Psyllid ID: psy11025


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-----
MDVEYSRLARDLPLPSATCATPRPASIRQNAAPSYVSPRDAEQKIAEIIERDFFPDLEKLHAQNDFLDAMELNDVQKLRELYAKYSNSTPYVDRCESSPATFETPEHFTSLEEAGSADHEASVRSQGSCSSKKSTSGKYQSLNEFLSTHTSEDNQSFEDIIEHAKKKHRIKYPWLYCGEDEAPENTSRFLELPSMQEQIDQAKDKDRDRRIQTWKFVNKNSAMYTPDGVELTKDEQIEMARNRMSINHSGTRLHVNPFDEQQSKEALHDLAKTQAISSLSGKIGVDGKEITLNSTPRNREAASTVLEKGAKSLEELKPDAALTLYSRAADVAHGEDNYKQAAEYISRNREAASTVLEKGAKSLEELKSDAALTLYSRAADVAHGEDNYKQAAEYISRAARMCVRVKEFDKAADLIRQEIGYHQESEHLLAIGRLAVALVLVQLARGDTVAAEKAFKEWGNCCEAPERCESGSSSFSFSLGKAGYHQESEHLLAIGRLAVALVLVQLARGDTVAAEKAFKEWGNCCEAPEINSHMD
ccHHHHHHHcccccccccccccccHHHHcccccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccHHHHHHHHHHHHHHHHHccccccccccccccHHHHHccccHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHcccccEEccccccccccccccccHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHccHHHHHcccHHHHHHHHHHHHHHcccccHHHHHHHHHHcHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccHHHcccccHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccccccccccccc
ccccccHHHccccccccccccccccccHcccccccEccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHccHcHHHHHHHHHHcHHHHHHcccccccccccccccccccccccEEEccccccccHHHHHHHcccccEEEEcccccccccccccccHHHHHHHHcccccccccccccccccEcccccccccccccccccccccccccccccccccccccHccHcHcccccHHHHHHHHHccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHccccccHHHcHcccccHHHHHHHccccHHHccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHccccccccHccccc
mdveysrlardlplpsatcatprpasirqnaapsyvsprdAEQKIAEIIErdffpdleklHAQNDFLDAMELNDVQKLRELYAKysnstpyvdrcesspatfetpehftsleeagsadheasvrsqgscsskkstsgkyQSLNEFLsthtsednqSFEDIIEHAKKkhrikypwlycgedeapentsrflelpsMQEQIDQakdkdrdrRIQTWKFVnknsamytpdgveltKDEQIEMARNRMSinhsgtrlhvnpfdeqqSKEALHDLAKTQAIsslsgkigvdgkeitlnstprnrEAASTVLEKGAKSLEELKPDAALTLYSRAadvahgedNYKQAAEYISRNREAASTVLEKGAKSLEELKSDAALTLYSRAadvahgedNYKQAAEYISRAARMCVRVKEFDKAADLIRQEIGYHQESEHLLAIGRLAVALVLVQLARGDTVAAEKAFKEwgncceapercesgsssfsfslgkagyhqESEHLLAIGRLAVALVLVQLARGDTVAAEKAFKEwgncceapeinshmd
mdveysrlardlplpsatcatprpasirqnaapsyvspRDAEQKIAEIIERDFFPDLEKLHAQNDFLDAMELNDVQKLRELYAKYSNSTPYVDRCESSPATFETPEHFTSLEEAGSADHEasvrsqgscsskkstsgKYQSLNEFLSthtsednqSFEDIIEHAKKKHRIKYPWLYCGEDEAPENTSRFLELPSMQEQidqakdkdrdrriqtwkfvnknsamytpdgvelTKDEQIEMARNRMSINHSGTRLHVNPFDEQQSKEALHDLAKTQAisslsgkigvdgkeitlnstprnreaASTVLEKGAKSLEELKPDAALTLYSRAADVAHGEDNYKQAAEYISRNREAASTVLEKGAKSLEELKSDAALTLYSRAADVAHGEDNYKQAAEYISRAARMCVRVKEFDKAADLIRQEIGYHQESEHLLAIGRLAVALVLVQLARGDTVAAEKAFKEWGNCCEAPERCESGSSSFSFSLGKAGYHQESEHLLAIGRLAVALVLVQLARGDTVAAEKAFKEwgncceapeinshmd
MDVEYSRLARDLPLPSATCATPRPASIRQNAAPSYVSPRDAEQKIAEIIERDFFPDLEKLHAQNDFLDAMELNDVQKLRELYAKYSNSTPYVDRCESSPATFETPEHFTSLEEAGSADHEAsvrsqgscsskkstsgkYQSLNEFLSTHTSEDNQSFEDIIEHAKKKHRIKYPWLYCGEDEAPENTSRFLELPSMQEQIDQAKDKDRDRRIQTWKFVNKNSAMYTPDGVELTKDEQIEMARNRMSINHSGTRLHVNPFDEQQSKEALHDLAKTQAISSLSGKIGVDGKEITLNSTPRNREAASTVLEKGAKSLEELKPDAALTLYSRAADVAHGEDNYKQAAEYISRNREAASTVLEKGAKSLEELKSDAALTLYSRAADVAHGEDNYKQAAEYISRAARMCVRVKEFDKAADLIRQEIGYHQESEHLLAIGRlavalvlvqlaRGDTVAAEKAFKEWGNCCEAPERCEsgsssfsfsLGKAGYHQESEHLLAIGRlavalvlvqlaRGDTVAAEKAFKEWGNCCEAPEINSHMD
********************************************IAEIIERDFFPDLEKLHAQNDFLDAMELNDVQKLRELYAKYSNSTPYV*******************************************************************IIEHAKKKHRIKYPWLYCG*********************************QTWKFVNK*******************************************************************************************************TLY*********************************************ALTLYSRAADVAHGEDNYKQAAEYISRAARMCVRVKEFDKAADLIRQEIGYHQESEHLLAIGRLAVALVLVQLARGDTVAAEKAFKEWGNCCEAPE*********SFSLGKAGYHQESEHLLAIGRLAVALVLVQLARGDTVAAEKAFKEWGNCCE*********
**************************************RDAEQKIAEIIERDFFPDLEKLHAQNDFLDAMELNDV*******************************************************************NEFLSTHTSEDNQSFEDIIEHAKKKHRIKYPW**************************************TWKFVNKNSAMYTPD***************************************************************************************************RAADVAHGEDNYKQA*****************************ALTLYSRAA**************YISRAARMCVRVKEFDKAADLIRQEIGYHQESEHLLAIGRLAVALVLVQLARGDTVAAEKAFKEWGNCCEAPERCESGSSSFSFSLGKAGYHQESEHLLAIGRLAVALVLVQLARGDTVAAEKAFKEWGNCCE*********
********ARDLPLPSATCATPRPASIR************AEQKIAEIIERDFFPDLEKLHAQNDFLDAMELNDVQKLRELYAKYSNSTPYVDRCESSPATFETPEHFTSL****************************QSLNEFLSTHTSEDNQSFEDIIEHAKKKHRIKYPWLYCGEDEAPENTSRFLELPSMQ************RRIQTWKFVNKNSAMYTPDGVELTKDEQIEMARNRMSINHSGTRLHVNPFDEQQSKEALHDLAKTQAISSLSGKIGVDGKEITLNSTPRNREAASTVLEKGAKSLEELKPDAALTLYSRAADVAHGEDNYKQAAEYISRNREAASTVLEKGAKSLEELKSDAALTLYSRAADVAHGEDNYKQAAEYISRAARMCVRVKEFDKAADLIRQEIGYHQESEHLLAIGRLAVALVLVQLARGDTVAAEKAFKEWGNCCEAP************SLGKAGYHQESEHLLAIGRLAVALVLVQLARGDTVAAEKAFKEWGNCCEAPEINSHMD
*********************PRPAS*****APSYVSPRDAEQKIAEIIERDFFPDLEKLHAQNDFLDAMELNDVQKLRELYAKYSN***************************************************YQSLNEFLSTHTSEDNQSFEDIIEHAKKKHRIKYPWLYCGEDEAPENTSRFLELPSMQEQIDQAKDKDRDRRIQTWKFVNKNSAMYTPDGVELTKDEQIEMARNRMSINHSGTRLH****************************I*VDGKE*TLNSTPRNREAASTVLEKGAKSLEELKPDAALTLYSRAADVAHGEDNYKQAAEYISRNREAASTVLEKGAKSLEELKSDAALTLYSRAADVAHGEDNYKQAAEYISRAARMCVRVKEFDKAADLIRQEIGYHQESEHLLAIGRLAVALVLVQLARGDTVAAEKAFKEWGNCCEAPERCESGSSSFSFSLGKAGYHQESEHLLAIGRLAVALVLVQLARGDTVAAEKAFKEWGNCCEAP*******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDVEYSRLARDLPLPSATCATPRPASIRQNAAPSYVSPRDAEQKIAEIIERDFFPDLEKLHAQNDFLDAMELNDVQKLRELYAKYSNSTPYVDRCESSPATFETPEHFTSLEEAGSADHEASVRSQGSCSSKKSTSGKYQSLNEFLSTHTSEDNQSFEDIIEHAKKKHRIKYPWLYCGEDEAPENTSRFLELPSMQEQIDQAKDKDRDRRIQTWKFVNKNSAMYTPDGVELTKDEQIEMARNRMSINHSGTRLHVNPFDEQQSKEALHDLAKTQAISSLSGKIGVDGKEITLNSTPRNREAASTVLEKGAKSLEELKPDAALTLYSRAADVAHGEDNYKQAAEYISRNREAASTVLEKGAKSLEELKSDAALTLYSRAADVAHGEDNYKQAAEYISRAARMCVRVKEFDKAADLIRQEIGYHQESEHLLAIGRLAVALVLVQLARGDTVAAEKAFKEWGNCCEAPERCESGSSSFSFSLGKAGYHQESEHLLAIGRLAVALVLVQLARGDTVAAEKAFKEWGNCCEAPEINSHMD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query535 2.2.26 [Sep-21-2011]
O44424501 Protein DGCR14 homolog OS yes N/A 0.525 0.560 0.359 7e-38
Q96DF8476 Protein DGCR14 OS=Homo sa yes N/A 0.441 0.495 0.347 1e-33
O70279479 Protein DGCR14 OS=Mus mus yes N/A 0.431 0.482 0.359 1e-33
P34420531 ES2 similar protein 2 OS= yes N/A 0.439 0.442 0.283 6e-19
Q9CWZ7312 Gamma-soluble NSF attachm no N/A 0.201 0.346 0.351 2e-10
P81127312 Gamma-soluble NSF attachm no N/A 0.201 0.346 0.351 2e-10
Q99747312 Gamma-soluble NSF attachm no N/A 0.201 0.346 0.351 2e-10
O59793384 Stress response protein b yes N/A 0.291 0.406 0.273 0.0001
>sp|O44424|DGC14_DROME Protein DGCR14 homolog OS=Drosophila melanogaster GN=Es2 PE=1 SV=2 Back     alignment and function desciption
 Score =  159 bits (401), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 107/298 (35%), Positives = 159/298 (53%), Gaps = 17/298 (5%)

Query: 25  ASIRQNAAPSYVSPRDAEQKIAEIIERDFFPDLEKLHAQNDFLDAMELNDVQKLRELYAK 84
           A +R    P  ++     +++++II+RDFFPDLE+L AQND+LDA    D  ++ E+  +
Sbjct: 40  AMVRHKNKPKILTEEKYIEEMSKIIQRDFFPDLERLRAQNDYLDAESRRDFVQMAEIRER 99

Query: 85  YS-NSTPYVDRCES------SPATFETPEH-----FTSLEEAGSADHEASV-RSQGSCSS 131
           YS        R  S      SPATFETP        T L  + + D   S   S+ S + 
Sbjct: 100 YSLGRISGTGRSTSRRNNAMSPATFETPVSQAKCSNTPLPNSRATDTPFSTDGSEKSDAE 159

Query: 132 KKSTSGKYQSLNEFLSTHTSEDNQSFEDIIEHAKKKHRIKYPWLYCGEDEAPENTSRFLE 191
            + T+ K  SL+ FL  +TSEDNQSF++IIE A+ K R KY  LY  E  + E   R L 
Sbjct: 160 GRDTTAKL-SLDAFLQKYTSEDNQSFQEIIETAEAKLRQKYAVLYNHEKLSAEQLQRALM 218

Query: 192 LPSMQEQIDQAKDKDRDRRIQTWKFVNKNSAMYTPDGVELTKDEQIEMARNRMSINHSGT 251
           LPS++ Q ++    D  R+I+TW + N NS MY PDGVE T++E++++A  + SI H+ T
Sbjct: 219 LPSIETQFEEP---DPLRKIETWNYTNMNSIMYVPDGVEYTEEERVQLAERKQSIQHNAT 275

Query: 252 RLHVNPFDEQQSKEALHDLAKTQAISSLSGKIGVDGKEITLNSTPRNREAASTVLEKG 309
           RL       +   + L+D          +    V G ++  + +PR  EA S ++  G
Sbjct: 276 RLPDEAKHREMDTKKLNDEVPQNGAGGATATPKVRGFDLLRSPSPRPGEAFSPIMTWG 333





Drosophila melanogaster (taxid: 7227)
>sp|Q96DF8|DGC14_HUMAN Protein DGCR14 OS=Homo sapiens GN=DGCR14 PE=1 SV=1 Back     alignment and function description
>sp|O70279|DGC14_MOUSE Protein DGCR14 OS=Mus musculus GN=Dgcr14 PE=2 SV=2 Back     alignment and function description
>sp|P34420|DGC14_CAEEL ES2 similar protein 2 OS=Caenorhabditis elegans GN=ess-2 PE=3 SV=2 Back     alignment and function description
>sp|Q9CWZ7|SNAG_MOUSE Gamma-soluble NSF attachment protein OS=Mus musculus GN=Napg PE=1 SV=1 Back     alignment and function description
>sp|P81127|SNAG_BOVIN Gamma-soluble NSF attachment protein OS=Bos taurus GN=NAPG PE=1 SV=3 Back     alignment and function description
>sp|Q99747|SNAG_HUMAN Gamma-soluble NSF attachment protein OS=Homo sapiens GN=NAPG PE=1 SV=1 Back     alignment and function description
>sp|O59793|BIS1_SCHPO Stress response protein bis1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bis1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query535
193290156491 nuclear protein Es2 [Nasonia vitripennis 0.560 0.610 0.456 3e-60
158302181504 AGAP001347-PA [Anopheles gambiae str. PE 0.461 0.490 0.488 2e-58
307182244 850 Protein DGCR14-like protein [Camponotus 0.465 0.292 0.453 4e-57
312371095503 hypothetical protein AND_22644 [Anophele 0.463 0.493 0.478 7e-57
307209873543 Protein DGCR14-like protein [Harpegnatho 0.459 0.453 0.453 1e-55
383852117 987 PREDICTED: uncharacterized protein LOC10 0.463 0.251 0.457 3e-54
332018817 683 Protein DGCR14-like protein [Acromyrmex 0.461 0.361 0.429 1e-52
380026599 947 PREDICTED: uncharacterized protein LOC10 0.446 0.252 0.433 3e-52
328789705 948 PREDICTED: hypothetical protein LOC41231 0.444 0.251 0.428 1e-51
189238578454 PREDICTED: similar to es2 protein [Tribo 0.442 0.522 0.443 1e-50
>gi|193290156|ref|NP_001123264.1| nuclear protein Es2 [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  239 bits (609), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 153/335 (45%), Positives = 198/335 (59%), Gaps = 35/335 (10%)

Query: 1   MDVEYSRLARDLPLPSATCATPRPASIRQNAA----PSYVSPRDAEQKIAEIIERDFFPD 56
           M +E ++  +DL    A   TPR  + R  A      +YV      +KI EII+RDFFPD
Sbjct: 20  MALETAKNMKDL----AIFKTPRGPAKRSKAKVLDEETYV------EKIGEIIQRDFFPD 69

Query: 57  LEKLHAQNDFLDAMELNDVQKLRELYAKYSNSTPYVDRCESSPATFETPEHFTSLEEAGS 116
           LEKL AQN+++DA+E ND +K+REL+ KYS   P      +SPATFETP H    +E  S
Sbjct: 70  LEKLKAQNEYIDALESNDTKKMRELFEKYSFERPRTSERLASPATFETPVH----KENSS 125

Query: 117 ADHEASVRSQGSCSSKKS-TSGKYQSLNEFLSTHTSEDNQSFEDIIEHAKKKHRIKYPWL 175
            D   S  S  SC +K+  T  +   L+EFLST+TSEDN SFE+I+   +KKHR+KY WL
Sbjct: 126 EDTPKSTAST-SCKAKEPKTEERRVGLDEFLSTNTSEDNASFEEIVFENEKKHRLKYAWL 184

Query: 176 YCGEDE----APENTS-RFLELPSMQEQIDQAKDKDRDRRIQTWKFVNKNSAMYTPDGVE 230
           Y  E E    A EN S R L        I+  K K+R  +I TW + NKN  MY PDGVE
Sbjct: 185 YKTETEPNILAIENNSDRLL-------AIENGK-KNRPFQIDTWSYKNKNYIMYIPDGVE 236

Query: 231 LTKDEQIEMARNRMSINHSGTRLHVNPFDEQQSKEALHDLAKTQAISSLSGKIGVDGKEI 290
           LT +E+IEMA+ R  + H  TRL VNPF+EQQ+KE + +LAK Q+ ++  GKIGVDGKEI
Sbjct: 237 LTTEEKIEMAKKRQEVIHYNTRLKVNPFNEQQNKETISELAKIQSKAN-DGKIGVDGKEI 295

Query: 291 TLNSTPRNREAASTVLEKGAKSLEELKPDAALTLY 325
               TPR              S+ E+ PD+ L  +
Sbjct: 296 VRTETPRINGYTILATPTPTPSIPEI-PDSPLMTW 329




Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|158302181|ref|XP_321797.4| AGAP001347-PA [Anopheles gambiae str. PEST] gi|157012827|gb|EAA01147.4| AGAP001347-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|307182244|gb|EFN69575.1| Protein DGCR14-like protein [Camponotus floridanus] Back     alignment and taxonomy information
>gi|312371095|gb|EFR19358.1| hypothetical protein AND_22644 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|307209873|gb|EFN86652.1| Protein DGCR14-like protein [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|383852117|ref|XP_003701575.1| PREDICTED: uncharacterized protein LOC100875510 [Megachile rotundata] Back     alignment and taxonomy information
>gi|332018817|gb|EGI59376.1| Protein DGCR14-like protein [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|380026599|ref|XP_003697035.1| PREDICTED: uncharacterized protein LOC100863586 [Apis florea] Back     alignment and taxonomy information
>gi|328789705|ref|XP_395775.3| PREDICTED: hypothetical protein LOC412314 [Apis mellifera] Back     alignment and taxonomy information
>gi|189238578|ref|XP_971100.2| PREDICTED: similar to es2 protein [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query535
FB|FBgn0023506501 Es2 "Es2" [Drosophila melanoga 0.543 0.580 0.348 5.5e-38
UNIPROTKB|F1RK78478 DGCR14 "Uncharacterized protei 0.519 0.581 0.343 2.7e-36
UNIPROTKB|E1C0J8481 DGCR14 "Uncharacterized protei 0.517 0.575 0.333 1.9e-35
UNIPROTKB|Q96DF8476 DGCR14 "Protein DGCR14" [Homo 0.521 0.586 0.336 5.1e-35
UNIPROTKB|A6QQU2478 DGCR14 "Uncharacterized protei 0.523 0.585 0.335 1.3e-34
MGI|MGI:107854479 Dgcr14 "DiGeorge syndrome crit 0.450 0.503 0.346 4.6e-34
RGD|1308218480 Dgcr14 "DiGeorge syndrome crit 0.450 0.502 0.349 9.5e-34
UNIPROTKB|E2RJZ1478 DGCR14 "Uncharacterized protei 0.517 0.579 0.328 1.2e-33
FB|FBgn0028552302 gammaSnap "gamma-soluble NSF a 0.269 0.476 0.398 1.4e-22
FB|FBgn0037789283 CG6208 [Drosophila melanogaste 0.394 0.745 0.264 1.2e-12
FB|FBgn0023506 Es2 "Es2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 407 (148.3 bits), Expect = 5.5e-38, P = 5.5e-38
 Identities = 107/307 (34%), Positives = 158/307 (51%)

Query:    16 SATCATPRP-ASIRQNAAPSYVSPRDAEQKIAEIIERDFFPDLEKLHAQNDFLDAMELND 74
             SA     +P A +R    P  ++     +++++II+RDFFPDLE+L AQND+LDA    D
Sbjct:    30 SALAEFKKPTAMVRHKNKPKILTEEKYIEEMSKIIQRDFFPDLERLRAQNDYLDAESRRD 89

Query:    75 -VQ--KLRELYA--KYSNSTPYVDRCES--SPATFETPEHF-----TSLEEAGSADHEAX 122
              VQ  ++RE Y+  + S +     R  +  SPATFETP        T L  + + D    
Sbjct:    90 FVQMAEIRERYSLGRISGTGRSTSRRNNAMSPATFETPVSQAKCSNTPLPNSRATDTPFS 149

Query:   123 XXXXXXXXXXXXXXXXYQSLNEFLSTHTSEDNQSFEDIIEHAKKKHRIKYPWLYCGEDEA 182
                               SL+ FL  +TSEDNQSF++IIE A+ K R KY  LY  E  +
Sbjct:   150 TDGSEKSDAEGRDTTAKLSLDAFLQKYTSEDNQSFQEIIETAEAKLRQKYAVLYNHEKLS 209

Query:   183 PENTSRFLELPSMQEQIDQAKDKDRDRRIQTWKFVNKNSAMYTPDGVELTKDEQIEMARN 242
              E   R L LPS++ Q ++    D  R+I+TW + N NS MY PDGVE T++E++++A  
Sbjct:   210 AEQLQRALMLPSIETQFEEP---DPLRKIETWNYTNMNSIMYVPDGVEYTEEERVQLAER 266

Query:   243 RMSINHSGTRLHVNPFDEQQSKEALHDLAKTQAISSLSGKIGVDGKEITLNSTPRNREAA 302
             + SI H+ TRL       +   + L+D          +    V G ++  + +PR  EA 
Sbjct:   267 KQSIQHNATRLPDEAKHREMDTKKLNDEVPQNGAGGATATPKVRGFDLLRSPSPRPGEAF 326

Query:   303 STVLEKG 309
             S ++  G
Sbjct:   327 SPIMTWG 333




GO:0004757 "sepiapterin reductase activity" evidence=ISS
GO:0005634 "nucleus" evidence=ISS;NAS
GO:0007399 "nervous system development" evidence=ISS
GO:0071013 "catalytic step 2 spliceosome" evidence=IDA
GO:0000398 "mRNA splicing, via spliceosome" evidence=IC
UNIPROTKB|F1RK78 DGCR14 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1C0J8 DGCR14 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q96DF8 DGCR14 "Protein DGCR14" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A6QQU2 DGCR14 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:107854 Dgcr14 "DiGeorge syndrome critical region gene 14" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1308218 Dgcr14 "DiGeorge syndrome critical region gene 14" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2RJZ1 DGCR14 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
FB|FBgn0028552 gammaSnap "gamma-soluble NSF attachment protein" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0037789 CG6208 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query535
pfam09751390 pfam09751, Es2, Nuclear protein Es2 3e-47
>gnl|CDD|220380 pfam09751, Es2, Nuclear protein Es2 Back     alignment and domain information
 Score =  168 bits (428), Expect = 3e-47
 Identities = 92/277 (33%), Positives = 134/277 (48%), Gaps = 30/277 (10%)

Query: 47  EIIERDFFPDLEKLHAQNDFLDAMELNDVQKLRELYAKYSNSTPYVDRCESSPATFETPE 106
           +IIERDFFPDL KL AQN++LDA+E  D +++RE+  K ++        E +P  F TP 
Sbjct: 17  KIIERDFFPDLLKLRAQNEYLDAVESGDKERIREIQRKLTSLMG--KSTEVTPGRFRTPS 74

Query: 107 ---HFTSLEEAGSADHEASVRSQG---------SCSSKKSTSGKYQ-----SLNEFLSTH 149
                 +    GS          G         S +  +      +     SL+EF + +
Sbjct: 75  SSSGLRNTPNPGSPSTSGDHTPMGGDTPRSVVSSETEGEEEGKGKKKDDNLSLDEFQAKY 134

Query: 150 TSEDNQSFEDIIEHAKKKHRIKYPWLYCGEDEAPENTSRFLELPSMQEQIDQAK-----D 204
           TSEDN SFE+++E   +K R K+ WLY  E E     ++ L LPS++EQ          +
Sbjct: 135 TSEDNASFEELLEKQNEKRREKHAWLYEAEKEHNRKIAQRLALPSIEEQTKLGIKSLAIE 194

Query: 205 KDRDRRIQTWKFVNKNSAMYTPDGVELTKDEQIEMARNRMSINHSGTRLH--VNPFDEQQ 262
            +    + TWK+  KNS M+ PDGVE +  E I+ A     I H  TR     NPF +  
Sbjct: 195 DNPAANLDTWKYKAKNSLMFMPDGVEDSPLETIQAAARAPEIVHKNTRFSQEYNPFPKSP 254

Query: 263 SKEALHDLAKTQAISSLSGKIGVDGKEITLNSTPRNR 299
           SK A+ +    +A +    ++G DGK    + TPR  
Sbjct: 255 SKSAIQEAIAGKARAKDG-EVGEDGK---GSETPRVN 287


This entry is of a family of proteins of approximately 500 residues with alternating regions of low complexity and conservation where the domain similarities are strong. Apart from a predicted coiled-coil domain, no other known functional domains have been characterized. The protein appears to be expressed in the nucleus and particularly highly in the pons sub-region of the brain. The protein is clearly necessary for normal development of the nervous system. Length = 390

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 535
PF09751414 Es2: Nuclear protein Es2; InterPro: IPR019148 This 100.0
KOG2627|consensus488 100.0
KOG1586|consensus288 100.0
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 99.96
KOG1585|consensus308 99.93
KOG1586|consensus288 99.91
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 99.87
KOG1585|consensus308 99.86
KOG4626|consensus 966 97.73
KOG1840|consensus508 97.72
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 97.52
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 97.5
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.31
KOG1840|consensus 508 97.29
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 97.18
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 96.98
PRK11788389 tetratricopeptide repeat protein; Provisional 96.94
KOG4626|consensus 966 96.94
KOG2003|consensus840 96.79
PRK11788 389 tetratricopeptide repeat protein; Provisional 96.69
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 96.63
PRK11189296 lipoprotein NlpI; Provisional 96.62
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 96.54
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 96.53
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 96.45
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 96.44
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 96.44
KOG1155|consensus559 96.42
KOG3616|consensus 1636 96.39
PRK10803263 tol-pal system protein YbgF; Provisional 96.38
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.34
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 96.23
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 96.22
cd00189100 TPR Tetratricopeptide repeat domain; typically con 96.15
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 96.12
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 96.06
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 96.04
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 96.02
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 96.01
KOG1155|consensus559 95.95
PRK12370553 invasion protein regulator; Provisional 95.93
KOG1129|consensus478 95.88
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 95.78
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 95.53
cd00189100 TPR Tetratricopeptide repeat domain; typically con 95.34
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 95.29
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 95.24
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 95.24
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 95.22
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 95.19
PRK02603172 photosystem I assembly protein Ycf3; Provisional 95.13
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 95.12
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 95.09
KOG3617|consensus 1416 95.02
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 94.7
KOG0553|consensus304 94.63
CHL00033168 ycf3 photosystem I assembly protein Ycf3 94.61
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 94.45
PRK15359144 type III secretion system chaperone protein SscB; 94.42
TIGR02552135 LcrH_SycD type III secretion low calcium response 94.41
PRK10803263 tol-pal system protein YbgF; Provisional 94.4
KOG1126|consensus638 94.37
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 94.35
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 94.11
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 93.98
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 93.96
PRK12370553 invasion protein regulator; Provisional 93.91
CHL00033168 ycf3 photosystem I assembly protein Ycf3 93.78
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 93.75
PRK04841 903 transcriptional regulator MalT; Provisional 93.72
KOG3617|consensus 1416 93.7
PF12688120 TPR_5: Tetratrico peptide repeat 93.52
PRK15359144 type III secretion system chaperone protein SscB; 93.52
cd05804355 StaR_like StaR_like; a well-conserved protein foun 93.52
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 93.44
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 93.4
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 93.38
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 93.33
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 92.9
PRK04841 903 transcriptional regulator MalT; Provisional 92.87
KOG3616|consensus 1636 92.65
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 92.5
PRK02603172 photosystem I assembly protein Ycf3; Provisional 92.47
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 92.42
PF12688120 TPR_5: Tetratrico peptide repeat 92.4
KOG2003|consensus 840 92.35
KOG0553|consensus 304 92.32
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 92.26
TIGR02552135 LcrH_SycD type III secretion low calcium response 91.73
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 91.6
KOG2076|consensus 895 91.58
COG2976207 Uncharacterized protein conserved in bacteria [Fun 90.84
KOG2047|consensus835 90.76
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 90.67
PF03704146 BTAD: Bacterial transcriptional activator domain; 90.64
KOG2002|consensus 1018 90.36
PF09986214 DUF2225: Uncharacterized protein conserved in bact 90.12
KOG0548|consensus539 89.94
KOG0547|consensus606 89.75
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 89.41
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 89.3
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 89.27
KOG1125|consensus579 88.64
KOG1126|consensus638 88.4
KOG2076|consensus 895 88.25
PRK10370198 formate-dependent nitrite reductase complex subuni 88.14
PF06552186 TOM20_plant: Plant specific mitochondrial import r 88.13
COG1729262 Uncharacterized protein conserved in bacteria [Fun 87.87
PRK10747398 putative protoheme IX biogenesis protein; Provisio 87.54
PRK11189296 lipoprotein NlpI; Provisional 87.54
PF04190260 DUF410: Protein of unknown function (DUF410) ; Int 87.33
PRK10370198 formate-dependent nitrite reductase complex subuni 87.23
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 86.92
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 86.61
KOG0543|consensus397 86.46
KOG0687|consensus 393 86.39
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 86.32
COG2976207 Uncharacterized protein conserved in bacteria [Fun 86.19
COG1729262 Uncharacterized protein conserved in bacteria [Fun 85.81
PF1286294 Apc5: Anaphase-promoting complex subunit 5 85.56
KOG1173|consensus611 85.55
KOG0547|consensus606 85.06
cd0268176 MIT_calpain7_1 MIT: domain contained within Microt 84.83
KOG0543|consensus397 84.6
PRK14574 822 hmsH outer membrane protein; Provisional 84.42
PRK15331165 chaperone protein SicA; Provisional 84.19
PRK10747 398 putative protoheme IX biogenesis protein; Provisio 83.32
PLN03218 1060 maturation of RBCL 1; Provisional 83.11
PF03704146 BTAD: Bacterial transcriptional activator domain; 82.92
PRK14720 906 transcript cleavage factor/unknown domain fusion p 82.75
KOG0548|consensus539 82.54
PF0207112 NSF: Aromatic-di-Alanine (AdAR) repeat ; InterPro: 81.97
KOG4234|consensus271 81.88
PF1337173 TPR_9: Tetratricopeptide repeat 81.67
COG5187 412 RPN7 26S proteasome regulatory complex component, 81.64
PRK14720 906 transcript cleavage factor/unknown domain fusion p 81.41
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 81.31
PF13512142 TPR_18: Tetratricopeptide repeat 81.02
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 80.82
KOG1920|consensus1265 80.73
KOG2002|consensus 1018 80.69
>PF09751 Es2: Nuclear protein Es2; InterPro: IPR019148 This entry represents a family of proteins of approximately 500 residues with alternating regions of low complexity and conservation where the domain similarities are strong Back     alignment and domain information
Probab=100.00  E-value=1.7e-67  Score=561.19  Aligned_cols=282  Identities=34%  Similarity=0.497  Sum_probs=219.0

Q ss_pred             CCCCcCChHHHHHHHHhhhhhccCCCcHHhhhhHHHHHHHhhcCHHHHHHHHHHhcC-CCCccCCCCCCCCCCCCCCCcc
Q psy11025         31 AAPSYVSPRDAEQKIAEIIERDFFPDLEKLHAQNDFLDAMELNDVQKLRELYAKYSN-STPYVDRCESSPATFETPEHFT  109 (535)
Q Consensus        31 ~~~~VLdEd~Y~~~L~~II~RDfFPdL~kl~~q~eyL~A~~s~D~~~i~~~~~~~~~-~~~~~~~~~~~p~~~~TP~~~~  109 (535)
                      |+++|||||+||++|++||+|||||||++|++|+||||||++||++||++++++|.. +++.......||++++||...+
T Consensus         1 r~~~vL~Ed~Y~~~l~~II~RDfFPdL~~l~~q~eyLeA~es~D~~~ir~~~~k~~~~~~~~~~~~~~tp~~~~tp~~~~   80 (414)
T PF09751_consen    1 RKQKVLDEDEYTEALSKIIQRDFFPDLPKLRAQNEYLEALESNDPERIREAQRKLSSRMRKSSRRSSPTPGRFRTPSSSS   80 (414)
T ss_pred             CCCccccHHHHHHHHHHHHHhhhCCChHHHHHHHHHHHHHHcCCHHHHHHHHHHHHhhccCCCCcCCCCCCccCCCcccc
Confidence            578999999999999999999999999999999999999999999999999999983 3322211245777777775321


Q ss_pred             cc---------ccc-------CCCCCCCcccccCCCC------CCCCCCCCCCChHHHhhhcCCccchhHHHHHHHHHHh
Q psy11025        110 SL---------EEA-------GSADHEASVRSQGSCS------SKKSTSGKYQSLNEFLSTHTSEDNQSFEDIIEHAKKK  167 (535)
Q Consensus       110 ~~---------~~~-------~~~~~p~~~~s~~~~~------~~~~~~~~~~sLd~F~~kyTSEDN~SF~~il~~~n~k  167 (535)
                      ..         +..       ...++|+++.++....      .....++++||||+||+|||||||+||++|||++|+|
T Consensus        81 ~~~~~~~~~~~~~~~~~tp~~~~~dtp~s~~~~~~~~~~~~~~~~~~~~~~~lSLD~F~akYTSEDNaSF~eIle~~n~k  160 (414)
T PF09751_consen   81 GTPSTPPPSTPSTPGDNTPSGWGGDTPMSSASSATSDDEEGKGKKKKNYDTNLSLDAFQAKYTSEDNASFEEILEKQNQK  160 (414)
T ss_pred             cCCCCCCCCCCCCCCCCCCcccCCCCCCCccccccccccccccccccccccCCCHHHHHhhccchhHHHHHHHHHHHHHH
Confidence            10         000       0123444433221111      1223358999999999999999999999999999999


Q ss_pred             hhhhcccccccCCCCccchhhhhcCCchHhhhhh----hcccCCcCccccCcCccCCccccCCCCCCCCH-HHHHHHhc-
Q psy11025        168 HRIKYPWLYCGEDEAPENTSRFLELPSMQEQIDQ----AKDKDRDRRIQTWKFVNKNSAMYTPDGVELTK-DEQIEMAR-  241 (535)
Q Consensus       168 ~~~k~awl~~~e~~~~~~~~~~l~~~~~~~~~~~----~~~~~r~~~~~~W~~~~~N~LMf~P~~~~~~~-~~~~~~~~-  241 (535)
                      +|+||+|||+.+..++.++...+++++++.+...    ...++||+.+|+|+|+++|+|||+|++++.+. ++..+... 
T Consensus       161 rreKyaWl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~rp~~~d~W~~k~rN~LMf~P~~~~~~~~e~~~~~~~~  240 (414)
T PF09751_consen  161 RREKYAWLYDNEKESNRRLAQQLALPSIEEQDKAGIRSLAIEDRPAAPDTWKYKARNSLMFPPDGVEDTPHETIEQKARA  240 (414)
T ss_pred             HHHHhHHHHhcccccHHHHHHHhhcchhhhhhccccchhhhhcCCCCCccccccccccccccCCCCcccccchhhhhhhc
Confidence            9999999999877788877777777765432110    11258999999999999999999999999984 44444433 


Q ss_pred             --CCCceeccCCCCC------CCCCCccccHHHHHHHHhhhhhhhhcCCC---CCCCCcccCCCCccccccccccccccc
Q psy11025        242 --NRMSINHSGTRLH------VNPFDEQQSKEALHDLAKTQAISSLSGKI---GVDGKEITLNSTPRNREAASTVLEKGA  310 (535)
Q Consensus       242 --~~k~I~~~NTR~~------~~p~~~~~~~~~~~~a~~~~~~~~~~g~~---~~~g~e~~~~~~p~v~gy~fv~~~~~~  310 (535)
                        +||+|+|.||||+      .+++..++++++|.+|+++++. ...|++   |.+|+++    ||+||||+||.+++|.
T Consensus       241 ~~~pk~I~~~NTR~p~~~~~~~~~~~~s~s~s~i~~a~~~~~~-~~~~~~~~~g~egk~~----tP~vnGy~fV~tpsp~  315 (414)
T PF09751_consen  241 PSPPKEIVHANTRFPESTPDESNSFPPSPSRSAIDDAIAGRPR-PKDSEVAATGSEGKEL----TPRVNGYSFVDTPSPA  315 (414)
T ss_pred             ccCcccccccccCCccccccccCCCCCCcCHHHHHHHHhcCCc-cCcccccccccccccc----CCCCCCccccCCCCCC
Confidence              4899999999995      4577878999999999999888 777777   6666655    9999999999999885


Q ss_pred             -----CccccCC
Q psy11025        311 -----KSLEELK  317 (535)
Q Consensus       311 -----~sl~k~K  317 (535)
                           .+|+-|=
T Consensus       316 Pg~~~sPlmTWG  327 (414)
T PF09751_consen  316 PGVDESPLMTWG  327 (414)
T ss_pred             CCCCCCCccccc
Confidence                 5777783



Apart from a predicted coiled-coil domain, no other known functional domains have been characterised. May be involved in pre-mRNA splicing and has been associated with the spliceosome C complex. The protein appears to be expressed in the nucleus, particularly in the pons sub-region of the brain. It is clearly necessary for normal development of the nervous system [].

>KOG2627|consensus Back     alignment and domain information
>KOG1586|consensus Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG1585|consensus Back     alignment and domain information
>KOG1586|consensus Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG1585|consensus Back     alignment and domain information
>KOG4626|consensus Back     alignment and domain information
>KOG1840|consensus Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG1840|consensus Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG4626|consensus Back     alignment and domain information
>KOG2003|consensus Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>KOG1155|consensus Back     alignment and domain information
>KOG3616|consensus Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG1155|consensus Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1129|consensus Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG0553|consensus Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG1126|consensus Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG3616|consensus Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG2003|consensus Back     alignment and domain information
>KOG0553|consensus Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG2076|consensus Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2047|consensus Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG2002|consensus Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG0548|consensus Back     alignment and domain information
>KOG0547|consensus Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG1125|consensus Back     alignment and domain information
>KOG1126|consensus Back     alignment and domain information
>KOG2076|consensus Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>KOG0543|consensus Back     alignment and domain information
>KOG0687|consensus Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>KOG1173|consensus Back     alignment and domain information
>KOG0547|consensus Back     alignment and domain information
>cd02681 MIT_calpain7_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>KOG0543|consensus Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG0548|consensus Back     alignment and domain information
>PF02071 NSF: Aromatic-di-Alanine (AdAR) repeat ; InterPro: IPR000744 Regulated exocytosis of neurotransmitters and hormones, as well as intracellular traffic, requires fusion of two lipid bilayers Back     alignment and domain information
>KOG4234|consensus Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>COG5187 RPN7 26S proteasome regulatory complex component, contains PCI domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>KOG2002|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query535
2ifu_A307 Crystal Structure Of A Gamma-Snap From Danio Rerio 8e-08
>pdb|2IFU|A Chain A, Crystal Structure Of A Gamma-Snap From Danio Rerio Length = 307 Back     alignment and structure

Iteration: 1

Score = 55.5 bits (132), Expect = 8e-08, Method: Compositional matrix adjust. Identities = 43/156 (27%), Positives = 73/156 (46%), Gaps = 10/156 (6%) Query: 302 ASTVLEKGAKSLEELKPDAALTLYSRAADVAHGEDNYKQAAEYISRNREAASTVLEKGAK 361 A+ E+ L++L+ Y A V + E+ + A+ L++ K Sbjct: 75 AAKAFEQAGXXLKDLQRXPEAVQYIEKASVXYVENG----------TPDTAAXALDRAGK 124 Query: 362 SLEELKSDAALTLYSRAADVAHGEDNYKQAAEYISRAARMCVRVKEFDKAADLIRQEIGY 421 E L A+ LY +AA V E+ +QAAE I +A+R+ VR ++FD+AA +++E Sbjct: 125 LXEPLDLSKAVHLYQQAAAVFENEERLRQAAELIGKASRLLVRQQKFDEAAASLQKEKSX 184 Query: 422 HQESEHLLAIGRXXXXXXXXXXXRGDTVAAEKAFKE 457 ++E E+ + R D VAA+K +E Sbjct: 185 YKEXENYPTCYKKCIAQVLVQLHRADYVAAQKCVRE 220

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query535
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 3e-17
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 7e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-05
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 3e-08
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 1e-05
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
 Score = 81.9 bits (202), Expect = 3e-17
 Identities = 49/172 (28%), Positives = 85/172 (49%), Gaps = 10/172 (5%)

Query: 300 EAASTVLEKGAKSLEELK-PDAALTLYSRAADVAHGEDNYKQAAEYISR---------NR 349
           E A     + A++    +    A   + +A  +        +A +YI +           
Sbjct: 53  EQAKDAYLQEAEAHANNRSLFHAAKAFEQAGMMLKDLQRMPEAVQYIEKASVMYVENGTP 112

Query: 350 EAASTVLEKGAKSLEELKSDAALTLYSRAADVAHGEDNYKQAAEYISRAARMCVRVKEFD 409
           + A+  L++  K +E L    A+ LY +AA V   E+  +QAAE I +A+R+ VR ++FD
Sbjct: 113 DTAAMALDRAGKLMEPLDLSKAVHLYQQAAAVFENEERLRQAAELIGKASRLLVRQQKFD 172

Query: 410 KAADLIRQEIGYHQESEHLLAIGRLAVALVLVQLARGDTVAAEKAFKEWGNC 461
           +AA  +++E   ++E E+     +  +A VLVQL R D VAA+K  +E  + 
Sbjct: 173 EAAASLQKEKSMYKEMENYPTCYKKCIAQVLVQLHRADYVAAQKCVRESYSI 224


>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query535
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.7
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.69
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.32
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.17
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 98.7
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 98.67
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 98.66
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 98.64
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 98.64
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 98.63
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 98.63
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.6
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.56
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.55
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.52
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.49
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 98.47
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 98.45
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.44
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 98.42
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.38
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.29
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.27
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.26
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 98.14
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.11
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.07
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.02
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 97.91
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 97.87
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 97.83
4eqf_A365 PEX5-related protein; accessory protein, tetratric 97.82
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 97.81
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 97.78
3u3w_A293 Transcriptional activator PLCR protein; ternary co 97.76
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 97.76
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 97.75
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 97.74
4i17_A228 Hypothetical protein; TPR repeats protein, structu 97.74
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 97.73
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 97.72
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 97.71
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 97.7
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 97.68
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 97.68
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 97.67
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 97.65
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 97.62
4eqf_A365 PEX5-related protein; accessory protein, tetratric 97.61
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 97.58
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 97.58
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 97.57
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 97.57
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 97.57
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 97.57
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 97.57
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 97.52
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 97.5
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 97.5
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 97.49
3u4t_A272 TPR repeat-containing protein; structural genomics 97.47
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 97.38
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 97.36
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 97.35
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 97.33
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 97.32
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 97.3
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 97.29
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 97.28
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 97.24
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 97.21
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.19
3u4t_A272 TPR repeat-containing protein; structural genomics 97.17
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 97.15
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 97.14
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 97.14
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 97.13
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 97.13
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 97.11
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 97.11
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 97.11
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 97.08
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.07
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 97.05
2gw1_A514 Mitochondrial precursor proteins import receptor; 97.05
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 97.05
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 97.04
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 97.03
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 97.02
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 97.01
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 96.98
2gw1_A 514 Mitochondrial precursor proteins import receptor; 96.96
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 96.95
4i17_A228 Hypothetical protein; TPR repeats protein, structu 96.94
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 96.92
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 96.91
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 96.91
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 96.9
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 96.9
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 96.89
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 96.86
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 96.85
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 96.84
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 96.83
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 96.76
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 96.76
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 96.76
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 96.7
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 96.69
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 96.68
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 96.68
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 96.66
3q49_B137 STIP1 homology and U box-containing protein 1; E3 96.66
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 96.65
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 96.64
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 96.63
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 96.61
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 96.61
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 96.57
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 96.56
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 96.51
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.5
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 96.49
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 96.49
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 96.46
4g1t_A 472 Interferon-induced protein with tetratricopeptide 96.4
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 96.4
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 96.35
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 96.32
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 96.29
1klx_A138 Cysteine rich protein B; structural genomics, heli 96.29
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 96.27
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 96.2
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 96.19
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 96.19
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 96.18
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 96.16
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 96.14
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 96.13
3q49_B137 STIP1 homology and U box-containing protein 1; E3 96.11
3k9i_A117 BH0479 protein; putative protein binding protein, 96.08
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 96.04
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 95.98
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 95.98
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 95.97
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 95.96
2l6j_A111 TPR repeat-containing protein associated with HSP; 95.95
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 95.93
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 95.9
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 95.89
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 95.87
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 95.85
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 95.84
4g1t_A472 Interferon-induced protein with tetratricopeptide 95.82
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 95.81
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 95.77
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 95.77
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 95.76
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 95.67
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 95.66
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 95.63
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 95.34
2l6j_A111 TPR repeat-containing protein associated with HSP; 95.3
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 95.25
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 95.22
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 95.18
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 95.13
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 95.08
3qww_A433 SET and MYND domain-containing protein 2; methyltr 95.08
2kat_A115 Uncharacterized protein; NESG, structure, structur 94.9
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 94.72
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 94.69
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 94.66
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 94.61
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 94.4
1klx_A138 Cysteine rich protein B; structural genomics, heli 94.4
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 94.32
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 94.23
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 94.1
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 94.04
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 93.97
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 93.91
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 93.86
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 93.6
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 93.54
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 93.39
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 93.15
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 93.04
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 92.88
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 92.75
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 92.67
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 92.67
2kat_A115 Uncharacterized protein; NESG, structure, structur 92.35
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 91.72
3k9i_A117 BH0479 protein; putative protein binding protein, 91.56
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 91.5
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 90.96
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 90.18
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 89.96
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 89.63
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 89.47
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 89.46
3lpz_A 336 GET4 (YOR164C homolog); protein targeting, tail-an 89.39
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 89.2
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 88.52
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 87.8
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 87.3
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 85.38
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 84.75
1wfd_A93 Hypothetical protein 1500032H18; MIT domain, struc 84.65
2wm9_A 428 Dedicator of cytokinesis protein 9; polymorphism, 84.34
2yin_A 436 DOCK2, dedicator of cytokinesis protein 2; apoptos 83.9
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 82.96
2v6x_A85 Vacuolar protein sorting-associated protein 4; pro 80.37
2cpt_A117 SKD1 protein, vacuolar sorting protein 4B; MIT, he 80.02
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
Probab=99.70  E-value=1.1e-15  Score=153.71  Aligned_cols=193  Identities=22%  Similarity=0.233  Sum_probs=156.8

Q ss_pred             CHHHHHHHHHHHhc-------hHHHHHHHHHHHHHHHh--CHHHHHHHHHHHHHHHHhC-CHHHHHHHHHHHHHHHhcCC
Q psy11025        317 KPDAALTLYSRAAD-------VAHGEDNYKQAAEYISR--NREAASTVLEKGAKSLEEL-KSDAALTLYSRAADVAHGED  386 (535)
Q Consensus       317 K~D~AA~lYekAA~-------~~eAa~af~kAA~~y~~--~~~~AA~~l~~AAk~~ek~-~~~eAie~y~kAaely~~eg  386 (535)
                      .+++|+++|.+||+       +.+|..+|.+|..++.+  .+..++.+|..++.+|... ++++|+++|++|++++...|
T Consensus        31 ~~~~A~~~~~~a~~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~a~~~~~lg~~~~~~g~~~~A~~~~~~Al~l~~~~g  110 (307)
T 2ifu_A           31 DYDSAASEYAKAAVAFKNAKQLEQAKDAYLQEAEAHANNRSLFHAAKAFEQAGMMLKDLQRMPEAVQYIEKASVMYVENG  110 (307)
T ss_dssp             CHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHTTCGGGGHHHHHHHHHHHHTTT
T ss_pred             CHHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHhCCCHHHHHHHHHHHHHHHHHcC
Confidence            45599999999876       68999999999999976  4567999999999999986 59999999999999999999


Q ss_pred             cHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHhcCCHHHHHHHHHHhhhccCCCC
Q psy11025        387 NYKQAAEYISRAARMCVRVKEFDKAADLIRQEIGYHQESEHLLAIGRLAVALVLVQLARGDTVAAEKAFKEWGNCCEAPE  466 (535)
Q Consensus       387 r~~~Aa~~l~kaAel~e~~~~y~~Aie~ye~~~~~~~a~e~~~~a~rl~la~il~~L~~~D~vaA~~~~e~~~~~~~~~~  466 (535)
                      .+..++.++..+|.++.. ++|++|++.|+++.+++...+.......++..+..++...|+...|+..|++...      
T Consensus       111 ~~~~~a~~~~~lg~~~~~-g~~~~A~~~~~~Al~~~~~~~~~~~~~~~~~~lg~~~~~~g~~~~A~~~~~~al~------  183 (307)
T 2ifu_A          111 TPDTAAMALDRAGKLMEP-LDLSKAVHLYQQAAAVFENEERLRQAAELIGKASRLLVRQQKFDEAAASLQKEKS------  183 (307)
T ss_dssp             CHHHHHHHHHHHHHHHTT-TCHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHH------
T ss_pred             CHHHHHHHHHHHHHHHHc-CCHHHHHHHHHHHHHHHHhCCChhHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHH------
Confidence            999999999999999999 9999999999999999876544434444444444556667888889999987322      


Q ss_pred             ccccccccccccccccchhhhhhhHHHHHHHHHHHHHHHhccCCHHHHHHHHHH---hcCCCCchhhhcc
Q psy11025        467 RCESGSSSFSFSLGKAGYHQESEHLLAIGRLAVALVLVQLARGDTVAAEKAFKE---WGNCCEAPEINSH  533 (535)
Q Consensus       467 f~~sre~~~l~~L~l~ay~~~~~~~~~~~~l~l~a~lc~L~~gD~V~A~~a~~~---~~~F~~s~E~~~~  533 (535)
                                       +......+.......+..|+|+++.||...|...+++   .|+|..++|+..+
T Consensus       184 -----------------~~~~~~~~~~~~~~~~~~g~~~~~~g~~~~A~~~~~~al~~p~~~~~~e~~~l  236 (307)
T 2ifu_A          184 -----------------MYKEMENYPTCYKKCIAQVLVQLHRADYVAAQKCVRESYSIPGFSGSEDCAAL  236 (307)
T ss_dssp             -----------------HHHHTTCHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHTTSTTSTTSHHHHHH
T ss_pred             -----------------HHHHcCChhHHHHHHHHHHHHHHHcCCHHHHHHHHHHHhCCCCCCCCHHHHHH
Confidence                             1112222445555678999999999999999999998   3999999987654



>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>1wfd_A Hypothetical protein 1500032H18; MIT domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: a.7.14.1 Back     alignment and structure
>2wm9_A Dedicator of cytokinesis protein 9; polymorphism, cell membrane, phosphoprotein, nucleotide-binding, alternative splicing; 2.20A {Homo sapiens} PDB: 2wmn_A* 2wmo_A* Back     alignment and structure
>2yin_A DOCK2, dedicator of cytokinesis protein 2; apoptosis, DOCK, DOCK guanine nucleotide exchange factors; 2.70A {Homo sapiens} PDB: 3b13_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2v6x_A Vacuolar protein sorting-associated protein 4; protein transport, vacuole, endosome, transport, ESCRT-III, VPS2, VPS4, SKD1, VPS4B, VPS4A; 1.98A {Saccharomyces cerevisiae} Back     alignment and structure
>2cpt_A SKD1 protein, vacuolar sorting protein 4B; MIT, helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.7.14.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query535
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.78
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.35
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.62
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.61
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.57
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 97.44
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 97.43
d1hz4a_ 366 Transcription factor MalT domain III {Escherichia 97.39
d1hz4a_366 Transcription factor MalT domain III {Escherichia 97.32
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 97.21
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.16
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 97.1
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.08
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.05
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.01
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 96.86
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 96.72
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 96.7
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 96.67
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 96.67
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 96.64
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 96.63
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 96.59
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 96.55
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 96.5
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 96.3
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 96.29
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 96.28
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 96.25
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 96.23
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 96.21
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 95.54
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 94.9
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 94.68
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 94.37
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 93.36
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 93.33
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 93.31
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 92.99
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 92.73
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 91.93
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 91.25
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 90.31
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 90.01
d1wfda_93 Hypothetical protein 1500032H18Rik {Mouse (Mus mus 89.79
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 88.44
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 83.02
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 82.57
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 82.5
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: Vesicular transport protein sec17
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.78  E-value=7.6e-18  Score=166.30  Aligned_cols=195  Identities=17%  Similarity=0.197  Sum_probs=151.5

Q ss_pred             CHHHHHHHHHHHhc-------hHHHHHHHHHHHHHHHh--CHHHHHHHHHHHHHHHHhCC-HHHHHHHHHHHHHHHhcCC
Q psy11025        317 KPDAALTLYSRAAD-------VAHGEDNYKQAAEYISR--NREAASTVLEKGAKSLEELK-SDAALTLYSRAADVAHGED  386 (535)
Q Consensus       317 K~D~AA~lYekAA~-------~~eAa~af~kAA~~y~~--~~~~AA~~l~~AAk~~ek~~-~~eAie~y~kAaely~~eg  386 (535)
                      |+++|+++|.+||+       |.+|.++|.+|++++.+  ++..++.+|..+|.+|.+.. +++|+++|.+|++++...|
T Consensus        32 ~~~~Aa~~y~~aa~~y~~~~~~~~A~~~y~kA~~~~~~~~~~~~~a~~~~~~g~~y~~~~~~~~A~~~~~~a~~~~~~~~  111 (290)
T d1qqea_          32 KFEEAADLCVQAATIYRLRKELNLAGDSFLKAADYQKKAGNEDEAGNTYVEAYKCFKSGGNSVNAVDSLENAIQIFTHRG  111 (290)
T ss_dssp             HHHHHHHHHHHHHHHHHHTTCTHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHTT
T ss_pred             cHHHHHHHHHHHHHHHHHCcCHHHHHHHHHHHHHHHHHcCCCHHHHHHHHHHHHHHHHhCCcHHHHHHHHHhhHHhhhcc
Confidence            45799999999998       78999999999999976  56779999999999998865 9999999999999999999


Q ss_pred             cHHHHHHHHHHHHHHHHH-hhhHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHhcCCHHHHHHHHHHhhhccCCC
Q psy11025        387 NYKQAAEYISRAARMCVR-VKEFDKAADLIRQEIGYHQESEHLLAIGRLAVALVLVQLARGDTVAAEKAFKEWGNCCEAP  465 (535)
Q Consensus       387 r~~~Aa~~l~kaAel~e~-~~~y~~Aie~ye~~~~~~~a~e~~~~a~rl~la~il~~L~~~D~vaA~~~~e~~~~~~~~~  465 (535)
                      .+..++.++..+|++++. .++|++|+++|+++.+++...+....++.+..-++.+....|+...|...|++........
T Consensus       112 ~~~~~~~~~~~l~~~~~~~~~~~~~A~~~~~~A~~l~~~~~~~~~~~~~~~~la~~~~~~g~y~~A~~~~~~~~~~~~~~  191 (290)
T d1qqea_         112 QFRRGANFKFELGEILENDLHDYAKAIDCYELAGEWYAQDQSVALSNKCFIKCADLKALDGQYIEASDIYSKLIKSSMGN  191 (290)
T ss_dssp             CHHHHHHHHHHHHHHHHHTTCCHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTTSSC
T ss_pred             cchhHHHHHHHHHHhHhhHHHHHHHHHHHHHHHHHHHHhcCchhhhhhHHHHHHHHHHHcChHHHHHHHHHHHHHhCccc
Confidence            999999999999999976 5999999999999999887765555455444444556667788888999999866532210


Q ss_pred             CccccccccccccccccchhhhhhhHHHHHHHHHHHHHHHhccCCHHHHHHHHHH---h-cCCCCchhhhcc
Q psy11025        466 ERCESGSSSFSFSLGKAGYHQESEHLLAIGRLAVALVLVQLARGDTVAAEKAFKE---W-GNCCEAPEINSH  533 (535)
Q Consensus       466 ~f~~sre~~~l~~L~l~ay~~~~~~~~~~~~l~l~a~lc~L~~gD~V~A~~a~~~---~-~~F~~s~E~~~~  533 (535)
                      .              .       ..+. ....++.+|+|+|+.||.+.|.+++++   + |+|.++||+..+
T Consensus       192 ~--------------~-------~~~~-~~~~~~~~~~~~l~~~d~~~A~~~~~~~~~~~~~~~~sre~~~l  241 (290)
T d1qqea_         192 R--------------L-------SQWS-LKDYFLKKGLCQLAATDAVAAARTLQEGQSEDPNFADSRESNFL  241 (290)
T ss_dssp             T--------------T-------TGGG-HHHHHHHHHHHHHHTTCHHHHHHHHHGGGCC---------HHHH
T ss_pred             h--------------h-------hhhh-HHHHHHHHHHHHHHhccHHHHHHHHHHHHHhCCCccchHHHHHH
Confidence            0              0       1122 233358889999999999999999998   2 999999998654



>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfda_ a.7.14.1 (A:) Hypothetical protein 1500032H18Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure