Psyllid ID: psy11070


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------15
MPVATASSDSEGKTKELNKEIDDEEDAITEALQSLGINKEYFISSTGGKNSKKQQLWSCPIKNCNKRFTTLSNLKMHMVRHGKPLTLCCEELGCGRKFQTMKQYSTHLKEHSNVSAPYMCDYKGVCMSLTLKISFVKAVANNSKYPVA
ccccccccccccccccccccccccHHHHHHHHHccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccc
cccccccccccccccccccccccHHHHHHHHHHHccccHHHEEccccccccccccccEccccccccEEccHHHHHHHHHHcccccccEccccccccccccHHHHHHHHHHcccccccEEEcccccccEcccccHHHHHHHcccccccc
mpvatassdsegktkelnkeIDDEEDAITEALQSLginkeyfisstggknskkqqlwscpikncnkrFTTLSNLKmhmvrhgkpltlcceelgcgrkfqtMKQYSTHLkehsnvsapymcdykgvCMSLTLKISFVKAVannskypva
mpvatassdsegktkelnkeiddeEDAITEALQSLGINKEYFISstggknskkqqlwscpiknCNKRFTTLSNLKMHMVRHGKPLTLCCEELGCGRKFQTMKQYSTHLKEHSNVSAPYMCDYKGVCMSLTLKISFVkavannskypva
MPVATASSDSEGKTKELNKeiddeedaiteaLQSLGINKEYFISSTGGKNSKKQQLWSCPIKNCNKRFTTLSNLKMHMVRHGKPLTLCCEELGCGRKFQTMKQYSTHLKEHSNVSAPYMCDYKGVCMSLTLKISFVKAVANNSKYPVA
********************************QSLGINKEYFIS*********QQLWSCPIKNCNKRFTTLSNLKMHMVRHGKPLTLCCEELGCGRKFQTMKQYSTHLKEHSNVSAPYMCDYKGVCMSLTLKISFVKAVA********
*******************EIDDEEDAITEALQSLGINKEYFISSTGGKNSKKQQLWSCPIKNCNKRFTTLSNLKMHMVRHGKPLTLCCEELGCGRKFQTMKQYSTHLKEHSNVSAPYMCDYKGVCMSLTLKISFVK***********
******************KEIDDEEDAITEALQSLGINKEYFISS**********LWSCPIKNCNKRFTTLSNLKMHMVRHGKPLTLCCEELGCGRKFQTMKQYSTHLKEHSNVSAPYMCDYKGVCMSLTLKISFVKAVA********
********************IDDEEDAITEALQSLGINKEYFISST*****KKQQLWSCPIKNCNKRFTTLSNLKMHMVRHGKPLTLCCEELGCGRKFQTMKQYSTHLKEHSNVSAPYMCDYKGVCMSLTLKISFVKAVANNS*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPVATASSDSEGKxxxxxxxxxxxxxxxxxxxxxLGINKEYFISSTGGKNSKKQQLWSCPIKNCNKRFTTLSNLKMHMVRHGKPLTLCCEELGCGRKFQTMKQYSTHLKEHSNVSAPYMCDYKGVCMSLTLKISFVKAVANNSKYPVA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query148 2.2.26 [Sep-21-2011]
Q8C8V1 858 Zinc finger protein ZXDC yes N/A 0.5 0.086 0.355 2e-08
Q2QGD7 858 Zinc finger protein ZXDC yes N/A 0.5 0.086 0.355 2e-08
A2CE44 873 Zinc finger X-linked prot no N/A 0.5 0.084 0.355 8e-08
Q5XIU2 638 Zinc finger protein 143 O no N/A 0.628 0.145 0.3 9e-08
O70230 638 Zinc finger protein 143 O no N/A 0.628 0.145 0.3 9e-08
Q8BKX7 478 Zinc finger protein 410 O no N/A 0.506 0.156 0.315 2e-07
P52747 638 Zinc finger protein 143 O no N/A 0.628 0.145 0.29 3e-07
Q86VK4 478 Zinc finger protein 410 O no N/A 0.506 0.156 0.315 4e-07
Q5EAC5 467 Zinc finger protein 410 O no N/A 0.506 0.160 0.315 8e-07
P98169 803 Zinc finger X-linked prot no N/A 0.5 0.092 0.342 1e-06
>sp|Q8C8V1|ZXDC_MOUSE Zinc finger protein ZXDC OS=Mus musculus GN=Zxdc PE=2 SV=1 Back     alignment and function desciption
 Score = 57.8 bits (138), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 27/76 (35%), Positives = 41/76 (53%), Gaps = 2/76 (2%)

Query: 49  KNSKKQQLWSCPIKNCNKRFTTLSNLKMHMVRHGKPLTLCCEELGCGRKFQTMKQYSTHL 108
           ++  K + +SCP+  C K+FTT+ NLK HM  H +     CE   C  +F T  + ++H 
Sbjct: 231 QSHDKLRPFSCPVGGCGKKFTTVYNLKAHMKGHEQESLFKCEV--CAERFPTHAKLNSHQ 288

Query: 109 KEHSNVSAPYMCDYKG 124
           + H     PY CD+ G
Sbjct: 289 RSHFEPERPYKCDFPG 304




Cooperates with CIITA to promote transcription of MHC class I and MHC class II genes.
Mus musculus (taxid: 10090)
>sp|Q2QGD7|ZXDC_HUMAN Zinc finger protein ZXDC OS=Homo sapiens GN=ZXDC PE=1 SV=2 Back     alignment and function description
>sp|A2CE44|ZXDAB_MOUSE Zinc finger X-linked protein ZXDA/ZXDB OS=Mus musculus GN=Zxda PE=2 SV=1 Back     alignment and function description
>sp|Q5XIU2|ZN143_RAT Zinc finger protein 143 OS=Rattus norvegicus GN=Znf143 PE=2 SV=2 Back     alignment and function description
>sp|O70230|ZN143_MOUSE Zinc finger protein 143 OS=Mus musculus GN=Znf143 PE=1 SV=2 Back     alignment and function description
>sp|Q8BKX7|ZN410_MOUSE Zinc finger protein 410 OS=Mus musculus GN=Znf410 PE=2 SV=2 Back     alignment and function description
>sp|P52747|ZN143_HUMAN Zinc finger protein 143 OS=Homo sapiens GN=ZNF143 PE=1 SV=2 Back     alignment and function description
>sp|Q86VK4|ZN410_HUMAN Zinc finger protein 410 OS=Homo sapiens GN=ZNF410 PE=1 SV=2 Back     alignment and function description
>sp|Q5EAC5|ZN410_BOVIN Zinc finger protein 410 OS=Bos taurus GN=ZNF410 PE=2 SV=1 Back     alignment and function description
>sp|P98169|ZXDB_HUMAN Zinc finger X-linked protein ZXDB OS=Homo sapiens GN=ZXDB PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query148
322788189 1004 hypothetical protein SINV_08318 [Solenop 0.405 0.059 0.388 7e-10
332027659 997 Zinc finger X-linked protein ZXDB [Acrom 0.405 0.060 0.388 7e-10
307176119 945 Zinc finger X-linked protein ZXDB [Campo 0.398 0.062 0.409 2e-09
328788295 1033 PREDICTED: hypothetical protein LOC10057 0.405 0.058 0.375 5e-09
350399130 1026 PREDICTED: hypothetical protein LOC10074 0.405 0.058 0.375 6e-09
340714417 1026 PREDICTED: hypothetical protein LOC10065 0.405 0.058 0.375 7e-09
383863735 1034 PREDICTED: uncharacterized protein LOC10 0.351 0.050 0.375 4e-08
387020013 465 Zinc finger protein 410-like [Crotalus a 0.506 0.161 0.355 7e-08
427792249 591 Putative zxd family zinc finger c, parti 0.439 0.109 0.393 7e-08
427790989 604 Putative zxd family zinc finger c, parti 0.439 0.107 0.393 8e-08
>gi|322788189|gb|EFZ13971.1| hypothetical protein SINV_08318 [Solenopsis invicta] Back     alignment and taxonomy information
 Score = 68.9 bits (167), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 43/72 (59%)

Query: 53  KQQLWSCPIKNCNKRFTTLSNLKMHMVRHGKPLTLCCEELGCGRKFQTMKQYSTHLKEHS 112
           K++ + C ++ CN+RFTT+ NL  H   H +P  + C+   CG KFQT +    H+K H 
Sbjct: 507 KRKDYVCEVEGCNRRFTTVYNLWSHAKLHSRPNRIICQVPDCGEKFQTKRALELHMKSHD 566

Query: 113 NVSAPYMCDYKG 124
              APY+C ++G
Sbjct: 567 QRHAPYVCQHEG 578




Source: Solenopsis invicta

Species: Solenopsis invicta

Genus: Solenopsis

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|332027659|gb|EGI67727.1| Zinc finger X-linked protein ZXDB [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307176119|gb|EFN65817.1| Zinc finger X-linked protein ZXDB [Camponotus floridanus] Back     alignment and taxonomy information
>gi|328788295|ref|XP_003251098.1| PREDICTED: hypothetical protein LOC100577295 [Apis mellifera] Back     alignment and taxonomy information
>gi|350399130|ref|XP_003485431.1| PREDICTED: hypothetical protein LOC100745564 [Bombus impatiens] Back     alignment and taxonomy information
>gi|340714417|ref|XP_003395725.1| PREDICTED: hypothetical protein LOC100650640 [Bombus terrestris] Back     alignment and taxonomy information
>gi|383863735|ref|XP_003707335.1| PREDICTED: uncharacterized protein LOC100877567 [Megachile rotundata] Back     alignment and taxonomy information
>gi|387020013|gb|AFJ52124.1| Zinc finger protein 410-like [Crotalus adamanteus] Back     alignment and taxonomy information
>gi|427792249|gb|JAA61576.1| Putative zxd family zinc finger c, partial [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|427790989|gb|JAA60946.1| Putative zxd family zinc finger c, partial [Rhipicephalus pulchellus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query148
UNIPROTKB|F1NJ79368 ZNF410 "Uncharacterized protei 0.506 0.203 0.342 6e-10
UNIPROTKB|F1NEH8372 ZNF410 "Uncharacterized protei 0.506 0.201 0.342 6.1e-10
UNIPROTKB|F1RMH4 842 ZXDC "Uncharacterized protein" 0.533 0.093 0.365 1.4e-09
UNIPROTKB|F1MWD7 749 ZXDC "Uncharacterized protein" 0.533 0.105 0.353 2.5e-09
UNIPROTKB|G3MYH0 760 ZXDC "Uncharacterized protein" 0.533 0.103 0.353 2.6e-09
RGD|1561296 856 Zxdc "ZXD family zinc finger C 0.533 0.092 0.353 3e-09
MGI|MGI:1933108 858 Zxdc "ZXD family zinc finger C 0.533 0.092 0.353 3e-09
RGD|1563355 583 Zxdb "zinc finger, X-linked, d 0.533 0.135 0.353 3.7e-09
RGD|1585677 583 LOC683516 "similar to Zinc fin 0.533 0.135 0.353 3.7e-09
RGD|1585685 583 LOC683508 "similar to Zinc fin 0.533 0.135 0.353 3.7e-09
UNIPROTKB|F1NJ79 ZNF410 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 149 (57.5 bits), Expect = 6.0e-10, P = 6.0e-10
 Identities = 26/76 (34%), Positives = 40/76 (52%)

Query:    49 KNSKKQQLWSCPIKNCNKRFTTLSNLKMHMVRHGKPLTLCCEELGCGRKFQTMKQYSTHL 108
             K  +  + ++CP + C K F  L  LK+HM  H       C ELGCG++F T      HL
Sbjct:   249 KTHRNDRSFTCPAEGCGKSFYVLQRLKVHMRTHNGEKPFVCTELGCGKQFTTAGNLKNHL 308

Query:   109 KEHSNVSAPYMCDYKG 124
             + H+    P++C+ +G
Sbjct:   309 RIHTG-EKPFLCEAQG 323


GO:0003676 "nucleic acid binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
UNIPROTKB|F1NEH8 ZNF410 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1RMH4 ZXDC "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1MWD7 ZXDC "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|G3MYH0 ZXDC "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|1561296 Zxdc "ZXD family zinc finger C" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1933108 Zxdc "ZXD family zinc finger C" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1563355 Zxdb "zinc finger, X-linked, duplicated B" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|1585677 LOC683516 "similar to Zinc finger X-linked protein ZXDB" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|1585685 LOC683508 "similar to Zinc finger X-linked protein ZXDB" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 148
KOG2462|consensus279 99.89
KOG2462|consensus279 99.89
KOG1074|consensus 958 99.63
KOG3576|consensus267 99.63
KOG3623|consensus1007 99.6
KOG3623|consensus 1007 99.49
KOG3576|consensus267 99.48
KOG1074|consensus 958 99.25
KOG3608|consensus 467 99.24
PHA00733128 hypothetical protein 99.14
PHA0276855 hypothetical protein; Provisional 98.92
KOG3608|consensus 467 98.9
PHA0276855 hypothetical protein; Provisional 98.84
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.82
PLN03086567 PRLI-interacting factor K; Provisional 98.8
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.67
PHA00733128 hypothetical protein 98.61
PLN03086567 PRLI-interacting factor K; Provisional 98.59
KOG3993|consensus 500 98.35
PHA0061644 hypothetical protein 98.33
COG5189423 SFP1 Putative transcriptional repressor regulating 98.29
PHA0061644 hypothetical protein 98.27
PHA0073279 hypothetical protein 98.07
PHA0073279 hypothetical protein 98.06
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.81
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.71
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.71
KOG3993|consensus500 97.64
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.61
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.49
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.44
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.27
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.26
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.17
smart0035526 ZnF_C2H2 zinc finger. 96.92
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.74
PRK04860160 hypothetical protein; Provisional 96.67
smart0035526 ZnF_C2H2 zinc finger. 96.64
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 96.58
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.42
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 95.65
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 95.49
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 95.1
COG5048467 FOG: Zn-finger [General function prediction only] 94.37
KOG4173|consensus253 94.21
PRK04860160 hypothetical protein; Provisional 93.75
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 93.09
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 91.75
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 91.66
COG5048 467 FOG: Zn-finger [General function prediction only] 90.46
KOG2893|consensus 341 90.23
KOG1146|consensus 1406 89.69
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 88.04
KOG1146|consensus 1406 87.61
COG5189423 SFP1 Putative transcriptional repressor regulating 87.27
TIGR00373158 conserved hypothetical protein TIGR00373. This fam 86.13
PF0289245 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc 84.14
PRK06266178 transcription initiation factor E subunit alpha; V 83.59
>KOG2462|consensus Back     alignment and domain information
Probab=99.89  E-value=5.4e-24  Score=146.41  Aligned_cols=107  Identities=22%  Similarity=0.448  Sum_probs=70.7

Q ss_pred             HhhhhcCCCCcceeeccC---CCccC---CCCCceeCCCcccccccCChHHHHHHHHHhcCCCceecCcCCcccccCChH
Q psy11070         29 TEALQSLGINKEYFISST---GGKNS---KKQQLWSCPIKNCNKRFTTLSNLKMHMVRHGKPLTLCCEELGCGRKFQTMK  102 (148)
Q Consensus        29 ~~~~~~~~~~~~~~~~~~---~~~~h---~~~k~~~C~~~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~~~C~~~f~~~~  102 (148)
                      ...+.+..|++.|...++   |...|   ...+.+.|.  .|+|.|...-.|++|+++|+  .++.|.  .||+.|.+++
T Consensus       128 ~~r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~--~C~K~YvSmpALkMHirTH~--l~c~C~--iCGKaFSRPW  201 (279)
T KOG2462|consen  128 HPRYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCK--YCGKVYVSMPALKMHIRTHT--LPCECG--ICGKAFSRPW  201 (279)
T ss_pred             CCceeccccccccccccccchhhcccccccccccccCC--CCCceeeehHHHhhHhhccC--CCcccc--cccccccchH
Confidence            344566677777777665   33333   124556677  77777777777777777765  456677  6777777777


Q ss_pred             HHHHHHHHhcCCCCceeCCCCCCCcccccHHHHHHHHHhhCC
Q psy11070        103 QYSTHLKEHSNVSAPYMCDYKGVCMSLTLKISFVKAVANNSK  144 (148)
Q Consensus       103 ~l~~h~~~h~~~~k~~~C~~c~~~~~f~~~~~l~~h~~~h~~  144 (148)
                      .|+-|+|+|+| ||||.|..|+|  +|..+++|+-|+.+|+.
T Consensus       202 LLQGHiRTHTG-EKPF~C~hC~k--AFADRSNLRAHmQTHS~  240 (279)
T KOG2462|consen  202 LLQGHIRTHTG-EKPFSCPHCGK--AFADRSNLRAHMQTHSD  240 (279)
T ss_pred             HhhcccccccC-CCCccCCcccc--hhcchHHHHHHHHhhcC
Confidence            77777777777 67777777776  47777777777777654



>KOG2462|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR00373 conserved hypothetical protein TIGR00373 Back     alignment and domain information
>PF02892 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PRK06266 transcription initiation factor E subunit alpha; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query148
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 1e-04
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 1e-04
2gli_A155 Five-Finger GliDNA COMPLEX Length = 155 3e-04
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 6e-04
1tf6_A190 Co-crystal Structure Of Xenopus Tfiiia Zinc Finger 7e-04
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure

Iteration: 1

Score = 42.4 bits (98), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 21/71 (29%), Positives = 37/71 (52%), Gaps = 3/71 (4%) Query: 54 QQLWSCPIKNCNKRFTTLSNLKMHMVRHGKPLTLCCEELGCGRKFQTMKQYSTHLKEHSN 113 ++ ++CP+++C++RF+ SNL H+ H C C R F +TH++ H+ Sbjct: 2 ERPYACPVESCDRRFSDSSNLTRHIRIHTGQKPFQCR--ICMRNFSRSDHLTTHIRTHTG 59 Query: 114 VSAPYMCDYKG 124 P+ CD G Sbjct: 60 -EKPFACDICG 69
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1TF6|A Chain A, Co-crystal Structure Of Xenopus Tfiiia Zinc Finger Domain Bound To The 5s Ribosomal Rna Gene Internal Control Region Length = 190 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query148
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 2e-09
2epa_A72 Krueppel-like factor 10; transforming growth facto 2e-09
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 5e-09
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-06
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 1e-04
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 6e-09
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 7e-08
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 4e-04
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 1e-07
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 3e-07
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 8e-07
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 1e-05
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-06
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 2e-06
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 3e-06
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 4e-05
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 4e-06
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 5e-06
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 6e-04
1tf6_A190 Protein (transcription factor IIIA); complex (tran 1e-05
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 1e-05
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 6e-04
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 4e-05
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 3e-04
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 5e-04
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 5e-04
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 5e-04
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
 Score = 51.1 bits (123), Expect = 2e-09
 Identities = 23/80 (28%), Positives = 39/80 (48%), Gaps = 5/80 (6%)

Query: 44  SSTGGKNSKKQQLWSCPIKNCNKRFTTLSNLKMHMVRH-G-KPLTLCCEELGCGRKFQTM 101
           S + G + +K+++  C    C K +T  S+LK H+  H G KP    C   GC  +F   
Sbjct: 3   SGSSGPDLEKRRIHYCDYPGCTKVYTKSSHLKAHLRTHTGEKPYK--CTWEGCDWRFARS 60

Query: 102 KQYSTHLKEHSNVSAPYMCD 121
            + + H ++H+    P+ C 
Sbjct: 61  DELTRHYRKHTGAK-PFQCG 79


>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Length = 47 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Length = 37 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query148
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.91
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.88
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.87
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.86
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.86
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.86
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.86
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.86
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.85
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.85
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.85
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.84
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.84
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.84
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.83
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.83
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.82
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.82
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.82
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.82
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.81
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.8
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.8
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.79
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.79
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.78
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.77
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.77
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.75
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.75
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.72
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.71
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.7
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.69
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.68
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.68
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.67
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.66
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.64
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.64
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.64
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.63
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.63
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.62
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.61
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.61
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.61
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.61
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.6
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.6
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.6
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.59
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.59
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.59
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.58
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.57
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.56
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.56
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.55
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.55
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.55
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.55
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.55
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.55
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.54
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.53
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.52
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.51
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.51
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.5
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.49
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.47
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.46
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.45
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.45
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.42
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.41
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.41
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.39
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.39
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.39
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.39
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.39
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.38
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.38
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.38
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.38
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.38
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.38
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.38
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.38
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.38
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.38
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.38
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.38
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.38
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.38
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.38
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.38
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.38
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.38
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.37
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.37
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.37
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.37
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.37
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.37
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.37
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.37
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.37
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.37
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.37
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.37
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.37
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.37
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.36
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.36
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.36
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.36
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.36
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.36
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.36
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.36
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.36
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.35
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.35
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.35
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.33
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.33
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.33
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.32
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.32
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.32
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.32
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.32
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.31
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.31
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.31
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.31
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.31
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.31
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.31
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.31
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.31
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.31
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.31
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.31
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.3
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.3
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.3
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.3
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.3
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.3
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.3
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.3
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.3
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.3
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.3
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.29
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.29
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.29
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.29
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.29
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.29
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.29
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.29
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.29
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.29
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.29
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.29
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.29
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.29
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.28
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.28
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.28
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.28
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.28
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.28
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.28
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.28
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.28
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.28
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.27
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.27
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.27
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.27
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.27
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.27
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.26
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.26
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.26
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.26
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.26
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.26
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.26
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.26
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.26
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.26
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.26
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.25
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.25
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.25
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.25
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.25
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.25
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.25
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.25
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.25
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.25
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.25
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.24
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.24
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.24
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.24
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.24
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.24
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.24
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.24
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 99.23
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.23
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.23
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.23
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.23
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.23
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.23
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.22
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.22
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.22
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.22
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.22
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.22
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.22
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.22
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.22
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.22
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.22
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.21
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.21
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.21
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.21
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.21
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.2
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.2
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.2
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.2
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 99.2
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.2
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.2
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.2
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.2
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.2
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.2
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.2
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.2
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.2
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.19
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.19
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.19
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.19
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.19
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.19
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.19
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.19
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.18
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.18
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.18
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.18
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.17
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.17
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.17
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.17
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.16
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.16
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.15
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.15
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.15
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.15
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.15
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.14
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 99.14
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.13
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.12
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.12
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 99.11
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.11
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 99.1
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.09
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 99.09
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.09
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 99.09
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 99.09
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 99.08
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.95
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.93
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.92
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.91
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.9
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.9
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.89
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.88
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 98.87
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 98.87
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.85
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.84
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.84
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.81
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.79
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.79
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.78
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.78
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.77
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.76
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.74
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.73
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.72
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.71
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.7
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.7
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.69
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.69
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.66
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.63
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.63
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.61
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.61
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.61
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.61
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.6
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.58
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.58
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.57
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.57
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.55
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.51
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.49
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 98.47
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.47
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.45
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.44
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.43
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.41
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.4
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.39
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.38
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.36
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.35
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.35
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.32
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.32
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.31
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.31
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.3
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.3
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.26
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.25
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.25
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.25
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.24
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.24
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.22
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 98.21
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.52
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.19
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.45
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.43
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.43
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.4
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.11
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.1
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.06
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 98.06
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.03
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.23
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 96.78
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 96.36
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 95.17
2e72_A49 POGO transposable element with ZNF domain; zinc fi 95.12
2e72_A49 POGO transposable element with ZNF domain; zinc fi 95.12
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 94.91
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 94.87
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 89.31
2czr_A226 TBP-interacting protein; tata-binding protein (TBP 88.99
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 85.11
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
Probab=99.91  E-value=8.9e-25  Score=139.31  Aligned_cols=91  Identities=16%  Similarity=0.257  Sum_probs=87.1

Q ss_pred             CCccCCCCCceeCCCcccccccCChHHHHHHHHHhcCCCceecCcCCcccccCChHHHHHHHHHhcCCCCceeCCCCCCC
Q psy11070         47 GGKNSKKQQLWSCPIKNCNKRFTTLSNLKMHMVRHGKPLTLCCEELGCGRKFQTMKQYSTHLKEHSNVSAPYMCDYKGVC  126 (148)
Q Consensus        47 ~~~~h~~~k~~~C~~~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~~~C~~~f~~~~~l~~h~~~h~~~~k~~~C~~c~~~  126 (148)
                      +..+|.|+++|.|.  .|+++|.....|..|+++|++++||.|.  .|++.|.+...|..|+++|++ ++||.|.+||+ 
T Consensus        13 ~~~~h~Gek~y~C~--~C~k~F~~~~~L~~H~~~H~~~k~~~C~--~C~k~F~~~~~L~~H~~~H~~-~k~~~C~~C~k-   86 (133)
T 2lt7_A           13 YELIVDGRVYYICI--VCKRSYVCLTSLRRHFNIHSWEKKYPCR--YCEKVFPLAEYRTKHEIHHTG-ERRYQCLACGK-   86 (133)
T ss_dssp             EEEEETTEEEEEET--TTCCEESCHHHHHHHHHHHHCCSCEECS--SSSCEESSHHHHHHHHHHHHT-CCCEEESSSCC-
T ss_pred             ceeecCCCcCeECC--CCCCCcCCHHHHHHHHHHcCCCCCeeCC--ccCeecccccchhhhccccCC-CccccCCCCCC-
Confidence            56788999999999  9999999999999999999999999999  999999999999999999999 99999999998 


Q ss_pred             cccccHHHHHHHHHhhCC
Q psy11070        127 MSLTLKISFVKAVANNSK  144 (148)
Q Consensus       127 ~~f~~~~~l~~h~~~h~~  144 (148)
                       .|...+.|..|+++|++
T Consensus        87 -~F~~~~~L~~H~~~hh~  103 (133)
T 2lt7_A           87 -SFINYQFMSSHIKSVHS  103 (133)
T ss_dssp             -EESSHHHHHHHHHHHTC
T ss_pred             -CcCCHHHHHHHhHHhcC
Confidence             69999999999999874



>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2czr_A TBP-interacting protein; tata-binding protein (TBP), hyperthermophilic archaeon, Zn-finger motif, transcription; 2.30A {Thermococcus kodakarensis} SCOP: c.52.4.1 Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 148
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 6e-05
d1ubdc428 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger 2e-04
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 0.002
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 0.004
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 36.6 bits (84), Expect = 6e-05
 Identities = 16/48 (33%), Positives = 19/48 (39%), Gaps = 2/48 (4%)

Query: 64  CNKRFTTLSNLKMHMVRHGKPLTLCCEELGCGRKFQTMKQYSTHLKEH 111
           C K FT  S    HM  H       C    CG+KF+       H+K H
Sbjct: 8   CGKSFTHKSQRDRHMSMHLGLRPYGCGV--CGKKFKMKHHLVGHMKIH 53


>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query148
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.69
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.66
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.37
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.35
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.34
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.34
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.33
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 99.33
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.32
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.29
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.29
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 99.28
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.26
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.23
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.23
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.22
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.21
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.2
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 99.19
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 99.19
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.18
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.17
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.16
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.14
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 99.14
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 99.14
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.11
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.1
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.1
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.07
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.06
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.05
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.05
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.05
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.0
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 99.0
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.98
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.93
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.89
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.89
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.56
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.47
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.47
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.45
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.37
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.32
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 98.24
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.19
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.16
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.11
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 98.11
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.05
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.03
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.03
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 98.01
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.98
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.9
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.9
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.88
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 97.87
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.82
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 97.8
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.73
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.71
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.71
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.7
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.67
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.66
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.64
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.62
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.61
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.57
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.49
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.43
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.3
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.26
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.25
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.23
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.19
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.12
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.11
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.05
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 96.99
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 96.8
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 96.71
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 96.62
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.31
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.17
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 96.09
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 96.06
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.02
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 95.87
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.69
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 95.62
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.61
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 95.58
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 95.51
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.28
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 95.25
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 95.17
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 94.53
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 94.49
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 94.14
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 93.65
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 93.47
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 93.39
d1tf3a331 Transcription factor IIIA, TFIIIA {Xenopus laevis 93.11
d1tf3a331 Transcription factor IIIA, TFIIIA {Xenopus laevis 93.05
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 92.78
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 92.48
d2glia132 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 90.9
d2czra1218 TBP-interacting protein {Thermococcus kodakaraensi 90.57
d1y0jb136 U-shaped transcription factor, different fingers { 88.83
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 88.09
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 86.77
d1x3ca161 Zinc finger protein 292, ZNF292 {Human (Homo sapie 86.42
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 85.72
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 82.69
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 82.35
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 81.92
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.69  E-value=1.3e-17  Score=88.21  Aligned_cols=53  Identities=25%  Similarity=0.475  Sum_probs=42.5

Q ss_pred             CCceecCcCCcccccCChHHHHHHHHHhcCCCCceeCCCCCCCcccccHHHHHHHHHhh
Q psy11070         84 PLTLCCEELGCGRKFQTMKQYSTHLKEHSNVSAPYMCDYKGVCMSLTLKISFVKAVANN  142 (148)
Q Consensus        84 ~~~~~c~~~~C~~~f~~~~~l~~h~~~h~~~~k~~~C~~c~~~~~f~~~~~l~~h~~~h  142 (148)
                      ++||.|.   ||+.|.....|..|+++|+| ++||.|.+||+  .|.+.+.|..|+++|
T Consensus         1 EK~y~C~---Cgk~F~~~~~l~~H~~~Ht~-ekpy~C~~C~k--~F~~~~~L~~H~r~H   53 (53)
T d2csha1           1 DKLYPCQ---CGKSFTHKSQRDRHMSMHLG-LRPYGCGVCGK--KFKMKHHLVGHMKIH   53 (53)
T ss_dssp             CCCEECT---TSCEESSHHHHHHHHHHHSC-CCSEECTTTSC--EESSSHHHHHHHTTT
T ss_pred             CcCCCCC---CCCeECCHHHhHHHhhcccc-ccCCcCCCcCC--EecCHHHHHHHHhcC
Confidence            5778883   88888888888888888888 88888888887  588888888888765



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a3 g.37.1.1 (A:71-101) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1tf3a3 g.37.1.1 (A:71-101) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2glia1 g.37.1.1 (A:103-134) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2czra1 c.52.4.1 (A:1-218) TBP-interacting protein {Thermococcus kodakaraensis [TaxId: 311400]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x3ca1 g.37.1.1 (A:8-68) Zinc finger protein 292, ZNF292 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure