxa_ | 133 | Cysteine rich protein B (HcpB) {Helicobacter pylor | 94.68 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 94.37 | |
| d1zu2a1 | 145 | Mitochondrial import receptor subunit tom20-3 {Tha | 93.36 | |
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 93.33 | |
| d2onda1 | 308 | Cleavage stimulation factor 77 kDa subunit CSTF3 { | 93.31 | |
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 92.99 | |
| d2h6fa1 | 315 | Protein farnesyltransferase alpha-subunit {Human ( | 92.73 | |
| d2onda1 | 308 | Cleavage stimulation factor 77 kDa subunit CSTF3 { | 91.93 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 91.25 | |
| d2h6fa1 | 315 | Protein farnesyltransferase alpha-subunit {Human ( | 90.31 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 90.01 | |
| d1wfda_ | 93 | Hypothetical protein 1500032H18Rik {Mouse (Mus mus | 89.79 | |
| d1ya0a1 | 497 | SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | 88.44 | |
| d1zbpa1 | 264 | Hypothetical protein VPA1032 {Vibrio parahaemolyti | 83.02 | |
| d1zu2a1 | 145 | Mitochondrial import receptor subunit tom20-3 {Tha | 82.57 | |
| d1ya0a1 | 497 | SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | 82.5 |
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: TPR-like family: Tetratricopeptide repeat (TPR) domain: Vesicular transport protein sec17 species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.78 E-value=7.6e-18 Score=166.30 Aligned_cols=195 Identities=17% Similarity=0.197 Sum_probs=151.5
Q ss_pred CHHHHHHHHHHHhc-------hHHHHHHHHHHHHHHHh--CHHHHHHHHHHHHHHHHhCC-HHHHHHHHHHHHHHHhcCC
Q psy11025 317 KPDAALTLYSRAAD-------VAHGEDNYKQAAEYISR--NREAASTVLEKGAKSLEELK-SDAALTLYSRAADVAHGED 386 (535)
Q Consensus 317 K~D~AA~lYekAA~-------~~eAa~af~kAA~~y~~--~~~~AA~~l~~AAk~~ek~~-~~eAie~y~kAaely~~eg 386 (535)
|+++|+++|.+||+ |.+|.++|.+|++++.+ ++..++.+|..+|.+|.+.. +++|+++|.+|++++...|
T Consensus 32 ~~~~Aa~~y~~aa~~y~~~~~~~~A~~~y~kA~~~~~~~~~~~~~a~~~~~~g~~y~~~~~~~~A~~~~~~a~~~~~~~~ 111 (290)
T d1qqea_ 32 KFEEAADLCVQAATIYRLRKELNLAGDSFLKAADYQKKAGNEDEAGNTYVEAYKCFKSGGNSVNAVDSLENAIQIFTHRG 111 (290)
T ss_dssp HHHHHHHHHHHHHHHHHHTTCTHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHTT
T ss_pred cHHHHHHHHHHHHHHHHHCcCHHHHHHHHHHHHHHHHHcCCCHHHHHHHHHHHHHHHHhCCcHHHHHHHHHhhHHhhhcc
Confidence 45799999999998 78999999999999976 56779999999999998865 9999999999999999999
Q ss_pred cHHHHHHHHHHHHHHHHH-hhhHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHhcCCHHHHHHHHHHhhhccCCC
Q psy11025 387 NYKQAAEYISRAARMCVR-VKEFDKAADLIRQEIGYHQESEHLLAIGRLAVALVLVQLARGDTVAAEKAFKEWGNCCEAP 465 (535)
Q Consensus 387 r~~~Aa~~l~kaAel~e~-~~~y~~Aie~ye~~~~~~~a~e~~~~a~rl~la~il~~L~~~D~vaA~~~~e~~~~~~~~~ 465 (535)
.+..++.++..+|++++. .++|++|+++|+++.+++...+....++.+..-++.+....|+...|...|++........
T Consensus 112 ~~~~~~~~~~~l~~~~~~~~~~~~~A~~~~~~A~~l~~~~~~~~~~~~~~~~la~~~~~~g~y~~A~~~~~~~~~~~~~~ 191 (290)
T d1qqea_ 112 QFRRGANFKFELGEILENDLHDYAKAIDCYELAGEWYAQDQSVALSNKCFIKCADLKALDGQYIEASDIYSKLIKSSMGN 191 (290)
T ss_dssp CHHHHHHHHHHHHHHHHHTTCCHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTTSSC
T ss_pred cchhHHHHHHHHHHhHhhHHHHHHHHHHHHHHHHHHHHhcCchhhhhhHHHHHHHHHHHcChHHHHHHHHHHHHHhCccc
Confidence 999999999999999976 5999999999999999887765555455444444556667788888999999866532210
Q ss_pred CccccccccccccccccchhhhhhhHHHHHHHHHHHHHHHhccCCHHHHHHHHHH---h-cCCCCchhhhcc
Q psy11025 466 ERCESGSSSFSFSLGKAGYHQESEHLLAIGRLAVALVLVQLARGDTVAAEKAFKE---W-GNCCEAPEINSH 533 (535)
Q Consensus 466 ~f~~sre~~~l~~L~l~ay~~~~~~~~~~~~l~l~a~lc~L~~gD~V~A~~a~~~---~-~~F~~s~E~~~~ 533 (535)
. . ..+. ....++.+|+|+|+.||.+.|.+++++ + |+|.++||+..+
T Consensus 192 ~--------------~-------~~~~-~~~~~~~~~~~~l~~~d~~~A~~~~~~~~~~~~~~~~sre~~~l 241 (290)
T d1qqea_ 192 R--------------L-------SQWS-LKDYFLKKGLCQLAATDAVAAARTLQEGQSEDPNFADSRESNFL 241 (290)
T ss_dssp T--------------T-------TGGG-HHHHHHHHHHHHHHTTCHHHHHHHHHGGGCC---------HHHH
T ss_pred h--------------h-------hhhh-HHHHHHHHHHHHHHhccHHHHHHHHHHHHHhCCCccchHHHHHH
Confidence 0 0 1122 233358889999999999999999998 2 999999998654
|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfda_ a.7.14.1 (A:) Hypothetical protein 1500032H18Rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|