Psyllid ID: psy11192

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180
MFSMSTGPQYWGRINPEWSLCNKGRRQSPINVDPEHLLFDPHLTELEIDKNKVSGVLQNTGQSLVFRVDKDTKHHVNISGGPLAYRYQFEEFYFRYGQVNDKGSEHQIHGYSFPGEIQLYGYNAELYHNMSEAQHKPQGIVGISLMIQLGERSNDELRIVTTNFNKVLFRDFVVRYVNKV
ccccccccccccccccccccccccccccccEEccccEEEccccccEEEcccccEEEEEEcccEEEEEEccccccEEEEEEccccccEEEEEEEEEEccccccccccccccccccEEEEEEEEcccccccHHHHHcccccEEEEEEEEEEcccccHHHHHHHHHccccccccEEEEccccc
ccccccccHHHHHHccHHHHccccccccccEEcccccEEccccccEEEEcccccEEEEEccEEEEEEEcccccccEEEEcccccccEEEEEEEEEEcccccccccEEEccccccEEEEEEEcccHHcccHHHHHHccccEEEEEEEEEEcccccHHHHHHHHHHHHHcccccEEEEcccc
mfsmstgpqywgrinpewslcnkgrrqspinvdpehllfdphlteleidknkvsgVLQNTGQSLVfrvdkdtkhhvnisggplayrYQFEEFYFRygqvndkgsehqihgysfpgeiqlYGYNAELYHNmseaqhkpqgiVGISLMIQLGERSNDELRIVTTNFNKVLFRDFVVRYVNKV
mfsmstgpqywgrinPEWSLCNKGRRQSPINVDPEHLLFDPHLTELEIDKNKVSGVLQNTGQSLVFRVDKDTKHHVNISGGPLAYRYQFEEFYFRYGQVNDKGSEHQIHGYSFPGEIQLYGYNAELYHNMSEAQHKPQGIVGISLMIQLGERSNDELRIVTtnfnkvlfrdfVVRYVNKV
MFSMSTGPQYWGRINPEWSLCNKGRRQSPINVDPEHLLFDPHLTELEIDKNKVSGVLQNTGQSLVFRVDKDTKHHVNISGGPLAyryqfeefyfryGQVNDKGSEHQIHGYSFPGEIQLYGYNAELYHNMSEAQHKPQGIVGISLMIQLGERSNDELRIVTTNFNKVLFRDFVVRYVNKV
*********YWGRINPEWSLCNKGRRQSPINVDPEHLLFDPHLTELEIDKNKVSGVLQNTGQSLVFRVDKDTKHHVNISGGPLAYRYQFEEFYFRYGQVNDKGSEHQIHGYSFPGEIQLYGYNAELYHNMSEAQHKPQGIVGISLMIQLGERSNDELRIVTTNFNKVLFRDFVVRYV***
MFSMSTGPQYWGRINPEWSLCNKGRRQSPINVDPEHLLFDPHLTELEIDKNKVSGVLQNTGQSLVFRVDKDTKHHVNISGGPLAYRYQFEEFYFRYGQVNDKGSEHQIHGYSFPGEIQLYGYNAELYHNMSEAQHKPQGIVGISLMIQLGERSNDELRIVTTNFNKVLFRDFV*******
********QYWGRINPEWSLCNKGRRQSPINVDPEHLLFDPHLTELEIDKNKVSGVLQNTGQSLVFRVDKDTKHHVNISGGPLAYRYQFEEFYFRYGQVNDKGSEHQIHGYSFPGEIQLYGYNAELYHNMSEAQHKPQGIVGISLMIQLGERSNDELRIVTTNFNKVLFRDFVVRYVNKV
****STGPQYWGRINPEWSLCNKGRRQSPINVDPEHLLFDPHLTELEIDKNKVSGVLQNTGQSLVFRVDKDTKHHVNISGGPLAYRYQFEEFYFRYGQVNDKGSEHQIHGYSFPGEIQLYGYNAELYHNMSEAQHKPQGIVGISLMIQLGERSNDELRIVTTNFNKVLFRDFVVRYV*K*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFSMSTGPQYWGRINPEWSLCNKGRRQSPINVDPEHLLFDPHLTELEIDKNKVSGVLQNTGQSLVFRVDKDTKHHVNISGGPLAYRYQFEEFYFRYGQVNDKGSEHQIHGYSFPGEIQLYGYNAELYHNMSEAQHKPQGIVGISLMIQLGERSNDELRIVTTNFNKVLFRDFVVRYVNKV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query180 2.2.26 [Sep-21-2011]
Q5R4U0 328 Carbonic anhydrase-relate yes N/A 0.905 0.496 0.431 2e-37
P61215 328 Carbonic anhydrase-relate yes N/A 0.905 0.496 0.431 2e-37
Q9N085 328 Carbonic anhydrase-relate N/A N/A 0.905 0.496 0.431 2e-37
Q9NS85 328 Carbonic anhydrase-relate yes N/A 0.905 0.496 0.431 2e-37
A0JN41 328 Carbonic anhydrase-relate yes N/A 0.905 0.496 0.431 2e-37
Q18932 337 Putative carbonic anhydra yes N/A 0.944 0.504 0.373 1e-33
Q95203 328 Carbonic anhydrase-relate N/A N/A 0.888 0.487 0.385 4e-28
O70354 328 Carbonic anhydrase-relate no N/A 0.888 0.487 0.380 1e-27
Q5R665 328 Carbonic anhydrase-relate yes N/A 0.888 0.487 0.380 1e-27
O75493 328 Carbonic anhydrase-relate no N/A 0.888 0.487 0.380 1e-27
>sp|Q5R4U0|CAH10_PONAB Carbonic anhydrase-related protein 10 OS=Pongo abelii GN=CA10 PE=2 SV=1 Back     alignment and function desciption
 Score =  154 bits (390), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 75/174 (43%), Positives = 112/174 (64%), Gaps = 11/174 (6%)

Query: 8   PQYWGRINPEWSLCNKGRRQSPINVDPEHLLFDPHLTELEIDK--NKVSGVLQNTGQSLV 65
           P +WG +N  W+LC+ G+RQSP+N++  H++FDP LT L I+    KVSG + NTG+ + 
Sbjct: 47  PSFWGLVNSAWNLCSVGKRQSPVNIETSHMIFDPFLTPLRINTGGRKVSGTMYNTGRHVS 106

Query: 66  FRVDKDTKHHVNISGGPLAYRYQFEEFYFRYGQVNDKGSEHQIHGYSFPGEIQLYGYNAE 125
            R+DK+  H VNISGGP+ Y ++ EE    +G  + +GSEH ++G +F GE+QL  YN E
Sbjct: 107 LRLDKE--HLVNISGGPMTYSHRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHE 164

Query: 126 LYHNMSEAQHKPQGIVGISLMIQLGERSNDELRIVTTNFNKVLFRDFVVRYVNK 179
           LY N++EA   P G+V +S+ I++ + SN  L       N++L RD + R   K
Sbjct: 165 LYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFL-------NRMLNRDTITRITYK 211
Does not have a catalytic activity.
Pongo abelii (taxid: 9601)
>sp|P61215|CAH10_MOUSE Carbonic anhydrase-related protein 10 OS=Mus musculus GN=Ca10 PE=2 SV=1 Back     alignment and function description
>sp|Q9N085|CAH10_MACFA Carbonic anhydrase-related protein 10 OS=Macaca fascicularis GN=CA10 PE=2 SV=1 Back     alignment and function description
>sp|Q9NS85|CAH10_HUMAN Carbonic anhydrase-related protein 10 OS=Homo sapiens GN=CA10 PE=2 SV=1 Back     alignment and function description
>sp|A0JN41|CAH10_BOVIN Carbonic anhydrase-related protein 10 OS=Bos taurus GN=CA10 PE=2 SV=1 Back     alignment and function description
>sp|Q18932|CAH2_CAEEL Putative carbonic anhydrase-like protein 2 OS=Caenorhabditis elegans GN=cah-2 PE=1 SV=3 Back     alignment and function description
>sp|Q95203|CAH11_SHEEP Carbonic anhydrase-related protein 11 OS=Ovis aries GN=CA11 PE=2 SV=2 Back     alignment and function description
>sp|O70354|CAH11_MOUSE Carbonic anhydrase-related protein 11 OS=Mus musculus GN=Ca11 PE=2 SV=2 Back     alignment and function description
>sp|Q5R665|CAH11_PONAB Carbonic anhydrase-related protein 11 OS=Pongo abelii GN=CA11 PE=2 SV=1 Back     alignment and function description
>sp|O75493|CAH11_HUMAN Carbonic anhydrase-related protein 11 OS=Homo sapiens GN=CA11 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query180
242011739 285 conserved hypothetical protein [Pediculu 0.911 0.575 0.780 3e-73
357609138 753 hypothetical protein KGM_18224 [Danaus p 0.955 0.228 0.672 6e-72
347964361 331 AGAP000715-PA [Anopheles gambiae str. PE 0.916 0.498 0.751 2e-71
223451995 341 CA-related protein [Anopheles gambiae] 0.916 0.483 0.751 3e-71
195448517 692 GK25008 [Drosophila willistoni] gi|19416 0.927 0.241 0.742 1e-70
194763495 331 GF21031 [Drosophila ananassae] gi|190618 0.927 0.504 0.742 7e-70
157117560 332 carbonic anhydrase [Aedes aegypti] gi|10 0.916 0.496 0.733 7e-70
195133280 328 GI16210 [Drosophila mojavensis] gi|19390 0.927 0.509 0.742 8e-70
195480369 335 GE15736 [Drosophila yakuba] gi|194188761 0.927 0.498 0.742 8e-70
195565641 332 GD16866 [Drosophila simulans] gi|1942037 0.927 0.503 0.742 9e-70
>gi|242011739|ref|XP_002426604.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212510753|gb|EEB13866.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  279 bits (714), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 128/164 (78%), Positives = 146/164 (89%)

Query: 7   GPQYWGRINPEWSLCNKGRRQSPINVDPEHLLFDPHLTELEIDKNKVSGVLQNTGQSLVF 66
           GP +WG INP+W+LC KGRRQSPINV+P+ LLFDP L  + +DK+KVSG LQNTGQSLVF
Sbjct: 9   GPGFWGLINPQWNLCTKGRRQSPINVEPDKLLFDPFLRHIHLDKHKVSGTLQNTGQSLVF 68

Query: 67  RVDKDTKHHVNISGGPLAYRYQFEEFYFRYGQVNDKGSEHQIHGYSFPGEIQLYGYNAEL 126
           R+DK+TKHHVNISGGPLAYRYQFEEFY  YG  N +GSEHQIHGYSFPGEIQLYG+NAEL
Sbjct: 69  RIDKETKHHVNISGGPLAYRYQFEEFYIHYGIENHQGSEHQIHGYSFPGEIQLYGFNAEL 128

Query: 127 YHNMSEAQHKPQGIVGISLMIQLGERSNDELRIVTTNFNKVLFR 170
           YHNMSEAQHKPQG+VGISLM+Q+GE  N ELRI+T+ FNKVL+R
Sbjct: 129 YHNMSEAQHKPQGVVGISLMVQIGETPNPELRIITSTFNKVLYR 172

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|357609138|gb|EHJ66315.1| hypothetical protein KGM_18224 [Danaus plexippus] Back     alignment and taxonomy information
>gi|347964361|ref|XP_311252.5| AGAP000715-PA [Anopheles gambiae str. PEST] gi|333467495|gb|EAA06900.6| AGAP000715-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|223451995|gb|ACM89452.1| CA-related protein [Anopheles gambiae] Back     alignment and taxonomy information
>gi|195448517|ref|XP_002071693.1| GK25008 [Drosophila willistoni] gi|194167778|gb|EDW82679.1| GK25008 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|194763495|ref|XP_001963868.1| GF21031 [Drosophila ananassae] gi|190618793|gb|EDV34317.1| GF21031 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|157117560|ref|XP_001658826.1| carbonic anhydrase [Aedes aegypti] gi|108875997|gb|EAT40222.1| AAEL008031-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|195133280|ref|XP_002011067.1| GI16210 [Drosophila mojavensis] gi|193907042|gb|EDW05909.1| GI16210 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|195480369|ref|XP_002101237.1| GE15736 [Drosophila yakuba] gi|194188761|gb|EDX02345.1| GE15736 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|195565641|ref|XP_002106407.1| GD16866 [Drosophila simulans] gi|194203783|gb|EDX17359.1| GD16866 [Drosophila simulans] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query180
FB|FBgn0029962 333 CG1402 [Drosophila melanogaste 0.961 0.519 0.662 9e-61
FB|FBgn0052698 327 CG32698 [Drosophila melanogast 0.905 0.498 0.494 5e-44
UNIPROTKB|Q9NS85 328 CA10 "Carbonic anhydrase-relat 0.905 0.496 0.413 4.1e-33
MGI|MGI:1919855 328 Car10 "carbonic anhydrase 10" 0.905 0.496 0.413 4.1e-33
ZFIN|ZDB-GENE-051030-123 328 ca10a "carbonic anhydrase Xa" 0.905 0.496 0.402 2.9e-32
WB|WBGene00000280 337 cah-2 [Caenorhabditis elegans 0.911 0.486 0.369 4.4e-29
WB|WBGene00000279365 cah-1 [Caenorhabditis elegans 0.694 0.342 0.330 1.5e-24
UNIPROTKB|Q95203 328 CA11 "Carbonic anhydrase-relat 0.888 0.487 0.374 1.6e-24
RGD|735155 328 Car11 "carbonic anhydrase 11" 0.888 0.487 0.368 2e-24
MGI|MGI:1336193 328 Car11 "carbonic anhydrase 11" 0.888 0.487 0.368 2.6e-24
FB|FBgn0029962 CG1402 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 622 (224.0 bits), Expect = 9.0e-61, P = 9.0e-61
 Identities = 116/175 (66%), Positives = 138/175 (78%)

Query:     6 TGPQYWGRINPEWSLCNKGRRQSPINVDPEHLLFDPHLTELEIDKNKVSGVLQNTGQSLV 65
             +GP +WG INP+W++CNKGRRQSPI+V P+ LLFDP+L  L IDK+KVSG L NTGQSLV
Sbjct:    45 SGPSFWGLINPQWNMCNKGRRQSPIDVVPDKLLFDPYLRPLHIDKHKVSGTLHNTGQSLV 104

Query:    66 FRVDKDTKHHVNISGGPLAXXXXXXXXXXXXGQVNDKGSEHQIHGYSFPGEIQLYGYNAE 125
             FRVDKDTK HVNISGGPLA            G  N +GSEH I GYSFPGEIQ+YG+N E
Sbjct:   105 FRVDKDTKQHVNISGGPLAYRYQFEEIYIHYGTENVRGSEHFIQGYSFPGEIQIYGFNKE 164

Query:   126 LYHNMSEAQHKPQGIVGISLMIQLGERSNDELRIVTTNFNKVLFRDFV--VRYVN 178
             LYHNMSEAQHK QGIVG+SLM+Q+GE  N ELRI+T+ FNKVL+R F   +R+++
Sbjct:   165 LYHNMSEAQHKSQGIVGLSLMVQIGETPNPELRIITSTFNKVLYRGFSTPIRHIS 219
GO:0004089 "carbonate dehydratase activity" evidence=ISS
GO:0008270 "zinc ion binding" evidence=IEA
GO:0005576 "extracellular region" evidence=IEA
FB|FBgn0052698 CG32698 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NS85 CA10 "Carbonic anhydrase-related protein 10" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1919855 Car10 "carbonic anhydrase 10" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-051030-123 ca10a "carbonic anhydrase Xa" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
WB|WBGene00000280 cah-2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
WB|WBGene00000279 cah-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q95203 CA11 "Carbonic anhydrase-related protein 11" [Ovis aries (taxid:9940)] Back     alignment and assigned GO terms
RGD|735155 Car11 "carbonic anhydrase 11" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1336193 Car11 "carbonic anhydrase 11" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer4.2.1LOW CONFIDENCE prediction!
4th Layer4.2.1.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query180
cd03121256 cd03121, alpha_CARP_X_XI_like, Carbonic anhydrase 2e-81
smart01057247 smart01057, Carb_anhydrase, Eukaryotic-type carbon 3e-42
cd00326227 cd00326, alpha_CA, Carbonic anhydrase alpha (verte 1e-39
cd03149236 cd03149, alpha_CA_VII, Carbonic anhydrase alpha, C 2e-25
cd03122253 cd03122, alpha_CARP_receptor_like, Carbonic anhydr 2e-24
pfam00194238 pfam00194, Carb_anhydrase, Eukaryotic-type carboni 2e-23
cd03119259 cd03119, alpha_CA_I_II_III_XIII, Carbonic anhydras 3e-22
cd03118236 cd03118, alpha_CA_V, Carbonic anhydrase alpha, CA 1e-21
cd03120256 cd03120, alpha_CARP_VIII, Carbonic anhydrase alpha 2e-20
cd03117234 cd03117, alpha_CA_IV_XV_like, Carbonic anhydrase a 2e-19
cd03124216 cd03124, alpha_CA_prokaryotic_like, Carbonic anhyd 8e-18
cd03123248 cd03123, alpha_CA_VI_IX_XII_XIV, Carbonic anhydras 2e-16
cd03126249 cd03126, alpha_CA_XII_XIV, Carbonic anhydrase alph 3e-15
cd03150247 cd03150, alpha_CA_IX, Carbonic anhydrase alpha, is 7e-15
COG3338250 COG3338, Cah, Carbonic anhydrase [Inorganic ion tr 2e-10
PLN02179235 PLN02179, PLN02179, carbonic anhydrase 2e-07
cd03125249 cd03125, alpha_CA_VI, Carbonic anhydrase alpha, is 9e-07
PLN02202284 PLN02202, PLN02202, carbonate dehydratase 7e-04
>gnl|CDD|239395 cd03121, alpha_CARP_X_XI_like, Carbonic anhydrase alpha related protein: groups X, XI and related proteins Back     alignment and domain information 
 Score =  241 bits (617), Expect = 2e-81
 Identities = 85/172 (49%), Positives = 116/172 (67%), Gaps = 5/172 (2%)

Query: 7   GPQYWGRINPEWSLCNKGRRQSPINVDPEHLLFDPHLTELEIDKN-KVSGVLQNTGQSLV 65
           GP +WG +N  W+LC+KGRRQSP++++P  LLFDP LT L ID   KVSG   NTG+ + 
Sbjct: 1   GPSFWGLVNSAWNLCSKGRRQSPVDIEPSRLLFDPFLTPLRIDTGRKVSGTFYNTGRHVS 60

Query: 66  FRVDKDTKHHVNISGGPLAYRYQFEEFYFRYGQVNDKGSEHQIHGYSFPGEIQLYGYNAE 125
           FR DKD    VNISGGPL+YRY+ EE    +G+ +++GSEH ++G +FPGE+QL  YN+E
Sbjct: 61  FRPDKD--PVVNISGGPLSYRYRLEEIRLHFGREDEQGSEHTVNGQAFPGEVQLIHYNSE 118

Query: 126 LYHNMSEAQHKPQGIVGISLMIQLGERSNDELRIVT--TNFNKVLFRDFVVR 175
           LY N SEA   P G+V +SL +++GE SN ELR +T       + ++     
Sbjct: 119 LYPNFSEASKSPNGLVIVSLFVKIGETSNPELRRLTNRDTITSIRYKGDAYF 170

This subgroup contains carbonic anhydrase related proteins (CARPs) X and XI, which have been implicated in various biological processes of the central nervous system. CARPs are sequence similar to carbonic anhydrases. Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism. CARPs have lost conserved histidines involved in zinc binding and consequently their catalytic activity. CARP XI plays a role in the development of gastrointestinal stromal tumors. Length = 256
>gnl|CDD|215000 smart01057, Carb_anhydrase, Eukaryotic-type carbonic anhydrase Back     alignment and domain information
>gnl|CDD|238200 cd00326, alpha_CA, Carbonic anhydrase alpha (vertebrate-like) group Back     alignment and domain information
>gnl|CDD|239402 cd03149, alpha_CA_VII, Carbonic anhydrase alpha, CA isozyme VII_like subgroup Back     alignment and domain information
>gnl|CDD|239396 cd03122, alpha_CARP_receptor_like, Carbonic anhydrase alpha related protein, receptor_like subfamily Back     alignment and domain information
>gnl|CDD|201071 pfam00194, Carb_anhydrase, Eukaryotic-type carbonic anhydrase Back     alignment and domain information
>gnl|CDD|239393 cd03119, alpha_CA_I_II_III_XIII, Carbonic anhydrase alpha, isozymes I, II, and III and XIII Back     alignment and domain information
>gnl|CDD|239392 cd03118, alpha_CA_V, Carbonic anhydrase alpha, CA isozyme V_like subgroup Back     alignment and domain information
>gnl|CDD|239394 cd03120, alpha_CARP_VIII, Carbonic anhydrase alpha related protein, group VIII Back     alignment and domain information
>gnl|CDD|239391 cd03117, alpha_CA_IV_XV_like, Carbonic anhydrase alpha, CA_IV, CA_XV, like isozymes Back     alignment and domain information
>gnl|CDD|239398 cd03124, alpha_CA_prokaryotic_like, Carbonic anhydrase alpha, prokaryotic-like subfamily Back     alignment and domain information
>gnl|CDD|239397 cd03123, alpha_CA_VI_IX_XII_XIV, Carbonic anhydrase alpha, isozymes VI, IX, XII and XIV Back     alignment and domain information
>gnl|CDD|239400 cd03126, alpha_CA_XII_XIV, Carbonic anhydrase alpha, isozymes XII and XIV Back     alignment and domain information
>gnl|CDD|239403 cd03150, alpha_CA_IX, Carbonic anhydrase alpha, isozyme IX Back     alignment and domain information
>gnl|CDD|225875 COG3338, Cah, Carbonic anhydrase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|177835 PLN02179, PLN02179, carbonic anhydrase Back     alignment and domain information
>gnl|CDD|239399 cd03125, alpha_CA_VI, Carbonic anhydrase alpha, isozyme VI Back     alignment and domain information
>gnl|CDD|177853 PLN02202, PLN02202, carbonate dehydratase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 180
cd03121256 alpha_CARP_X_XI_like Carbonic anhydrase alpha rela 100.0
cd03119259 alpha_CA_I_II_III_XIII Carbonic anhydrase alpha, i 100.0
cd03122253 alpha_CARP_receptor_like Carbonic anhydrase alpha 100.0
cd03150247 alpha_CA_IX Carbonic anhydrase alpha, isozyme IX. 100.0
PF00194256 Carb_anhydrase: Eukaryotic-type carbonic anhydrase 100.0
cd03126249 alpha_CA_XII_XIV Carbonic anhydrase alpha, isozyme 100.0
cd03123248 alpha_CA_VI_IX_XII_XIV Carbonic anhydrase alpha, i 100.0
cd03120256 alpha_CARP_VIII Carbonic anhydrase alpha related p 100.0
cd03125249 alpha_CA_VI Carbonic anhydrase alpha, isozyme VI. 100.0
KOG0382|consensus262 100.0
cd03149236 alpha_CA_VII Carbonic anhydrase alpha, CA isozyme 100.0
cd03118236 alpha_CA_V Carbonic anhydrase alpha, CA isozyme V_ 100.0
cd03117234 alpha_CA_IV_XV_like Carbonic anhydrase alpha, CA_I 100.0
cd00326227 alpha_CA Carbonic anhydrase alpha (vertebrate-like 100.0
PLN02202284 carbonate dehydratase 100.0
PLN02179235 carbonic anhydrase 100.0
cd03124216 alpha_CA_prokaryotic_like Carbonic anhydrase alpha 100.0
COG3338250 Cah Carbonic anhydrase [Inorganic ion transport an 100.0
>cd03121 alpha_CARP_X_XI_like Carbonic anhydrase alpha related protein: groups X, XI and related proteins Back     alignment and domain information 
Probab=100.00  E-value=1.9e-53  Score=348.18  Aligned_cols=169  Identities=50%  Similarity=0.943  Sum_probs=155.5

Q ss_pred             CCCCccccCCCcccCCCCCCCCCceeeCCCceeCCCCCceeeecc-CeeeEEEecCcEEEEEeCCCCCeeEEEecCCCCc
Q psy11192          7 GPQYWGRINPEWSLCNKGRRQSPINVDPEHLLFDPHLTELEIDKN-KVSGVLQNTGQSLVFRVDKDTKHHVNISGGPLAY   85 (180)
Q Consensus         7 gP~~W~~~~p~~~~C~~G~~QSPInI~~~~~~~~~~l~~l~~~y~-~~~~~i~N~G~tv~v~~~~~~~~~~~i~Gg~l~~   85 (180)
                      ||++|+.++|+|..|++|++||||||.+..+.+++.+.+|.++|. ....+|.|+||||+|.+..+.  .+.++||+|..
T Consensus         1 GP~~W~~~~~~~~~C~~G~~QSPI~I~~~~~~~~~~l~~L~~~~~~~~~~~l~N~Ghtv~v~~~~~~--~~~i~gG~l~~   78 (256)
T cd03121           1 GPSFWGLVNSAWNLCSKGRRQSPVDIEPSRLLFDPFLTPLRIDTGRKVSGTFYNTGRHVSFRPDKDP--VVNISGGPLSY   78 (256)
T ss_pred             CCCcccccCCchhhccCCCCcCCEeEeccceEECCCCCceeeccCCCCceEEEECCEEEEEEECCCC--ceEEeCCCCCC
Confidence            799999999999999899999999999988877788899999887 667899999999999987542  46688999999


Q ss_pred             ceEeEEEEEEeeCCCCCCCceeeccCCCCceeEEEeeccccCCChhHhhcCCCcEEEEEEEEEeCCCCChhHHHHHHhhh
Q psy11192         86 RYQFEEFYFRYGQVNDKGSEHQIHGYSFPGEIQLYGYNAELYHNMSEAQHKPQGIVGISLMIQLGERSNDELRIVTTNFN  165 (180)
Q Consensus        86 ~Y~l~q~HfHWG~~~~~gSEH~idG~~~~~E~H~Vh~~~~~y~~~~eA~~~~~glaVlav~~~~~~~~n~~l~~i~~~l~  165 (180)
                      +|+|.|||||||+++..||||+|||++|||||||||++.++|.+++||+++++++|||||||++++.+|+.|++|++.|.
T Consensus        79 ~Y~l~Q~HFHwG~~~~~gSEH~idG~~yp~E~HlVH~n~~~y~~~~~A~~~~~glaVvgv~~~~g~~~n~~l~~i~~~l~  158 (256)
T cd03121          79 RYRLEEIRLHFGREDEQGSEHTVNGQAFPGEVQLIHYNSELYPNFSEASKSPNGLVIVSLFVKIGETSNPELRRLTNRDT  158 (256)
T ss_pred             cEEEEEEEEecCCCCCCCCceeeCCcccCceEEEEEEcccccCCHHHHhcCCCCeEEEEEEEeecccCCHHHHHHHHhcc
Confidence            99999999999999999999999999999999999999967999999999999999999999999767999999999999


Q ss_pred             --hccCCCeEEEec
Q psy11192        166 --KVLFRDFVVRYV  177 (180)
Q Consensus       166 --~i~~~~~~~~~~  177 (180)
                        .|..+++++.+.
T Consensus       159 ~~~i~~~~~~~~~~  172 (256)
T cd03121         159 ITSIRYKGDAYFLQ  172 (256)
T ss_pred             ccccccCCceeecC
Confidence              998888887653

This subgroup contains carbonic anhydrase related proteins (CARPs) X and XI, which have been implicated in various biological processes of the central nervous system. CARPs are sequence similar to carbonic anhydrases. Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism. CARPs have lost conserved histidines involved in zinc binding and consequently their catalytic activity. CARP XI plays a role in the development of gastrointestinal stromal tumors.
>cd03119 alpha_CA_I_II_III_XIII Carbonic anhydrase alpha, isozymes I, II, and III and XIII Back     alignment and domain information
>cd03122 alpha_CARP_receptor_like Carbonic anhydrase alpha related protein, receptor_like subfamily Back     alignment and domain information
>cd03150 alpha_CA_IX Carbonic anhydrase alpha, isozyme IX Back     alignment and domain information
>PF00194 Carb_anhydrase: Eukaryotic-type carbonic anhydrase; InterPro: IPR001148 Carbonic anhydrases (CA: 4 Back     alignment and domain information
>cd03126 alpha_CA_XII_XIV Carbonic anhydrase alpha, isozymes XII and XIV Back     alignment and domain information
>cd03123 alpha_CA_VI_IX_XII_XIV Carbonic anhydrase alpha, isozymes VI, IX, XII and XIV Back     alignment and domain information
>cd03120 alpha_CARP_VIII Carbonic anhydrase alpha related protein, group VIII Back     alignment and domain information
>cd03125 alpha_CA_VI Carbonic anhydrase alpha, isozyme VI Back     alignment and domain information
>KOG0382|consensus Back     alignment and domain information
>cd03149 alpha_CA_VII Carbonic anhydrase alpha, CA isozyme VII_like subgroup Back     alignment and domain information
>cd03118 alpha_CA_V Carbonic anhydrase alpha, CA isozyme V_like subgroup Back     alignment and domain information
>cd03117 alpha_CA_IV_XV_like Carbonic anhydrase alpha, CA_IV, CA_XV, like isozymes Back     alignment and domain information
>cd00326 alpha_CA Carbonic anhydrase alpha (vertebrate-like) group Back     alignment and domain information
>PLN02202 carbonate dehydratase Back     alignment and domain information
>PLN02179 carbonic anhydrase Back     alignment and domain information
>cd03124 alpha_CA_prokaryotic_like Carbonic anhydrase alpha, prokaryotic-like subfamily Back     alignment and domain information
>COG3338 Cah Carbonic anhydrase [Inorganic ion transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query180
3da2_A262 X-Ray Structure Of Human Carbonic Anhydrase 13 In C 2e-15
3czv_A264 Crystal Structure Of The Human Carbonic Anhydrase X 2e-15
3mdz_A281 Crystal Structure Of Human Carbonic Anhydrase Vii [ 2e-15
3ml5_A269 Crystal Structure Of The C183sC217S MUTANT OF HUMAN 3e-15
1keq_A248 Crystal Structure Of F65aY131C CARBONIC ANHYDRASE V 1e-14
1dmx_A248 Murine Mitochondrial Carbonic Anyhdrase V At 2.45 A 5e-14
1urt_A248 Murine Carbonic Anhydrase V Length = 248 1e-13
1j9w_A260 Solution Structure Of The Cai Michigan 1 Variant Le 1e-11
7ca2_A260 Engineering The Hydrophobic Pocket Of Carbonic Anhy 1e-11
2w2j_A291 Crystal Structure Of The Human Carbonic Anhydrase R 3e-11
1flj_A260 Crystal Structure Of S-Glutathiolated Carbonic Anhy 4e-11
3dvc_A259 X-Ray Crystal Structure Of Mutant N62t Of Human Car 4e-11
1h9q_A259 H119q Carbonic Anhydrase Ii Length = 259 4e-11
2nwy_A260 Structural And Kinetic Effects Of Hydrophobic Mutat 5e-11
3tvo_X258 Human Carbonic Anhydrase Ii Proton Transfer Double 6e-11
2it4_A256 X Ray Structure Of The Complex Between Carbonic Anh 6e-11
3u45_X260 Human Carbonic Anhydrase Ii V143a Length = 260 6e-11
1crm_A260 Structure And Function Of Carbonic Anhydrases Lengt 7e-11
3dbu_A260 Use Of Carbonic Anhydrase Ii, Ix Active-Site Mimic, 7e-11
4bcw_A257 Carbonic Anhydrase Ix Mimic In Complex With (e)-2-( 7e-11
2foy_A260 Human Carbonic Anhydrase I Complexed With A Two-Pro 7e-11
2nxr_A260 Structural Effects Of Hydrophobic Mutations On The 8e-11
1ugd_A258 Human Carbonic Anhydrase Ii[hcaii] (E.C.4.2.1.1) Mu 9e-11
1fr7_A260 X-Ray Crystal Structure Of Zinc-Bound F93sF95LW97M 1e-10
3mni_A260 Human Carbonic Anhydrase Ii Mutant K170d Length = 2 1e-10
1cvf_A259 Structural Consequences Of Redesigning A Protein-Zi 1e-10
3tvn_X258 Human Carbonic Anhydrase Ii Proton Transfer Mutant 1e-10
1fql_A260 X-Ray Crystal Structure Of Zinc-Bound F95mW97V CARB 1e-10
1fqm_A260 X-Ray Crystal Structure Of Zinc-Bound F93iF95MW97V 1e-10
8ca2_A260 Engineering The Hydrophobic Pocket Of Carbonic Anhy 1e-10
3dv7_A259 Role Of Hydrophilic Residues In Proton Transfer Dur 1e-10
1hva_A260 Engineering The Zinc Binding Site Of Human Carbonic 1e-10
1cvh_A255 Structural Consequences Of Redesigning A Protein-Zi 1e-10
3dvb_A259 X-Ray Crystal Structure Of Mutant N62v Human Carbon 1e-10
6ca2_A260 Engineering The Hydrophobic Pocket Of Carbonic Anhy 2e-10
4g0c_A257 Neutron Structure Of Acetazolamide-Bound Human Carb 2e-10
1cni_A259 X-Ray Crystallographic Studies Of Engineered Hydrog 2e-10
1g3z_A259 Carbonic Anhydrase Ii (F131v) Length = 259 2e-10
1cnb_A259 Compensatory Plastic Effects In The Redesign Of Pro 2e-10
1mua_A256 Structure And Energetics Of A Non-Proline Cis-Pepti 2e-10
3kkx_A260 Neutron Structure Of Human Carbonic Anhydrase Ii Le 2e-10
2pov_A259 The Crystal Structure Of The Human Carbonic Anhydra 2e-10
1ydb_A259 Structural Basis Of Inhibitor Affinity To Variants 2e-10
9ca2_A260 Engineering The Hydrophobic Pocket Of Carbonic Anhy 2e-10
3mnk_A260 Human Carbonic Anhydrase Ii Mutant K170h Length = 2 2e-10
3pyk_A260 Human Carbonic Anhydrase Ii As Host For Pianostool 2e-10
3tmj_A258 Joint X-RayNEUTRON STRUCTURE OF HUMAN CARBONIC ANHY 2e-10
3r16_A257 Human Caii Bound To N-(4-Sulfamoylphenyl)-2-(Thioph 2e-10
1dca_A260 Structure Of An Engineered Metal Binding Site In Hu 2e-10
2cbe_A260 Structure Of Native And Apo Carbonic Anhydrase Ii A 2e-10
1xpz_A258 Structure Of Human Carbonic Anhydrase Ii With 4-[4- 2e-10
1f2w_A259 The Mechanism Of Cyanamide Hydration Catalyzed By C 2e-10
1g0e_A260 Site-Specific Mutant (His64 Replaced With Ala) Of H 2e-10
3rg4_A260 Crystal Structure Of The W5f Mutant Of Human Carbon 2e-10
1hec_A260 Structural Consequences Of Hydrophilic Amino-Acid S 2e-10
5ca2_A260 Conformational Mobility Of His-64 In The Thr-200 (R 2e-10
3m1k_A265 Carbonic Anhydrase In Complex With Fragment Length 2e-10
1yda_A259 Structural Basis Of Inhibitor Affinity To Variants 2e-10
1cvc_A259 Redesigning The Zinc Binding Site Of Human Carbonic 2e-10
1th9_A260 Effect Of Shuttle Location And Ph Environment On H+ 2e-10
1ccs_A259 Structure-Assisted Redesign Of A Protein-Zinc Bindi 2e-10
1h4n_A259 H94n Carbonic Anhydrase Ii Complexed With Tris Leng 2e-10
1g6v_A260 Complex Of The Camelid Heavy-Chain Antibody Fragmen 2e-10
1bic_A259 Crystallographic Analysis Of Thr-200-> His Human Ca 2e-10
1ccu_A259 Structure-Assisted Redesign Of A Protein-Zinc Bindi 2e-10
1cva_A259 Structural And Functional Importance Of A Conserved 2e-10
1cnh_A259 X-Ray Crystallographic Studies Of Engineered Hydrog 2e-10
1ugf_A258 Human Carbonic Anhydrase Ii [hcaii] (E.C.4.2.1.1) M 2e-10
3rge_A260 Crystal Structure Of The W5h Mutant Of Human Carbon 2e-10
3rld_A260 Crystal Structure Of The Y7i Mutant Of Human Carbon 2e-10
12ca_A260 Altering The Mouth Of A Hydrophobic Pocket. Structu 2e-10
1hed_A260 Structural Consequences Of Hydrophilic Amino-Acid S 2e-10
1lzv_A260 Site-Specific Mutant (Tyr7 Replaced With His) Of Hu 2e-10
1ydd_A259 Structural Basis Of Inhibitor Affinity To Variants 2e-10
1heb_A260 Structural Consequences Of Hydrophilic Amino-Acid S 2e-10
3ryv_B259 Carbonic Anhydrase Complexed With N-Ethyl-4-Sulfamo 2e-10
3mnj_A260 Human Carbonic Anhydrase Ii Mutant K170e Length = 2 2e-10
1cal_A259 Structural Analysis Of The Zinc Hydroxide-Thr 199-G 2e-10
1cct_A259 Structure-Assisted Redesign Of A Protein-Zinc Bindi 2e-10
1hea_A260 Carbonic Anhydrase Ii (Carbonate Dehydratase) (Hca 2e-10
1lg5_A260 Crystal Structure Analysis Of The Hca Ii Mutant T19 2e-10
1cnk_A259 X-Ray Crystallographic Studies Of Engineered Hydrog 2e-10
3u47_A260 Human Carbonic Anhydrase Ii V143l Length = 260 2e-10
1yo0_A260 Proton Transfer From His200 In Human Carbonic Anhyd 2e-10
2foq_A260 Human Carbonic Anhydrase Ii Complexed With Two-Pron 2e-10
1cnj_A259 X-Ray Crystallographic Studies Of Engineered Hydrog 2e-10
3u3a_X260 Structure Of Human Carbonic Anhydrase Ii V143i Leng 2e-10
2nwo_A260 Structural And Kinetic Effect Of Hydrophobic Mutati 2e-10
1cve_A259 Structural Consequences Of Redesigning A Protein-Zi 2e-10
3dvd_A259 X-Ray Crystal Structure Of Mutant N62d Of Human Car 2e-10
3v3i_B260 Kinetic And Structural Studies Of Thermostabilized 2e-10
3rg3_A260 Crystal Structure Of The W5e Mutant Of Human Carbon 2e-10
2fnk_A260 Activation Of Human Carbonic Anhydrase Ii By Exogen 2e-10
2fnn_A260 Activation Of Human Carbonic Anhydrase Ii By Exogen 2e-10
1h9n_A259 H119n Carbonic Anhydrase Ii Length = 259 2e-10
2fnm_A260 Activation Of Human Carbonic Anhdyrase Ii By Exogen 2e-10
3mnh_A260 Human Carbonic Anhydrase Ii Mutant K170a Length = 2 2e-10
3v3j_A260 Kinetic And Structural Studies Of Thermostabilized 3e-10
1tg3_A260 Effect Of Shuttle Location And Ph Environment On H+ 3e-10
1cvd_A255 Structural Consequences Of Redesigning A Protein-Zi 3e-10
3v3g_B260 Kinetic And Structural Studies Of Thermostabilized 3e-10
3kig_A265 Mutant Carbonic Anhydrase Ii In Complex With An Azi 3e-10
1ugb_A258 Human Carbonic Anhydrase Ii[hcaii] (E.C.4.2.1.1) Mu 3e-10
3m1q_A265 Carbonic Anhydrase Ii Mutant W5c-H64c With Opened D 3e-10
3v3h_B260 Kinetic And Structural Studies Of Thermostabilized 3e-10
1ugc_A258 Human Carbonic Anhydrase Ii [hcaii] (e.c.4.2.1.1) M 4e-10
1zh9_A259 Carbonic Anhydrase Ii In Complex With N-4-methyl-1- 4e-10
1caj_A259 Structural Analysis Of The Zinc Hydroxide-Thr 199-G 4e-10
1cak_A259 Structural Analysis Of The Zinc Hydroxide-Thr 199-G 4e-10
1zsa_A259 Carbonic Anhydrase Ii Mutant E117q, Apo Form Length 4e-10
3pjj_A259 Synthetic Dimer Of Human Carbonic Anhydrase Ii Leng 4e-10
1uga_A258 Human Carbonic Anhydrase Ii[hcaii] (E.C.4.2.1.1) Mu 5e-10
1uge_A258 Human Carbonic Anhydrase Ii [hcaii] (E.C.4.2.1.1) M 5e-10
3v3f_A260 Kinetic And Structural Studies Of Thermostabilized 6e-10
1cai_A259 Structural Analysis Of The Zinc Hydroxide-Thr 199-G 8e-10
1cng_A259 X-Ray Crystallographic Studies Of Engineered Hydrog 8e-10
1z93_A266 Human Carbonic Anhydrase Iii:structural And Kinetic 2e-09
1z97_A266 Human Carbonic Anhydrase Iii: Structural And Kineti 2e-09
3uyq_A260 Hca 3 Length = 260 2e-09
3uyn_A260 Hca 3 Length = 260 2e-09
1rj5_A261 Crystal Structure Of The Extracellular Domain Of Mu 3e-09
2hfw_A260 Structural And Kinetic Analysis Of Proton Shuttle R 3e-09
3jxf_A272 Ca-Like Domain Of Human Ptprz Length = 272 3e-09
3s97_A273 Ptprz Cntn1 Complex Length = 273 3e-09
1v9e_A259 Crystal Structure Analysis Of Bovine Carbonic Anhyd 3e-09
1v9i_C261 Crystal Structure Analysis Of The Site Specific Mut 3e-09
1jcz_A263 Crystal Structure Of The Extracellular Domain Of Hu 1e-08
3jxh_C265 Ca-Like Domain Of Human Ptprg Length = 265 6e-08
4e9o_X 269 Vaccinia D8l Ectodomain Structure Length = 269 7e-08
3jxg_B269 Ca-Like Domain Of Mouse Ptprg Length = 269 3e-07
3iai_A257 Crystal Structure Of The Catalytic Domain Of The Tu 2e-06
>pdb|3DA2|A Chain A, X-Ray Structure Of Human Carbonic Anhydrase 13 In Complex With Inhibitor Length = 262 Back     alignment and structure 
Iteration: 1

 Score = 78.6 bits (192), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 50/174 (28%), Positives = 85/174 (48%), Gaps = 9/174 (5%)
Query: 7   GPQYWGRINPEWSLCNKGRRQSPINVDPEHLLFDPHLTELEIDKNKVSG-VLQNTGQSLV 65
           GP +W    P       G +QSPI +  + + +D  L  L I  +  S  ++ N+G S  
Sbjct: 14  GPIHWKEFFP----IADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHS-- 67
Query: 66  FRVD-KDTKHHVNISGGPLAXXXXXXXXXXXXGQVNDKGSEHQIHGYSFPGEIQLYGYNA 124
           F VD  DT++   + GGPL             G  +D GSEH + G S+  E+ +  +N+
Sbjct: 68  FNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNS 127
Query: 125 ELYHNMSEAQHKPQGIVGISLMIQLGERSNDELRIVTTNFNKVLFRDFVVRYVN 178
           + Y +  EA H+P G+  + + +Q+GE  N +L+ +T   + +  +    R+ N
Sbjct: 128 DKYPSFVEAAHEPDGLAVLGVFLQIGE-PNSQLQKITDTLDSIKEKGKQTRFTN 180
>pdb|3CZV|A Chain A, Crystal Structure Of The Human Carbonic Anhydrase Xiii In Complex With Acetazolamide Length = 264 Back     alignment and structure
>pdb|3MDZ|A Chain A, Crystal Structure Of Human Carbonic Anhydrase Vii [isoform 1], Ca7 Length = 281 Back     alignment and structure
>pdb|3ML5|A Chain A, Crystal Structure Of The C183sC217S MUTANT OF HUMAN CA VII IN COMPLEX With Acetazolamide Length = 269 Back     alignment and structure
>pdb|1KEQ|A Chain A, Crystal Structure Of F65aY131C CARBONIC ANHYDRASE V, Covalently Modified With 4-Chloromethylimidazole Length = 248 Back     alignment and structure
>pdb|1DMX|A Chain A, Murine Mitochondrial Carbonic Anyhdrase V At 2.45 Angstroms Resolution Length = 248 Back     alignment and structure
>pdb|1URT|A Chain A, Murine Carbonic Anhydrase V Length = 248 Back     alignment and structure
>pdb|1J9W|A Chain A, Solution Structure Of The Cai Michigan 1 Variant Length = 260 Back     alignment and structure
>pdb|7CA2|A Chain A, Engineering The Hydrophobic Pocket Of Carbonic Anhydrase Ii Length = 260 Back     alignment and structure
>pdb|2W2J|A Chain A, Crystal Structure Of The Human Carbonic Anhydrase Related Protein Viii Length = 291 Back     alignment and structure
>pdb|1FLJ|A Chain A, Crystal Structure Of S-Glutathiolated Carbonic Anhydrase Iii Length = 260 Back     alignment and structure
>pdb|3DVC|A Chain A, X-Ray Crystal Structure Of Mutant N62t Of Human Carbonic Anhydrase Ii Length = 259 Back     alignment and structure
>pdb|1H9Q|A Chain A, H119q Carbonic Anhydrase Ii Length = 259 Back     alignment and structure
>pdb|2NWY|A Chain A, Structural And Kinetic Effects Of Hydrophobic Mutations On The Active Site Of Human Carbonic Anhydrase Ii Length = 260 Back     alignment and structure
>pdb|3TVO|X Chain X, Human Carbonic Anhydrase Ii Proton Transfer Double Mutant Length = 258 Back     alignment and structure
>pdb|2IT4|A Chain A, X Ray Structure Of The Complex Between Carbonic Anhydrase I And The Phosphonate Antiviral Drug Foscarnet Length = 256 Back     alignment and structure
>pdb|3U45|X Chain X, Human Carbonic Anhydrase Ii V143a Length = 260 Back     alignment and structure
>pdb|1CRM|A Chain A, Structure And Function Of Carbonic Anhydrases Length = 260 Back     alignment and structure
>pdb|3DBU|A Chain A, Use Of Carbonic Anhydrase Ii, Ix Active-Site Mimic, For The Purpose Of Screening Inhibitors For Possible Anti-Cancer Properties Length = 260 Back     alignment and structure
>pdb|4BCW|A Chain A, Carbonic Anhydrase Ix Mimic In Complex With (e)-2-(5-bromo- 2-hydroxyphenyl)ethenesulfonic Acid Length = 257 Back     alignment and structure
>pdb|2FOY|A Chain A, Human Carbonic Anhydrase I Complexed With A Two-Prong Inhibitor Length = 260 Back     alignment and structure
>pdb|2NXR|A Chain A, Structural Effects Of Hydrophobic Mutations On The Active Site Of Human Carbonic Anhydrase Ii Length = 260 Back     alignment and structure
>pdb|1UGD|A Chain A, Human Carbonic Anhydrase Ii[hcaii] (E.C.4.2.1.1) Mutant With Ala 65 Replaced By Ser (A65s) Length = 258 Back     alignment and structure
>pdb|1FR7|A Chain A, X-Ray Crystal Structure Of Zinc-Bound F93sF95LW97M Carbonic Anhydrase (Caii) Variant Length = 260 Back     alignment and structure
>pdb|3MNI|A Chain A, Human Carbonic Anhydrase Ii Mutant K170d Length = 260 Back     alignment and structure
>pdb|1CVF|A Chain A, Structural Consequences Of Redesigning A Protein-Zinc Binding Site Length = 259 Back     alignment and structure
>pdb|3TVN|X Chain X, Human Carbonic Anhydrase Ii Proton Transfer Mutant Length = 258 Back     alignment and structure
>pdb|1FQL|A Chain A, X-Ray Crystal Structure Of Zinc-Bound F95mW97V CARBONIC Anhydrase (Caii) Variant Length = 260 Back     alignment and structure
>pdb|1FQM|A Chain A, X-Ray Crystal Structure Of Zinc-Bound F93iF95MW97V Carbonic Anhydrase (Caii) Variant Length = 260 Back     alignment and structure
>pdb|8CA2|A Chain A, Engineering The Hydrophobic Pocket Of Carbonic Anhydrase Ii Length = 260 Back     alignment and structure
>pdb|3DV7|A Chain A, Role Of Hydrophilic Residues In Proton Transfer During Catalysis By Human Carbonic Anhydrase Ii (N62a) Length = 259 Back     alignment and structure
>pdb|1HVA|A Chain A, Engineering The Zinc Binding Site Of Human Carbonic Anhydrase Ii: Structure Of The His-94-> Cys Apoenzyme In A New Crystalline Form Length = 260 Back     alignment and structure
>pdb|1CVH|A Chain A, Structural Consequences Of Redesigning A Protein-Zinc Binding Site Length = 255 Back     alignment and structure
>pdb|3DVB|A Chain A, X-Ray Crystal Structure Of Mutant N62v Human Carbonic Anhydrase Ii Length = 259 Back     alignment and structure
>pdb|6CA2|A Chain A, Engineering The Hydrophobic Pocket Of Carbonic Anhydrase Ii Length = 260 Back     alignment and structure
>pdb|4G0C|A Chain A, Neutron Structure Of Acetazolamide-Bound Human Carbonic Anhydrase Ii Reveal Molecular Details Of Drug Binding Length = 257 Back     alignment and structure
>pdb|1CNI|A Chain A, X-Ray Crystallographic Studies Of Engineered Hydrogen Bond Networks In A Protein-Zinc Binding Site Length = 259 Back     alignment and structure
>pdb|1G3Z|A Chain A, Carbonic Anhydrase Ii (F131v) Length = 259 Back     alignment and structure
>pdb|1CNB|A Chain A, Compensatory Plastic Effects In The Redesign Of Protein- Zinc Binding Sites Length = 259 Back     alignment and structure
>pdb|1MUA|A Chain A, Structure And Energetics Of A Non-Proline Cis-Peptidyl Linkage In An Engineered Protein Length = 256 Back     alignment and structure
>pdb|3KKX|A Chain A, Neutron Structure Of Human Carbonic Anhydrase Ii Length = 260 Back     alignment and structure
>pdb|2POV|A Chain A, The Crystal Structure Of The Human Carbonic Anhydrase Ii In Complex With 4-Amino-6-Chloro-Benzene-1,3-Disulfonamide Length = 259 Back     alignment and structure
>pdb|1YDB|A Chain A, Structural Basis Of Inhibitor Affinity To Variants Of Human Carbonic Anhydrase Ii Length = 259 Back     alignment and structure
>pdb|9CA2|A Chain A, Engineering The Hydrophobic Pocket Of Carbonic Anhydrase Ii Length = 260 Back     alignment and structure
>pdb|3MNK|A Chain A, Human Carbonic Anhydrase Ii Mutant K170h Length = 260 Back     alignment and structure
>pdb|3PYK|A Chain A, Human Carbonic Anhydrase Ii As Host For Pianostool Complexes Bearing A Sulfonamide Anchor Length = 260 Back     alignment and structure
>pdb|3TMJ|A Chain A, Joint X-RayNEUTRON STRUCTURE OF HUMAN CARBONIC ANHYDRASE II AT PH 7.8 Length = 258 Back     alignment and structure
>pdb|3R16|A Chain A, Human Caii Bound To N-(4-Sulfamoylphenyl)-2-(Thiophen-2-Yl) Acetamide Length = 257 Back     alignment and structure
>pdb|1DCA|A Chain A, Structure Of An Engineered Metal Binding Site In Human Carbonic Anhydrase Ii Reveals The Architecture Of A Regulatory Cysteine Switch Length = 260 Back     alignment and structure
>pdb|2CBE|A Chain A, Structure Of Native And Apo Carbonic Anhydrase Ii And Some Of Its Anion-Ligand Complexes Length = 260 Back     alignment and structure
>pdb|1XPZ|A Chain A, Structure Of Human Carbonic Anhydrase Ii With 4-[4-O- Sulfamoylbenzyl)(4-Cyanophenyl)amino]-4h-[1,2, 4]-Triazole Length = 258 Back     alignment and structure
>pdb|1F2W|A Chain A, The Mechanism Of Cyanamide Hydration Catalyzed By Carbonic Anhydrase Ii Revealed By Cryogenic X-Ray Diffraction Length = 259 Back     alignment and structure
>pdb|1G0E|A Chain A, Site-Specific Mutant (His64 Replaced With Ala) Of Human Carbonic Anhydrase Ii Complexed With 4-Methylimidazole Length = 260 Back     alignment and structure
>pdb|3RG4|A Chain A, Crystal Structure Of The W5f Mutant Of Human Carbonic Anhydrase Ii Length = 260 Back     alignment and structure
>pdb|1HEC|A Chain A, Structural Consequences Of Hydrophilic Amino-Acid Substitutions In The Hydrophobic Pocket Of Human Carbonic Anhydrase Ii Length = 260 Back     alignment and structure
>pdb|5CA2|A Chain A, Conformational Mobility Of His-64 In The Thr-200 (Right Arrow) Ser Mutant Of Human Carbonic Anhydrase Ii Length = 260 Back     alignment and structure
>pdb|3M1K|A Chain A, Carbonic Anhydrase In Complex With Fragment Length = 265 Back     alignment and structure
>pdb|1YDA|A Chain A, Structural Basis Of Inhibitor Affinity To Variants Of Human Carbonic Anhydrase Ii Length = 259 Back     alignment and structure
>pdb|1CVC|A Chain A, Redesigning The Zinc Binding Site Of Human Carbonic Anhydrase Ii: Structure Of A His2asp-Zn2+ Metal Coordination Polyhedron Length = 259 Back     alignment and structure
>pdb|1TH9|A Chain A, Effect Of Shuttle Location And Ph Environment On H+ Transfer In Human Carbonic Anhydrase Ii Length = 260 Back     alignment and structure
>pdb|1CCS|A Chain A, Structure-Assisted Redesign Of A Protein-Zinc Binding Site With Femtomolar Affinity Length = 259 Back     alignment and structure
>pdb|1H4N|A Chain A, H94n Carbonic Anhydrase Ii Complexed With Tris Length = 259 Back     alignment and structure
>pdb|1G6V|A Chain A, Complex Of The Camelid Heavy-Chain Antibody Fragment Cab- Ca05 With Bovine Carbonic Anhydrase Length = 260 Back     alignment and structure
>pdb|1BIC|A Chain A, Crystallographic Analysis Of Thr-200-> His Human Carbonic Anhydrase Ii And Its Complex With The Substrate, Hco3- Length = 259 Back     alignment and structure
>pdb|1CCU|A Chain A, Structure-Assisted Redesign Of A Protein-Zinc Binding Site With Femtomolar Affinity Length = 259 Back     alignment and structure
>pdb|1CVA|A Chain A, Structural And Functional Importance Of A Conserved Hydrogen Bond Network In Human Carbonic Anhydrase Ii Length = 259 Back     alignment and structure
>pdb|1CNH|A Chain A, X-Ray Crystallographic Studies Of Engineered Hydrogen Bond Networks In A Protein-Zinc Binding Site Length = 259 Back     alignment and structure
>pdb|1UGF|A Chain A, Human Carbonic Anhydrase Ii [hcaii] (E.C.4.2.1.1) Mutant With Ala 65 Replaced By Thr (A65t) Length = 258 Back     alignment and structure
>pdb|3RGE|A Chain A, Crystal Structure Of The W5h Mutant Of Human Carbonic Anhydrase Ii Length = 260 Back     alignment and structure
>pdb|3RLD|A Chain A, Crystal Structure Of The Y7i Mutant Of Human Carbonic Anhydrase Ii Length = 260 Back     alignment and structure
>pdb|12CA|A Chain A, Altering The Mouth Of A Hydrophobic Pocket. Structure And Kinetics Of Human Carbonic Anhydrase Ii Mutants At Residue Val-121 Length = 260 Back     alignment and structure
>pdb|1HED|A Chain A, Structural Consequences Of Hydrophilic Amino-Acid Substitutions In The Hydrophobic Pocket Of Human Carbonic Anhydrase Ii Length = 260 Back     alignment and structure
>pdb|1LZV|A Chain A, Site-Specific Mutant (Tyr7 Replaced With His) Of Human Carbonic Anhydrase Ii Length = 260 Back     alignment and structure
>pdb|1YDD|A Chain A, Structural Basis Of Inhibitor Affinity To Variants Of Human Carbonic Anhydrase Ii Length = 259 Back     alignment and structure
>pdb|1HEB|A Chain A, Structural Consequences Of Hydrophilic Amino-Acid Substitutions In The Hydrophobic Pocket Of Human Carbonic Anhydrase Ii Length = 260 Back     alignment and structure
>pdb|3RYV|B Chain B, Carbonic Anhydrase Complexed With N-Ethyl-4-Sulfamoylbenzamide Length = 259 Back     alignment and structure
>pdb|3MNJ|A Chain A, Human Carbonic Anhydrase Ii Mutant K170e Length = 260 Back     alignment and structure
>pdb|1CAL|A Chain A, Structural Analysis Of The Zinc Hydroxide-Thr 199-Glu 106 Hydrogen Bonding Network In Human Carbonic Anhydrase Ii Length = 259 Back     alignment and structure
>pdb|1CCT|A Chain A, Structure-Assisted Redesign Of A Protein-Zinc Binding Site With Femtomolar Affinity Length = 259 Back     alignment and structure
>pdb|1HEA|A Chain A, Carbonic Anhydrase Ii (Carbonate Dehydratase) (Hca Ii) (E.C.4.2.1.1) Mutant With Leu 198 Replaced By Arg (L198r) Length = 260 Back     alignment and structure
>pdb|1LG5|A Chain A, Crystal Structure Analysis Of The Hca Ii Mutant T199p In Complex With Beta-Mercaptoethanol Length = 260 Back     alignment and structure
>pdb|1CNK|A Chain A, X-Ray Crystallographic Studies Of Engineered Hydrogen Bond Networks In A Protein-Zinc Binding Site Length = 259 Back     alignment and structure
>pdb|3U47|A Chain A, Human Carbonic Anhydrase Ii V143l Length = 260 Back     alignment and structure
>pdb|1YO0|A Chain A, Proton Transfer From His200 In Human Carbonic Anhydrase Ii Length = 260 Back     alignment and structure
>pdb|2FOQ|A Chain A, Human Carbonic Anhydrase Ii Complexed With Two-Prong Inhibitors Length = 260 Back     alignment and structure
>pdb|1CNJ|A Chain A, X-Ray Crystallographic Studies Of Engineered Hydrogen Bond Networks In A Protein-Zinc Binding Site Length = 259 Back     alignment and structure
>pdb|3U3A|X Chain X, Structure Of Human Carbonic Anhydrase Ii V143i Length = 260 Back     alignment and structure
>pdb|2NWO|A Chain A, Structural And Kinetic Effect Of Hydrophobic Mutations In The Active Site Of Human Carbonic Anhydrase Ii Length = 260 Back     alignment and structure
>pdb|1CVE|A Chain A, Structural Consequences Of Redesigning A Protein-Zinc Binding Site Length = 259 Back     alignment and structure
>pdb|3DVD|A Chain A, X-Ray Crystal Structure Of Mutant N62d Of Human Carbonic Anhydrase Ii Length = 259 Back     alignment and structure
>pdb|3V3I|B Chain B, Kinetic And Structural Studies Of Thermostabilized Mutants Of Hca Ii Length = 260 Back     alignment and structure
>pdb|3RG3|A Chain A, Crystal Structure Of The W5e Mutant Of Human Carbonic Anhydrase Ii Length = 260 Back     alignment and structure
>pdb|2FNK|A Chain A, Activation Of Human Carbonic Anhydrase Ii By Exogenous Proton Donors Length = 260 Back     alignment and structure
>pdb|2FNN|A Chain A, Activation Of Human Carbonic Anhydrase Ii By Exogenous Proton Donors Length = 260 Back     alignment and structure
>pdb|1H9N|A Chain A, H119n Carbonic Anhydrase Ii Length = 259 Back     alignment and structure
>pdb|2FNM|A Chain A, Activation Of Human Carbonic Anhdyrase Ii By Exogenous Proton Donors Length = 260 Back     alignment and structure
>pdb|3MNH|A Chain A, Human Carbonic Anhydrase Ii Mutant K170a Length = 260 Back     alignment and structure
>pdb|3V3J|A Chain A, Kinetic And Structural Studies Of Thermostabilized Mutants Of Hca Ii Length = 260 Back     alignment and structure
>pdb|1TG3|A Chain A, Effect Of Shuttle Location And Ph Environment On H+ Transfer In Human Carbonic Anhydrase Ii Length = 260 Back     alignment and structure
>pdb|1CVD|A Chain A, Structural Consequences Of Redesigning A Protein-Zinc Binding Site Length = 255 Back     alignment and structure
>pdb|3V3G|B Chain B, Kinetic And Structural Studies Of Thermostabilized Mutants Of Hca Ii Length = 260 Back     alignment and structure
>pdb|3KIG|A Chain A, Mutant Carbonic Anhydrase Ii In Complex With An Azide And An Alkyne Length = 265 Back     alignment and structure
>pdb|1UGB|A Chain A, Human Carbonic Anhydrase Ii[hcaii] (E.C.4.2.1.1) Mutant With Ala 65 Replaced By Gly (A65g) Length = 258 Back     alignment and structure
>pdb|3M1Q|A Chain A, Carbonic Anhydrase Ii Mutant W5c-H64c With Opened Disulfide Bond Length = 265 Back     alignment and structure
>pdb|3V3H|B Chain B, Kinetic And Structural Studies Of Thermostabilized Mutants Of Hca Ii Length = 260 Back     alignment and structure
>pdb|1UGC|A Chain A, Human Carbonic Anhydrase Ii [hcaii] (e.c.4.2.1.1) Mutant With Ala 65 Replaced By His (a65h) Length = 258 Back     alignment and structure
>pdb|1ZH9|A Chain A, Carbonic Anhydrase Ii In Complex With N-4-methyl-1- Piperazinyl-n'-(p-sulfonamide)phenylthiourea As Sulfonamide Inhibitor Length = 259 Back     alignment and structure
>pdb|1CAJ|A Chain A, Structural Analysis Of The Zinc Hydroxide-Thr 199-Glu 106 Hydrogen Bonding Network In Human Carbonic Anhydrase Ii Length = 259 Back     alignment and structure
>pdb|1CAK|A Chain A, Structural Analysis Of The Zinc Hydroxide-Thr 199-Glu 106 Hydrogen Bonding Network In Human Carbonic Anhydrase Ii Length = 259 Back     alignment and structure
>pdb|1ZSA|A Chain A, Carbonic Anhydrase Ii Mutant E117q, Apo Form Length = 259 Back     alignment and structure
>pdb|3PJJ|A Chain A, Synthetic Dimer Of Human Carbonic Anhydrase Ii Length = 259 Back     alignment and structure
>pdb|1UGA|A Chain A, Human Carbonic Anhydrase Ii[hcaii] (E.C.4.2.1.1) Mutant With Ala 65 Replaced By Phe (A65f) Length = 258 Back     alignment and structure
>pdb|1UGE|A Chain A, Human Carbonic Anhydrase Ii [hcaii] (E.C.4.2.1.1) Mutant With Ala 65 Replaced By Leu (A65l) Length = 258 Back     alignment and structure
>pdb|3V3F|A Chain A, Kinetic And Structural Studies Of Thermostabilized Mutants Of Hca Ii Length = 260 Back     alignment and structure
>pdb|1CAI|A Chain A, Structural Analysis Of The Zinc Hydroxide-Thr 199-Glu 106 Hydrogen Bonding Network In Human Carbonic Anhydrase Ii Length = 259 Back     alignment and structure
>pdb|1CNG|A Chain A, X-Ray Crystallographic Studies Of Engineered Hydrogen Bond Networks In A Protein-Zinc Binding Site Length = 259 Back     alignment and structure
>pdb|1Z93|A Chain A, Human Carbonic Anhydrase Iii:structural And Kinetic Study Of Catalysis And Proton Transfer Length = 266 Back     alignment and structure
>pdb|1Z97|A Chain A, Human Carbonic Anhydrase Iii: Structural And Kinetic Study Of Catalysis And Proton Transfer Length = 266 Back     alignment and structure
>pdb|3UYQ|A Chain A, Hca 3 Length = 260 Back     alignment and structure
>pdb|3UYN|A Chain A, Hca 3 Length = 260 Back     alignment and structure
>pdb|1RJ5|A Chain A, Crystal Structure Of The Extracellular Domain Of Murine Carbonic Anhydrase Xiv Length = 261 Back     alignment and structure
>pdb|2HFW|A Chain A, Structural And Kinetic Analysis Of Proton Shuttle Residues In The Active Site Of Human Carbonic Anhydrase Iii Length = 260 Back     alignment and structure
>pdb|3JXF|A Chain A, Ca-Like Domain Of Human Ptprz Length = 272 Back     alignment and structure
>pdb|3S97|A Chain A, Ptprz Cntn1 Complex Length = 273 Back     alignment and structure
>pdb|1V9E|A Chain A, Crystal Structure Analysis Of Bovine Carbonic Anhydrase Ii Length = 259 Back     alignment and structure
>pdb|1V9I|C Chain C, Crystal Structure Analysis Of The Site Specific Mutant (Q253c) Of Bovine Carbonic Anhydrase Ii Length = 261 Back     alignment and structure
>pdb|1JCZ|A Chain A, Crystal Structure Of The Extracellular Domain Of Human Carbonic Anhydrase Xii Length = 263 Back     alignment and structure
>pdb|3JXH|C Chain C, Ca-Like Domain Of Human Ptprg Length = 265 Back     alignment and structure
>pdb|4E9O|X Chain X, Vaccinia D8l Ectodomain Structure Length = 269 Back     alignment and structure
>pdb|3IAI|A Chain A, Crystal Structure Of The Catalytic Domain Of The Tumor-Associated Human Carbonic Anhydrase Ix Length = 257 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query180
3fw3_A266 Carbonic anhydrase 4; structure-based drug design. 8e-47
2znc_A258 Carbonic anhydrase IV; lyase, zinc, murine, membra 1e-45
3ml5_A269 Carbonic anhydrase 7; protein-inhibitor complex, l 9e-44
1keq_A248 F65A/Y131C-MI carbonic anhydrase V; proton transfe 3e-43
3d0n_A264 Carbonic anhydrase 13; lyase, metal-binding, metal 3e-43
3iai_A257 Carbonic anhydrase 9; transmembrane proteins, cell 8e-43
2foy_A260 Carbonic anhydrase 1; lyase, zinc, inhibitor, copp 2e-42
3k34_A260 Carbonic anhydrase 2; atomic resolution, sulfonami 4e-42
2w2j_A291 Carbonic anhydrase-related protein; lyase, metal-b 1e-41
3jxf_A272 Receptor-type tyrosine-protein phosphatase zeta; C 2e-41
2hfx_A260 Carbonic anhydrase 3; proton shuttle, HCA III, pro 2e-41
1rj5_A261 Carbonic anhydrase XIV; beta-sheet, alpha-helix, z 3e-41
3jxg_A269 Receptor-type tyrosine-protein phosphatase gamma; 4e-41
4e9o_X 269 D8L antigen, IMV membrane protein; CAH alpha fold, 4e-41
1jd0_A263 Carbonic anhydrase XII; extracellular domain, bito 4e-39
3fe4_A278 Carbonic anhydrase 6; secretion, metal binding, st 4e-37
1y7w_A291 Halotolerant alpha-type carbonic anhydrase (DCA I; 3e-32
1kop_A223 Carbonic anhydrase; lyase, structural trimming; 1. 1e-30
3q31_A244 Carbonic anhydrase; glysosy secreted, dimeric, lya 5e-27
3b1b_A 377 Carbonic anhydrase 1; N-glycosylation, zinc-finger 2e-24
>3fw3_A Carbonic anhydrase 4; structure-based drug design. small molecule complex. CO-CRYS membrane, disease mutation, glycoprotein, GPI-anchor; HET: ETS GLC; 1.72A {Homo sapiens} PDB: 1znc_A* 3f7b_A* 3f7u_A* Length = 266 Back     alignment and structure
 Score =  152 bits (387), Expect = 8e-47
 Identities = 37/170 (21%), Positives = 70/170 (41%), Gaps = 8/170 (4%)

Query: 6   TGPQYWGRINPE-WSLCNKGRRQSPINVDPEHLLFDPHLTELEIDK--NKVSGVLQNTGQ 62
                +  + P  W    +  RQSPIN+       D  L          K +  +QN G 
Sbjct: 11  AESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLGRFFFSGYDKKQTWTVQNNGH 70

Query: 63  SLVFRVDKDTKHHVNISGGPLAYRYQFEEFYFRYGQVNDKGSEHQIHGYSFPGEIQLYGY 122
           S++  ++       +ISGG L   YQ ++ +  +  +  KGSEH + G  F  E+ +   
Sbjct: 71  SVMMLLENKA----SISGGGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMHIVHE 126

Query: 123 NAEL-YHNMSEAQHKPQGIVGISLMIQLGERSNDELRIVTTNFNKVLFRD 171
             +    N+ EAQ     I  ++ +++ G + N+  + +    + +   +
Sbjct: 127 KEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGFQPLVEALSNIPKPE 176
>2znc_A Carbonic anhydrase IV; lyase, zinc, murine, membrane; 2.80A {Mus musculus} SCOP: b.74.1.1 PDB: 3znc_A* Length = 258 Back     alignment and structure
>3ml5_A Carbonic anhydrase 7; protein-inhibitor complex, lyase; HET: AZM; 2.05A {Homo sapiens} PDB: 3mdz_A* Length = 269 Back     alignment and structure
>1keq_A F65A/Y131C-MI carbonic anhydrase V; proton transfer, engineered residue, lyase; HET: 4MZ; 1.88A {Mus musculus} SCOP: b.74.1.1 PDB: 1dmx_A 1dmy_A* 1urt_A Length = 248 Back     alignment and structure
>3d0n_A Carbonic anhydrase 13; lyase, metal-binding, metal binding PROT; HET: GOL; 1.55A {Homo sapiens} PDB: 3czv_A* 3da2_A* Length = 264 Back     alignment and structure
>3iai_A Carbonic anhydrase 9; transmembrane proteins, cell membrane, projection, disulfide bond, glycoprotein, lyase, membrane, binding, nucleus; HET: AZM NAG BMA MAN; 2.20A {Homo sapiens} Length = 257 Back     alignment and structure
>2foy_A Carbonic anhydrase 1; lyase, zinc, inhibitor, copper; HET: B30; 1.55A {Homo sapiens} SCOP: b.74.1.1 PDB: 1bzm_A* 1czm_A* 1azm_A 1hug_A 1huh_A 1hcb_A* 2fw4_A* 2nmx_A* 2nn1_A* 2nn7_A* 3lxe_A* 1jv0_A 1j9w_A 1crm_A 2cab_A 2it4_A Length = 260 Back     alignment and structure
>3k34_A Carbonic anhydrase 2; atomic resolution, sulfonamide inhibitor mutation, lyase, metal-binding, lyase-lyase inhibitor compl; HET: HGB SUA; 0.90A {Homo sapiens} PDB: 1ca3_A* 1cnw_A* 1cny_A* 1eou_A* 1g6v_A 1hca_A 1kwq_A* 1kwr_A* 1t9n_A 1tb0_X 1tbt_X 1te3_X 1teq_X 1teu_X 1cnx_A 1xev_A 1xeg_A 2ax2_A* 2eu3_A* 2ez7_A* ... Length = 260 Back     alignment and structure
>2w2j_A Carbonic anhydrase-related protein; lyase, metal-binding; 1.60A {Homo sapiens} Length = 291 Back     alignment and structure
>3jxf_A Receptor-type tyrosine-protein phosphatase zeta; Ca-like domain, alternative splicing, glycoprotein, hydrolase, membrane, polymorphism; 2.00A {Homo sapiens} PDB: 3s97_A* Length = 272 Back     alignment and structure
>1rj5_A Carbonic anhydrase XIV; beta-sheet, alpha-helix, zinc enzyme, lyase; HET: NAG BMA; 2.81A {Mus musculus} SCOP: b.74.1.1 PDB: 1rj6_A* Length = 261 Back     alignment and structure
>4e9o_X D8L antigen, IMV membrane protein; CAH alpha fold, VP7 motif, beta sheet, cell surface chondroi binding, viral entry, chondroitin sulfate; 1.42A {Vaccinia virus} PDB: 4etq_X Length = 269 Back     alignment and structure
>1jd0_A Carbonic anhydrase XII; extracellular domain, bitopic protein, type I membrane protein, lyase; HET: AZM; 1.50A {Homo sapiens} SCOP: b.74.1.1 PDB: 1jcz_A* Length = 263 Back     alignment and structure
>3fe4_A Carbonic anhydrase 6; secretion, metal binding, structural GEN structural genomics consortium, SGC, glycoprotein, lyase, M binding, secreted; 1.90A {Homo sapiens} Length = 278 Back     alignment and structure
>1y7w_A Halotolerant alpha-type carbonic anhydrase (DCA I; haltolerant protein, algal Ca anhydrase, salt tolerant protein, zinc enzyme; 1.86A {Dunaliella salina} Length = 291 Back     alignment and structure
>1kop_A Carbonic anhydrase; lyase, structural trimming; 1.90A {Neisseria gonorrhoeae} SCOP: b.74.1.1 PDB: 1koq_A Length = 223 Back     alignment and structure
>3q31_A Carbonic anhydrase; glysosy secreted, dimeric, lyase; HET: NAG; 2.70A {Aspergillus oryzae} Length = 244 Back     alignment and structure
>3b1b_A Carbonic anhydrase 1; N-glycosylation, zinc-finger, lyase; HET: NAG; 1.88A {Chlamydomonas reinhardtii} Length = 377 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query180
3k34_A260 Carbonic anhydrase 2; atomic resolution, sulfonami 100.0
2foy_A260 Carbonic anhydrase 1; lyase, zinc, inhibitor, copp 100.0
3d0n_A264 Carbonic anhydrase 13; lyase, metal-binding, metal 100.0
2hfx_A260 Carbonic anhydrase 3; proton shuttle, HCA III, pro 100.0
3ml5_A269 Carbonic anhydrase 7; protein-inhibitor complex, l 100.0
3jxf_A272 Receptor-type tyrosine-protein phosphatase zeta; C 100.0
3jxg_A269 Receptor-type tyrosine-protein phosphatase gamma; 100.0
1rj5_A261 Carbonic anhydrase XIV; beta-sheet, alpha-helix, z 100.0
3fw3_A266 Carbonic anhydrase 4; structure-based drug design. 100.0
3fe4_A278 Carbonic anhydrase 6; secretion, metal binding, st 100.0
1jd0_A263 Carbonic anhydrase XII; extracellular domain, bito 100.0
1keq_A248 F65A/Y131C-MI carbonic anhydrase V; proton transfe 100.0
3iai_A257 Carbonic anhydrase 9; transmembrane proteins, cell 100.0
2w2j_A291 Carbonic anhydrase-related protein; lyase, metal-b 100.0
2znc_A258 Carbonic anhydrase IV; lyase, zinc, murine, membra 100.0
4e9o_X 269 D8L antigen, IMV membrane protein; CAH alpha fold, 100.0
3q31_A244 Carbonic anhydrase; glysosy secreted, dimeric, lya 100.0
1kop_A223 Carbonic anhydrase; lyase, structural trimming; 1. 100.0
3b1b_A 377 Carbonic anhydrase 1; N-glycosylation, zinc-finger 100.0
1y7w_A291 Halotolerant alpha-type carbonic anhydrase (DCA I; 100.0
>3k34_A Carbonic anhydrase 2; atomic resolution, sulfonamide inhibitor mutation, lyase, metal-binding, lyase-lyase inhibitor compl; HET: HGB SUA; 0.90A {Homo sapiens} SCOP: b.74.1.1 PDB: 1ca3_A* 1cnw_A* 1cny_A* 1eou_A* 1g6v_A 1hca_A 1kwq_A* 1kwr_A* 1t9n_A 1tb0_X 1tbt_X 1te3_X 1teq_X 1teu_X 1cnx_A 1xev_A 1xeg_A 2ax2_A* 2eu3_A* 2ez7_A* ... Back     alignment and structure
Probab=100.00  E-value=1.5e-54  Score=354.22  Aligned_cols=169  Identities=24%  Similarity=0.555  Sum_probs=155.9

Q ss_pred             CCCCCCCCCccccCCCcccCCCCCCCCCceeeCCCceeCCCCCceeeeccC-eeeEEEecCcEEEEEeCCCCCeeEEEec
Q psy11192          2 FSMSTGPQYWGRINPEWSLCNKGRRQSPINVDPEHLLFDPHLTELEIDKNK-VSGVLQNTGQSLVFRVDKDTKHHVNISG   80 (180)
Q Consensus         2 ~~~~~gP~~W~~~~p~~~~C~~G~~QSPInI~~~~~~~~~~l~~l~~~y~~-~~~~i~N~G~tv~v~~~~~~~~~~~i~G   80 (180)
                      |.|..||++|+.++|.   | +|++||||||.+..+.+++.++||.++|.. ...+|.|+||||+|.++++.. ...|+|
T Consensus         7 Y~~~~gP~~W~~~~p~---c-~G~~QSPInI~~~~~~~~~~l~~l~~~Y~~~~~~~l~NnGhtv~v~~~~~~~-~~~i~g   81 (260)
T 3k34_A            7 YGKHNGPEHWHKDFPI---A-KGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQD-KAVLKG   81 (260)
T ss_dssp             SSTTTSTTTGGGTCGG---G-GSSSCSCCEECTTTCEECTTCEEEEEECTTCCEEEEEECSSSEEEEECCSSS-CSEEEE
T ss_pred             CCCCCChhHhcccCCC---C-CCCccCCEEEccCceEecCCCcceeeeecCCceEEEEECCeEEEEEEcCCCC-ceEEeC
Confidence            7888999999999883   6 899999999999998888999999999974 568999999999999987533 235899


Q ss_pred             CCCCcceEeEEEEEEeeCCCCCCCceeeccCCCCceeEEEeeccccCCChhHhhcCCCcEEEEEEEEEeCCCCChhHHHH
Q psy11192         81 GPLAYRYQFEEFYFRYGQVNDKGSEHQIHGYSFPGEIQLYGYNAELYHNMSEAQHKPQGIVGISLMIQLGERSNDELRIV  160 (180)
Q Consensus        81 g~l~~~Y~l~q~HfHWG~~~~~gSEH~idG~~~~~E~H~Vh~~~~~y~~~~eA~~~~~glaVlav~~~~~~~~n~~l~~i  160 (180)
                      |+|..+|+|.|||||||+.+..||||+|||++|||||||||+|.+ |.+++||+++++|||||||||++++. |++|++|
T Consensus        82 g~L~~~Y~l~Q~HfHWG~~~~~gSEHtidG~~~p~ElH~VH~n~~-y~~~~eA~~~~~glaVlgv~~~~g~~-n~~l~~i  159 (260)
T 3k34_A           82 GPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTK-YGDFGKAVQQPDGLAVLGIFLKVGSA-KPGLQKV  159 (260)
T ss_dssp             ETCCSCEEEEEEEEEECSSTTCCCSSEETTBCCSEEEEEEEEEGG-GSSHHHHTTSTTSEEEEEEEEEESSC-CGGGHHH
T ss_pred             CCCCCcEEEEEEEEecCCCCCCCCcceeccccCCcceeEEEecCC-CCCHHHHhhccCceEEEEEEEecCCC-CHHHHHH
Confidence            999999999999999999999999999999999999999999996 99999999999999999999999974 9999999


Q ss_pred             HHhhhhccCCCeEEEec
Q psy11192        161 TTNFNKVLFRDFVVRYV  177 (180)
Q Consensus       161 ~~~l~~i~~~~~~~~~~  177 (180)
                      ++.|+.|+.+|+++.++
T Consensus       160 ~~~l~~i~~~g~~~~~~  176 (260)
T 3k34_A          160 VDVLDSIKTKGKSADFT  176 (260)
T ss_dssp             HHHGGGSCSTTCEEECC
T ss_pred             HHHHHhhccCCceeecC
Confidence            99999999999998874
>2foy_A Carbonic anhydrase 1; lyase, zinc, inhibitor, copper; HET: B30; 1.55A {Homo sapiens} SCOP: b.74.1.1 PDB: 1bzm_A* 1czm_A* 1azm_A 1hug_A 1huh_A 1hcb_A* 2fw4_A* 2nmx_A* 2nn1_A* 2nn7_A* 3lxe_A* 1jv0_A 1j9w_A 1crm_A 2cab_A 2it4_A Back     alignment and structure
>3d0n_A Carbonic anhydrase 13; lyase, metal-binding, metal binding PROT; HET: GOL; 1.55A {Homo sapiens} PDB: 3czv_A* 3da2_A* Back     alignment and structure
>3ml5_A Carbonic anhydrase 7; protein-inhibitor complex, lyase; HET: AZM; 2.05A {Homo sapiens} SCOP: b.74.1.1 PDB: 3mdz_A* Back     alignment and structure
>3jxf_A Receptor-type tyrosine-protein phosphatase zeta; Ca-like domain, alternative splicing, glycoprotein, hydrolase, membrane, polymorphism; 2.00A {Homo sapiens} SCOP: b.74.1.0 PDB: 3s97_A* Back     alignment and structure
>1rj5_A Carbonic anhydrase XIV; beta-sheet, alpha-helix, zinc enzyme, lyase; HET: NAG BMA; 2.81A {Mus musculus} SCOP: b.74.1.1 PDB: 1rj6_A* Back     alignment and structure
>3fw3_A Carbonic anhydrase 4; structure-based drug design. small molecule complex. CO-CRYS membrane, disease mutation, glycoprotein, GPI-anchor; HET: ETS GLC; 1.72A {Homo sapiens} SCOP: b.74.1.1 PDB: 1znc_A* 3f7b_A* 3f7u_A* Back     alignment and structure
>3fe4_A Carbonic anhydrase 6; secretion, metal binding, structural GEN structural genomics consortium, SGC, glycoprotein, lyase, M binding, secreted; 1.90A {Homo sapiens} SCOP: b.74.1.0 Back     alignment and structure
>1jd0_A Carbonic anhydrase XII; extracellular domain, bitopic protein, type I membrane protein, lyase; HET: AZM; 1.50A {Homo sapiens} SCOP: b.74.1.1 PDB: 1jcz_A* Back     alignment and structure
>1keq_A F65A/Y131C-MI carbonic anhydrase V; proton transfer, engineered residue, lyase; HET: 4MZ; 1.88A {Mus musculus} SCOP: b.74.1.1 PDB: 1dmx_A 1dmy_A* 1urt_A Back     alignment and structure
>3iai_A Carbonic anhydrase 9; transmembrane proteins, cell membrane, projection, disulfide bond, glycoprotein, lyase, membrane, binding, nucleus; HET: AZM NAG BMA MAN; 2.20A {Homo sapiens} SCOP: b.74.1.0 Back     alignment and structure
>2w2j_A Carbonic anhydrase-related protein; lyase, metal-binding; 1.60A {Homo sapiens} Back     alignment and structure
>2znc_A Carbonic anhydrase IV; lyase, zinc, murine, membrane; 2.80A {Mus musculus} SCOP: b.74.1.1 PDB: 3znc_A* Back     alignment and structure
>4e9o_X D8L antigen, IMV membrane protein; CAH alpha fold, VP7 motif, beta sheet, cell surface chondroi binding, viral entry, chondroitin sulfate; 1.42A {Vaccinia virus} PDB: 4etq_X Back     alignment and structure
>3q31_A Carbonic anhydrase; glysosy secreted, dimeric, lyase; HET: NAG; 2.70A {Aspergillus oryzae} Back     alignment and structure
>1kop_A Carbonic anhydrase; lyase, structural trimming; 1.90A {Neisseria gonorrhoeae} SCOP: b.74.1.1 PDB: 1koq_A Back     alignment and structure
>3b1b_A Carbonic anhydrase 1; N-glycosylation, zinc-finger, lyase; HET: NAG; 1.88A {Chlamydomonas reinhardtii} Back     alignment and structure
>1y7w_A Halotolerant alpha-type carbonic anhydrase (DCA I; haltolerant protein, algal Ca anhydrase, salt tolerant protein, zinc enzyme; 1.86A {Dunaliella salina} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 180
d1hcba_258 b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapi 9e-34
d1znca_262 b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapi 1e-33
d1flja_259 b.74.1.1 (A:) Carbonic anhydrase {Rat (Rattus norv 1e-32
d1luga_259 b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapi 6e-31
d1rj6a_259 b.74.1.1 (A:) Carbonic anhydrase {Mouse (Mus muscu 6e-31
d2znca_258 b.74.1.1 (A:) Carbonic anhydrase {Mouse (Mus muscu 4e-30
d1keqa_238 b.74.1.1 (A:) Carbonic anhydrase {Mouse (Mus muscu 1e-28
d1jd0a_260 b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapi 5e-26
d1kopa_223 b.74.1.1 (A:) Carbonic anhydrase {Neisseria gonorr 2e-17
>d1hcba_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme I [TaxId: 9606]} Length = 258 Back     information, alignment and structure

class: All beta proteins
fold: Carbonic anhydrase
superfamily: Carbonic anhydrase
family: Carbonic anhydrase
domain: Carbonic anhydrase
species: Human (Homo sapiens), erythrocytes, isozyme I [TaxId: 9606]

 Score =  118 bits (295), Expect = 9e-34
 Identities = 38/160 (23%), Positives = 77/160 (48%), Gaps = 6/160 (3%)

Query: 2   FSMSTGPQYWGRINPEWSLCNKGRRQSPINVDPEHLLFDPHLTELEIDKNKVS-GVLQNT 60
           +    GP+ W ++ P       G  QSP+++       D  L  + +  N  +   + N 
Sbjct: 5   YDDKNGPEQWSKLYP----IANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINV 60

Query: 61  GQSLVFRVDKDTKHHVNISGGPLAYRYQFEEFYFRYGQVNDKGSEHQIHGYSFPGEIQLY 120
           G S     + +    V + GGP +  Y+  +F+F +G  N+ GSEH + G  +  E+ + 
Sbjct: 61  GHSFHVNFEDNDNRSV-LKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVA 119

Query: 121 GYNAELYHNMSEAQHKPQGIVGISLMIQLGERSNDELRIV 160
            +N+  Y +++EA  K  G+  I +++++GE +    +++
Sbjct: 120 HWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVL 159
>d1znca_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), isozyme IV [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1flja_ b.74.1.1 (A:) Carbonic anhydrase {Rat (Rattus norvegicus), isozyme III [TaxId: 10116]} Length = 259 Back     information, alignment and structure
>d1luga_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II [TaxId: 9606]} Length = 259 Back     information, alignment and structure
>d1rj6a_ b.74.1.1 (A:) Carbonic anhydrase {Mouse (Mus musculus), isozyme XIV [TaxId: 10090]} Length = 259 Back     information, alignment and structure
>d2znca_ b.74.1.1 (A:) Carbonic anhydrase {Mouse (Mus musculus), isozyme IV [TaxId: 10090]} Length = 258 Back     information, alignment and structure
>d1keqa_ b.74.1.1 (A:) Carbonic anhydrase {Mouse (Mus musculus), liver, isozyme V [TaxId: 10090]} Length = 238 Back     information, alignment and structure
>d1jd0a_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), isozyme XII [TaxId: 9606]} Length = 260 Back     information, alignment and structure
>d1kopa_ b.74.1.1 (A:) Carbonic anhydrase {Neisseria gonorrhoeae [TaxId: 485]} Length = 223 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query180
d1flja_259 Carbonic anhydrase {Rat (Rattus norvegicus), isozy 100.0
d1hcba_258 Carbonic anhydrase {Human (Homo sapiens), erythroc 100.0
d1luga_259 Carbonic anhydrase {Human (Homo sapiens), erythroc 100.0
d1znca_262 Carbonic anhydrase {Human (Homo sapiens), isozyme 100.0
d1rj6a_259 Carbonic anhydrase {Mouse (Mus musculus), isozyme 100.0
d2znca_258 Carbonic anhydrase {Mouse (Mus musculus), isozyme 100.0
d1jd0a_260 Carbonic anhydrase {Human (Homo sapiens), isozyme 100.0
d1keqa_238 Carbonic anhydrase {Mouse (Mus musculus), liver, i 100.0
d1kopa_223 Carbonic anhydrase {Neisseria gonorrhoeae [TaxId: 100.0
>d1flja_ b.74.1.1 (A:) Carbonic anhydrase {Rat (Rattus norvegicus), isozyme III [TaxId: 10116]} Back     information, alignment and structure
class: All beta proteins
fold: Carbonic anhydrase
superfamily: Carbonic anhydrase
family: Carbonic anhydrase
domain: Carbonic anhydrase
species: Rat (Rattus norvegicus), isozyme III [TaxId: 10116]

Probab=100.00  E-value=2.1e-49  Score=321.86  Aligned_cols=169  Identities=25%  Similarity=0.568  Sum_probs=154.3

Q ss_pred             CCCCCCCCCccccCCCcccCCCCCCCCCceeeCCCceeCCCCCceeeeccC-eeeEEEecCcEEEEEeCCCCCeeEEEec
Q psy11192          2 FSMSTGPQYWGRINPEWSLCNKGRRQSPINVDPEHLLFDPHLTELEIDKNK-VSGVLQNTGQSLVFRVDKDTKHHVNISG   80 (180)
Q Consensus         2 ~~~~~gP~~W~~~~p~~~~C~~G~~QSPInI~~~~~~~~~~l~~l~~~y~~-~~~~i~N~G~tv~v~~~~~~~~~~~i~G   80 (180)
                      |.+..||++|+.++|    ||+|++||||||.+..+...+.+.+|.++|.. ...++.|+||+++|.+++..... .+.|
T Consensus         6 Y~~~~GP~~W~~~~~----c~~G~~QSPInI~~~~~~~~~~l~~l~~~y~~~~~~~l~N~G~t~~~~~~~~~~~~-~~~g   80 (259)
T d1flja_           6 YASHNGPEHWHELYP----IAKGDNQSPIELHTKDIRHDPSLQPWSVSYDPGSAKTILNNGKTCRVVFDDTFDRS-MLRG   80 (259)
T ss_dssp             SSTTTSGGGGGGTCG----GGGSSSCSCCEECGGGEEECTTCCCEEEECCGGGEEEEEECSSCEEEEECCSSSSS-EEEE
T ss_pred             CCCCCChhHhccccc----CCCCCccCCEeECcCceeECCCCCceeeeccCCCceEEEecCeEEEEEEcCCCCee-EEec
Confidence            788899999999876    66999999999999888888888999999964 56789999999999998754433 4889


Q ss_pred             CCCCcceEeEEEEEEeeCCCCCCCceeeccCCCCceeEEEeeccccCCChhHhhcCCCcEEEEEEEEEeCCCCChhHHHH
Q psy11192         81 GPLAYRYQFEEFYFRYGQVNDKGSEHQIHGYSFPGEIQLYGYNAELYHNMSEAQHKPQGIVGISLMIQLGERSNDELRIV  160 (180)
Q Consensus        81 g~l~~~Y~l~q~HfHWG~~~~~gSEH~idG~~~~~E~H~Vh~~~~~y~~~~eA~~~~~glaVlav~~~~~~~~n~~l~~i  160 (180)
                      |+|..+|+|.|||||||..+..||||+|||++|||||||||++.+ |.++.+|++.++++||||+|+++++ +|+.++.|
T Consensus        81 g~l~~~Y~l~q~hfHwG~~~~~gSEH~idG~~~~~E~h~VH~n~~-~~~~~~a~~~~~~lav~~v~~~~~~-~n~~~~~i  158 (259)
T d1flja_          81 GPLSGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHLVHWNPK-YNTFGEALKQPDGIAVVGIFLKIGR-EKGEFQIL  158 (259)
T ss_dssp             TTCSSCEEEEEEEEEECSSTTCCCSSEETTBCCSEEEEEEEECGG-GSSHHHHTTSTTSEEEEEEEEEESS-CCHHHHHH
T ss_pred             CccccceeeEEEEEEeCCCCCCCcceeECCEecCCceEEEEecCC-CCCHHHHhcCCCCcEEEEEEEecCC-cchHHHHH
Confidence            999999999999999999999999999999999999999999987 9999999999999999999999997 59999999


Q ss_pred             HHhhhhccCCCeEEEec
Q psy11192        161 TTNFNKVLFRDFVVRYV  177 (180)
Q Consensus       161 ~~~l~~i~~~~~~~~~~  177 (180)
                      ++.|+.|..+++++.+.
T Consensus       159 ~~~l~~i~~~~~~~~~~  175 (259)
T d1flja_         159 LDALDKIKTKGKEAPFN  175 (259)
T ss_dssp             HHHGGGGCSTTCEEECC
T ss_pred             HHHHHhhhccCceeccC
Confidence            99999999999988764
>d1hcba_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme I [TaxId: 9606]} Back     information, alignment and structure
>d1luga_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II [TaxId: 9606]} Back     information, alignment and structure
>d1znca_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), isozyme IV [TaxId: 9606]} Back     information, alignment and structure
>d1rj6a_ b.74.1.1 (A:) Carbonic anhydrase {Mouse (Mus musculus), isozyme XIV [TaxId: 10090]} Back     information, alignment and structure
>d2znca_ b.74.1.1 (A:) Carbonic anhydrase {Mouse (Mus musculus), isozyme IV [TaxId: 10090]} Back     information, alignment and structure
>d1jd0a_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), isozyme XII [TaxId: 9606]} Back     information, alignment and structure
>d1keqa_ b.74.1.1 (A:) Carbonic anhydrase {Mouse (Mus musculus), liver, isozyme V [TaxId: 10090]} Back     information, alignment and structure
>d1kopa_ b.74.1.1 (A:) Carbonic anhydrase {Neisseria gonorrhoeae [TaxId: 485]} Back     information, alignment and structure