Psyllid ID: psy11287

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110--
MLLVLASRFQFDSVGYLGETGPCSSNPCRNDGHCVVKNGKAVCKCPSCSAEYNPVCGSDGISYENECKLNLEACQHSRQISVLYIGLCSKGLLREIDKARQENEIPPGKLQS
cccEEEEcccccccccccccccccccccccccEEEEEccEEEEEcccccccccccccccccEEccHHHHHHHHHHcccccEEEEEccccccccccccccccccccccccccc
cEEEEEEEEEEEEcccccccccccccEcccccEEEEccccEEEEccccccccccEEEccccEEccHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHcccccccccccccc
MLLVLASrfqfdsvgylgetgpcssnpcrndghcvvkngkavckcpscsaeynpvcgsdgisyeNECKLNLEACQHSRQISVLYIGLCSKGLLREIDKarqeneippgklqs
MLLVLASRFQFDSVGYLGETGPCSSNPCRNDGHCVVKNGKAVCKCPSCSAEYNPVCGSDGISYENECKLNLEACQHSRQISVLYIGLCSKGLLREIDkarqeneippgklqs
MLLVLASRFQFDSVGYLGETGPCSSNPCRNDGHCVVKNGKAVCKCPSCSAEYNPVCGSDGISYENECKLNLEACQHSRQISVLYIGLCSKGLLREIDKARQENEIPPGKLQS
**LVLASRFQFDSVGYLGETGPCSSNPCRNDGHCVVKNGKAVCKCPSCSAEYNPVCGSDGISYENECKLNLEACQHSRQISVLYIGLCSKGLLREI****************
*********************PCSSNPCRNDGHCVVKNGKAVCKCPSCSAEYNPVCGSDGISYENECKLNLEACQHSRQISVLYIGLCS***********************
MLLVLASRFQFDSVGYLGETGPCSSNPCRNDGHCVVKNGKAVCKCPSCSAEYNPVCGSDGISYENECKLNLEACQHSRQISVLYIGLCSKGLLREIDKARQ***********
MLLVLASRFQFDSVGYLGETGPCSSNPCRNDGHCVVKNGKAVCKCPSCSAEYNPVCGSDGISYENECKLNLEACQHSRQISVLYIGLCSKGLLREIDKAR************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLLVLASRFQFDSVGYLGETGPCSSNPCRNDGHCVVKNGKAVCKCPSCSAEYNPVCGSDGISYENECKLNLEACQHSRQISVLYIGLCSKGLLREIDKARQENEIPPGKLQS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query112 2.2.26 [Sep-21-2011]
A2ASQ1 1950 Agrin OS=Mus musculus GN= yes N/A 0.705 0.040 0.430 4e-10
O00468 2067 Agrin OS=Homo sapiens GN= yes N/A 0.625 0.033 0.423 1e-09
P31696 2081 Agrin OS=Gallus gallus GN yes N/A 0.660 0.035 0.453 1e-09
P25304 1959 Agrin OS=Rattus norvegicu yes N/A 0.714 0.040 0.404 1e-08
Q8N475 847 Follistatin-related prote no N/A 0.839 0.110 0.316 2e-08
Q6MZW2 842 Follistatin-related prote no N/A 0.589 0.078 0.405 4e-08
Q17QD6 374 Tomoregulin-2 OS=Bos taur no N/A 0.598 0.179 0.411 2e-07
Q9QYM9 374 Tomoregulin-2 OS=Mus musc no N/A 0.598 0.179 0.411 2e-07
Q8BFR2 847 Follistatin-related prote no N/A 0.598 0.079 0.371 2e-07
Q9UIK5 374 Tomoregulin-2 OS=Homo sap no N/A 0.598 0.179 0.411 4e-07
>sp|A2ASQ1|AGRIN_MOUSE Agrin OS=Mus musculus GN=Agrn PE=1 SV=1 Back     alignment and function desciption
 Score = 63.5 bits (153), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 47/86 (54%), Gaps = 7/86 (8%)

Query: 22  PCSSNPCRNDGHCVVKNGKAVCKCPS-CSAEYNPVCGSDGISYENECKLNLEACQHSRQI 80
           PC    C     C VKNGKAVC+C   CS  Y+PVCGSDG++Y + C+L   AC   R+I
Sbjct: 362 PCRGAQCAFGATCTVKNGKAVCECQRVCSGGYDPVCGSDGVTYGSVCELESMACTLGREI 421

Query: 81  SVLYIGLCSK------GLLREIDKAR 100
            V   G C +      G L E++  R
Sbjct: 422 RVARRGPCDRCGQCRFGSLCEVETGR 447
Plays a central role in the formation and the maintenance of the neuromuscular junction (NMJ), the synapse between motor neuron and skeletal muscle. Ligand of the MUSK signaling complex that directly binds LRP4 in this complex and induces the phosphorylation of MUSK, the kinase of the complex. The activation of MUSK in myotubes induces the formation of NMJ by regulating different processes including the transcription of specific genes and the clustering of AChR in the postsynaptic membrane.
Mus musculus (taxid: 10090)
>sp|O00468|AGRIN_HUMAN Agrin OS=Homo sapiens GN=AGRN PE=1 SV=5 Back     alignment and function description
>sp|P31696|AGRIN_CHICK Agrin OS=Gallus gallus GN=AGRN PE=1 SV=3 Back     alignment and function description
>sp|P25304|AGRIN_RAT Agrin OS=Rattus norvegicus GN=Agrn PE=1 SV=2 Back     alignment and function description
>sp|Q8N475|FSTL5_HUMAN Follistatin-related protein 5 OS=Homo sapiens GN=FSTL5 PE=2 SV=2 Back     alignment and function description
>sp|Q6MZW2|FSTL4_HUMAN Follistatin-related protein 4 OS=Homo sapiens GN=FSTL4 PE=2 SV=3 Back     alignment and function description
>sp|Q17QD6|TEFF2_BOVIN Tomoregulin-2 OS=Bos taurus GN=TMEFF2 PE=2 SV=1 Back     alignment and function description
>sp|Q9QYM9|TEFF2_MOUSE Tomoregulin-2 OS=Mus musculus GN=Tmeff2 PE=2 SV=1 Back     alignment and function description
>sp|Q8BFR2|FSTL5_MOUSE Follistatin-related protein 5 OS=Mus musculus GN=Fstl5 PE=2 SV=1 Back     alignment and function description
>sp|Q9UIK5|TEFF2_HUMAN Tomoregulin-2 OS=Homo sapiens GN=TMEFF2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query112
242020688 1614 Agrin precursor, putative [Pediculus hum 0.723 0.050 0.566 3e-19
322800545 318 hypothetical protein SINV_04289 [Solenop 0.705 0.248 0.540 1e-18
307179324 1668 Agrin [Camponotus floridanus] 0.642 0.043 0.592 2e-18
332020060 569 Agrin [Acromyrmex echinatior] 0.660 0.130 0.605 5e-18
189233617 2027 PREDICTED: similar to agrin [Tribolium c 0.651 0.036 0.613 8e-18
270014663 1796 hypothetical protein TcasGA2_TC004709 [T 0.651 0.040 0.613 1e-17
350425393 2243 PREDICTED: agrin-like [Bombus impatiens] 0.75 0.037 0.488 8e-17
340723263 2243 PREDICTED: agrin-like [Bombus terrestris 0.75 0.037 0.488 8e-17
383850257 1852 PREDICTED: agrin-like [Megachile rotunda 0.75 0.045 0.488 9e-17
380027342 1784 PREDICTED: agrin-like [Apis florea] 0.732 0.045 0.5 2e-16
>gi|242020688|ref|XP_002430784.1| Agrin precursor, putative [Pediculus humanus corporis] gi|212515981|gb|EEB18046.1| Agrin precursor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score = 99.4 bits (246), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 47/83 (56%), Positives = 58/83 (69%)

Query: 7   SRFQFDSVGYLGETGPCSSNPCRNDGHCVVKNGKAVCKCPSCSAEYNPVCGSDGISYENE 66
           ++ +    G  G  GPCS + C N   CV + GK  C+CP+C +E++PVCGSDGISY NE
Sbjct: 245 TKLETSYAGICGGEGPCSGHFCTNGALCVERGGKPYCECPTCPSEFDPVCGSDGISYGNE 304

Query: 67  CKLNLEACQHSRQISVLYIGLCS 89
           CKL LEACQH R ISVLY GLC+
Sbjct: 305 CKLRLEACQHRRDISVLYPGLCN 327

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|322800545|gb|EFZ21537.1| hypothetical protein SINV_04289 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|307179324|gb|EFN67688.1| Agrin [Camponotus floridanus] Back     alignment and taxonomy information
>gi|332020060|gb|EGI60511.1| Agrin [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|189233617|ref|XP_001811978.1| PREDICTED: similar to agrin [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270014663|gb|EFA11111.1| hypothetical protein TcasGA2_TC004709 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|350425393|ref|XP_003494108.1| PREDICTED: agrin-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340723263|ref|XP_003400011.1| PREDICTED: agrin-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|383850257|ref|XP_003700712.1| PREDICTED: agrin-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|380027342|ref|XP_003697386.1| PREDICTED: agrin-like [Apis florea] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query112
UNIPROTKB|F1MSI2 2032 AGRN "Uncharacterized protein" 0.625 0.034 0.474 4.3e-12
MGI|MGI:87961 1950 Agrn "agrin" [Mus musculus (ta 0.616 0.035 0.471 1.1e-11
UNIPROTKB|F1P3E3 1952 AGRN "Agrin" [Gallus gallus (t 0.660 0.037 0.453 1.4e-11
UNIPROTKB|F1NWQ6 1998 AGRN "Agrin" [Gallus gallus (t 0.660 0.037 0.453 1.4e-11
UNIPROTKB|P31696 2081 AGRN "Agrin" [Gallus gallus (t 0.660 0.035 0.453 1.5e-11
UNIPROTKB|O00468 2067 AGRN "Agrin" [Homo sapiens (ta 0.616 0.033 0.442 3.1e-11
WB|WBGene00018304 1473 agr-1 [Caenorhabditis elegans 0.669 0.050 0.421 3.4e-11
UNIPROTKB|Q17QD6 374 TMEFF2 "Tomoregulin-2" [Bos ta 0.598 0.179 0.411 8.2e-11
MGI|MGI:1861735 374 Tmeff2 "transmembrane protein 0.598 0.179 0.411 8.2e-11
RGD|2067 1959 Agrn "agrin" [Rattus norvegicu 0.598 0.034 0.470 1.3e-10
UNIPROTKB|F1MSI2 AGRN "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 179 (68.1 bits), Expect = 4.3e-12, P = 4.3e-12
 Identities = 37/78 (47%), Positives = 46/78 (58%)

Query:    21 GPC--SSNPCRN-----DGHCVVKNGKAVCKCP-SCSAEYNPVCGSDGISYENECKLNLE 72
             GPC  S +PCR         C VKNG+A C CP +CS  Y+PVCGSDGI+Y + C+L   
Sbjct:   450 GPCDQSPSPCRGVQCPFGAMCAVKNGEAECACPKACSGVYDPVCGSDGITYGSACELEAT 509

Query:    73 ACQHSRQISVLYIGLCSK 90
             AC   R+I V   G C +
Sbjct:   510 ACALGREIRVARRGPCDR 527
GO:0043113 "receptor clustering" evidence=IEA
GO:0005605 "basal lamina" evidence=IEA
GO:0043236 "laminin binding" evidence=IEA
GO:0007213 "G-protein coupled acetylcholine receptor signaling pathway" evidence=IEA
MGI|MGI:87961 Agrn "agrin" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1P3E3 AGRN "Agrin" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NWQ6 AGRN "Agrin" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P31696 AGRN "Agrin" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|O00468 AGRN "Agrin" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
WB|WBGene00018304 agr-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q17QD6 TMEFF2 "Tomoregulin-2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1861735 Tmeff2 "transmembrane protein with EGF-like and two follistatin-like domains 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|2067 Agrn "agrin" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query112
smart0028046 smart00280, KAZAL, Kazal type serine protease inhi 1e-11
cd0010441 cd00104, KAZAL_FS, Kazal type serine protease inhi 3e-10
pfam0005048 pfam00050, Kazal_1, Kazal-type serine protease inh 8e-09
cd0132745 cd01327, KAZAL_PSTI, Kazal-type pancreatic secreto 9e-07
pfam0764842 pfam07648, Kazal_2, Kazal-type serine protease inh 1e-06
>gnl|CDD|197624 smart00280, KAZAL, Kazal type serine protease inhibitors Back     alignment and domain information 
 Score = 54.6 bits (132), Expect = 1e-11
 Identities = 23/45 (51%), Positives = 29/45 (64%), Gaps = 1/45 (2%)

Query: 45 CPS-CSAEYNPVCGSDGISYENECKLNLEACQHSRQISVLYIGLC 88
          CP  C  EY+PVCGSDG++Y NEC L   AC+  + I V + G C
Sbjct: 2  CPEACPREYDPVCGSDGVTYSNECHLCKAACESGKSIEVKHDGPC 46

Kazal type serine protease inhibitors and follistatin-like domains. Length = 46
>gnl|CDD|238052 cd00104, KAZAL_FS, Kazal type serine protease inhibitors and follistatin-like domains Back     alignment and domain information
>gnl|CDD|200959 pfam00050, Kazal_1, Kazal-type serine protease inhibitor domain Back     alignment and domain information
>gnl|CDD|238648 cd01327, KAZAL_PSTI, Kazal-type pancreatic secretory trypsin inhibitors (PSTI) and related proteins, including the second domain of the ovomucoid turkey inhibitor and the C-terminal domain of the esophagus cancer-related gene-2 protein (ECRG-2), are members of the superfamily of kazal-type proteinase inhibitors and follistatin-like proteins Back     alignment and domain information
>gnl|CDD|191798 pfam07648, Kazal_2, Kazal-type serine protease inhibitor domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 112
cd0132886 FSL_SPARC Follistatin-like SPARC (secreted protein 99.8
smart0028046 KAZAL Kazal type serine protease inhibitors. Kazal 99.65
cd0132745 KAZAL_PSTI Kazal-type pancreatic secretory trypsin 99.63
PF0005048 Kazal_1: Kazal-type serine protease inhibitor doma 99.5
PF0764842 Kazal_2: Kazal-type serine protease inhibitor doma 99.48
cd0010441 KAZAL_FS Kazal type serine protease inhibitors and 99.44
KOG4004|consensus 259 99.03
KOG3555|consensus 434 98.59
smart0005769 FIMAC factor I membrane attack complex. 98.44
KOG4578|consensus 421 98.3
cd0133054 KAZAL_SLC21 The kazal-type serine protease inhibit 97.27
KOG4597|consensus 560 96.05
smart0027426 FOLN Follistatin-N-terminal domain-like. Follistat 95.68
PF0928922 FOLN: Follistatin/Osteonectin-like EGF domain; Int 94.9
TIGR00805 633 oat sodium-independent organic anion transporter. 92.71
cd0132745 KAZAL_PSTI Kazal-type pancreatic secretory trypsin 89.19
cd0132886 FSL_SPARC Follistatin-like SPARC (secreted protein 87.41
PF0000832 EGF: EGF-like domain This is a sub-family of the P 86.29
KOG1219|consensus 4289 85.97
>cd01328 FSL_SPARC Follistatin-like SPARC (secreted protein, acidic, and rich in cysteines) domain; SPARC/BM-40/osteonectin is a multifunctional glycoprotein which modulates cellular interaction with the extracellular matrix by its binding to structural matrix proteins such as collagen and vitronectin Back     alignment and domain information 
Probab=99.80  E-value=9.2e-20  Score=119.74  Aligned_cols=69  Identities=26%  Similarity=0.735  Sum_probs=62.2

Q ss_pred             CCCCCCCCCCCccccc-CCeeeeeCC-CCCCCC---CCeEcccCcEechhhHHHHHHhhCC-----------CCceEeee
Q psy11287         22 PCSSNPCRNDGHCVVK-NGKAVCKCP-SCSAEY---NPVCGSDGISYENECKLNLEACQHS-----------RQISVLYI   85 (112)
Q Consensus        22 ~C~~~~C~~g~~C~~~-~~~~~C~C~-~C~~~~---~pVCGSDG~TY~n~C~l~~~~C~~~-----------~~i~i~~~   85 (112)
                      ||+++.|++|++|+++ +++|+|+|. .||.++   .+||||||+||.|+|+|++++|..+           .+|+|.|+
T Consensus         1 pC~~v~C~~G~~C~~d~~~~p~CvC~~~Cp~~~~~~~~VCGsDg~TY~s~C~L~r~~C~~~~~~~~~~~~~~~~l~i~Y~   80 (86)
T cd01328           1 PCENHHCGAGKVCEVDDENTPKCVCIDPCPEEVDDRRKVCTNDNETFDSDCELYRTRCLCKGGKKGCRGPKYQHLHLDYY   80 (86)
T ss_pred             CCCCcCCCCCCEeeECCCCCeEEecCCcCCCCCCCCCceeCCCCCCcccHhHHhhhHhccCCCCcCCCCCccCeEEEEee
Confidence            6899999999999996 789999998 899865   5699999999999999999999732           48999999


Q ss_pred             cCCCC
Q psy11287         86 GLCSK   90 (112)
Q Consensus        86 G~C~~   90 (112)
                      |+|+.
T Consensus        81 G~Ck~   85 (86)
T cd01328          81 GECKE   85 (86)
T ss_pred             ccccC
Confidence            99974

The protein it composed of an N-terminal acidic region, a follistatin (FS) domain and an EF-hand calcium binding domain. The FS domain consists of an N-terminal beta hairpin (FOLN/EGF-like domain) and a small hydrophobic core of alpha/beta structure (Kazal domain) and has five disulfide bonds and a conserved N-glycosylation site. The FSL_SPARC domain is a member of the superfamily of kazal-like proteinase inhibitors and follistatin-like proteins.
>smart00280 KAZAL Kazal type serine protease inhibitors Back     alignment and domain information
>cd01327 KAZAL_PSTI Kazal-type pancreatic secretory trypsin inhibitors (PSTI) and related proteins, including the second domain of the ovomucoid turkey inhibitor and the C-terminal domain of the esophagus cancer-related gene-2 protein (ECRG-2), are members of the superfamily of kazal-type proteinase inhibitors and follistatin-like proteins Back     alignment and domain information
>PF00050 Kazal_1: Kazal-type serine protease inhibitor domain; InterPro: IPR002350 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively Back     alignment and domain information
>PF07648 Kazal_2: Kazal-type serine protease inhibitor domain; InterPro: IPR011497 This domain is usually indicative of serine protease inhibitors that belong to Merops inhibitor families: I1, I2, I17 and I31 Back     alignment and domain information
>cd00104 KAZAL_FS Kazal type serine protease inhibitors and follistatin-like domains Back     alignment and domain information
>KOG4004|consensus Back     alignment and domain information
>KOG3555|consensus Back     alignment and domain information
>smart00057 FIMAC factor I membrane attack complex Back     alignment and domain information
>KOG4578|consensus Back     alignment and domain information
>cd01330 KAZAL_SLC21 The kazal-type serine protease inhibitor domain has been detected in an extracellular loop region of solute carrier 21 (SLC21) family members (organic anion transporters) , which may regulate the specificity of anion uptake Back     alignment and domain information
>KOG4597|consensus Back     alignment and domain information
>smart00274 FOLN Follistatin-N-terminal domain-like Back     alignment and domain information
>PF09289 FOLN: Follistatin/Osteonectin-like EGF domain; InterPro: IPR015369 This domain is predominantly found in osteonectin and follistatin Back     alignment and domain information
>TIGR00805 oat sodium-independent organic anion transporter Back     alignment and domain information
>cd01327 KAZAL_PSTI Kazal-type pancreatic secretory trypsin inhibitors (PSTI) and related proteins, including the second domain of the ovomucoid turkey inhibitor and the C-terminal domain of the esophagus cancer-related gene-2 protein (ECRG-2), are members of the superfamily of kazal-type proteinase inhibitors and follistatin-like proteins Back     alignment and domain information
>cd01328 FSL_SPARC Follistatin-like SPARC (secreted protein, acidic, and rich in cysteines) domain; SPARC/BM-40/osteonectin is a multifunctional glycoprotein which modulates cellular interaction with the extracellular matrix by its binding to structural matrix proteins such as collagen and vitronectin Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query112
1pce_A60 Solution Structure And Dynamics Of Pec-60, A Protei 2e-06
2kcx_A74 Solution Nmr Structure Of Kazal-1 Domain Of Human F 6e-05
1y1b_A48 Solution Structure Of Anemonia Elastase Inhibitor L 6e-05
3b4v_C237 X-Ray Structure Of Activin In Complex With Fstl3 Le 1e-04
3sek_C209 Crystal Structure Of The Myostatin:follistatin-Like 2e-04
1y1c_A48 Solution Structure Of Anemonia Elastase Inhibitor A 3e-04
1cgj_I56 Three-Dimensional Structure Of The Complexes Betwee 6e-04
1cgi_I56 Three-Dimensional Structure Of The Complexes Betwee 6e-04
>pdb|1PCE|A Chain A, Solution Structure And Dynamics Of Pec-60, A Protein Of The Kazal Type Inhibitor Family, Determined By Nuclear Magnetic Resonance Spectroscopy Length = 60 Back     alignment and structure 
Iteration: 1

 Score = 47.4 bits (111), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 30/43 (69%)
Query: 46 PSCSAEYNPVCGSDGISYENECKLNLEACQHSRQISVLYIGLC 88
          P CS  Y+PVCG+DG++YE+ECKL L   ++ + I ++  G C
Sbjct: 18 PDCSRIYDPVCGTDGVTYESECKLCLARIENKQDIQIVKDGEC 60
>pdb|2KCX|A Chain A, Solution Nmr Structure Of Kazal-1 Domain Of Human Follistatin-Related Protein 3 (Fstl-3). Northeast Structural Genomics Target Hr6186a Length = 74 Back     alignment and structure
>pdb|1Y1B|A Chain A, Solution Structure Of Anemonia Elastase Inhibitor Length = 48 Back     alignment and structure
>pdb|3B4V|C Chain C, X-Ray Structure Of Activin In Complex With Fstl3 Length = 237 Back     alignment and structure
>pdb|3SEK|C Chain C, Crystal Structure Of The Myostatin:follistatin-Like 3 Complex Length = 209 Back     alignment and structure
>pdb|1Y1C|A Chain A, Solution Structure Of Anemonia Elastase Inhibitor Analogue Length = 48 Back     alignment and structure
>pdb|1CGJ|I Chain I, Three-Dimensional Structure Of The Complexes Between Bovine ChymotrypsinogenA And Two Recombinant Variants Of Human Pancreatic Secretory Trypsin Inhibitor (Kazal-Type) Length = 56 Back     alignment and structure
>pdb|1CGI|I Chain I, Three-Dimensional Structure Of The Complexes Between Bovine ChymotrypsinogenA And Two Recombinant Variants Of Human Pancreatic Secretory Trypsin Inhibitor (Kazal-Type) Length = 56 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query112
1lr7_A74 Follistatin, FS1; heparin-binding, cystine-rich, s 5e-14
1pce_A60 PEC-60; proteinase inhibitor(kazal type); NMR {Sus 2e-13
1uvf_A61 Serine proteinase inhibitor kazal type 5; trypsin 4e-13
3sek_C209 Follistatin-related protein 3; protein-protein com 2e-12
3sek_C209 Follistatin-related protein 3; protein-protein com 7e-08
1uvg_A78 Serine proteinase inhibitor kazal type 5; trypsin 3e-12
3b4v_C237 Follistatin-like 3; ligand-inhibitor signalling co 5e-12
3b4v_C237 Follistatin-like 3; ligand-inhibitor signalling co 4e-07
3b4v_C 237 Follistatin-like 3; ligand-inhibitor signalling co 5e-06
1cgj_I56 Pancreatic secretory trypsin inhibitor (kazal type 2e-11
1y1b_A48 Elastase inhibitor; non-classical, kazal-type, pro 2e-11
2jxd_A62 Serine protease inhibitor kazal-type 2; anti-paral 1e-10
2arp_F152 Follistatin; cystine knot, disulfide rich, EGF dom 2e-10
2arp_F152 Follistatin; cystine knot, disulfide rich, EGF dom 2e-09
1tgs_I56 Pancreatic secretory trypsin inhibitor (kazal type 3e-10
2leo_A66 Serine protease inhibitor kazal-type 7; esophageal 3e-10
1nub_A 229 Basement membrane protein BM-40; extracellular mod 5e-10
2f3c_I55 Thrombin inhibitor infestin; serine protease - inh 5e-10
2erw_A56 Serine protease inhibitor infestin; kazal type dom 7e-10
1r0r_I51 Ovomucoid, omtky3; high resolution, serine proteas 5e-09
3hh2_C 288 Follistatin; protein-protein complex, TB domain, c 6e-09
3hh2_C288 Follistatin; protein-protein complex, TB domain, c 1e-08
3hh2_C288 Follistatin; protein-protein complex, TB domain, c 4e-06
3hh2_C 288 Follistatin; protein-protein complex, TB domain, c 3e-04
1bus_A57 Proteinase inhibitor IIA; HET: PCA; NMR {Bos tauru 1e-08
1tbr_R103 RHODNIIN; complex (serine protease-inhibitor), kaz 3e-08
1tbr_R103 RHODNIIN; complex (serine protease-inhibitor), kaz 1e-07
1yu6_C185 Ovomucoid; protein proteinase inhibitor, protease, 2e-06
1yu6_C185 Ovomucoid; protein proteinase inhibitor, protease, 4e-06
1yu6_C185 Ovomucoid; protein proteinase inhibitor, protease, 1e-05
3qtl_D75 Kazal-type serine protease inhibitor SPI-1; serine 1e-05
3qtl_D75 Kazal-type serine protease inhibitor SPI-1; serine 8e-04
3asi_A 410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 6e-05
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 5e-04
1ldt_L46 LDTI, tryptase inhibitor; complex (hydrolase/inhib 5e-04
>1lr7_A Follistatin, FS1; heparin-binding, cystine-rich, sucrose octasulphate, hormone/growth factor complex; HET: SO4; 1.50A {Rattus norvegicus} SCOP: g.3.11.3 g.68.1.1 PDB: 1lr8_A* 1lr9_A Length = 74 Back     alignment and structure
 Score = 60.7 bits (147), Expect = 5e-14
 Identities = 24/71 (33%), Positives = 30/71 (42%), Gaps = 4/71 (5%)

Query: 22 PCSSNPCRNDGHCVV-KNGKAVCKCP---SCSAEYNPVCGSDGISYENECKLNLEACQHS 77
           C +  C     C + K  K  C C    S      PVCG DG +Y NEC L    C+  
Sbjct: 3  TCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQ 62

Query: 78 RQISVLYIGLC 88
           ++ V Y G C
Sbjct: 63 PELEVQYQGKC 73
>1pce_A PEC-60; proteinase inhibitor(kazal type); NMR {Sus scrofa} SCOP: g.68.1.1 Length = 60 Back     alignment and structure
>3sek_C Follistatin-related protein 3; protein-protein complex, TB domain, cystine knot motif, TGF- fold, disulfide linked dimer, follistatin domain (FSD); HET: NAG; 2.40A {Homo sapiens} PDB: 2kcx_A Length = 209 Back     alignment and structure
>3sek_C Follistatin-related protein 3; protein-protein complex, TB domain, cystine knot motif, TGF- fold, disulfide linked dimer, follistatin domain (FSD); HET: NAG; 2.40A {Homo sapiens} PDB: 2kcx_A Length = 209 Back     alignment and structure
>3b4v_C Follistatin-like 3; ligand-inhibitor signalling complex, cleavage on PAIR of BAS residues, glycoprotein, growth factor, hormone, secreted; HET: NAG; 2.48A {Homo sapiens} Length = 237 Back     alignment and structure
>3b4v_C Follistatin-like 3; ligand-inhibitor signalling complex, cleavage on PAIR of BAS residues, glycoprotein, growth factor, hormone, secreted; HET: NAG; 2.48A {Homo sapiens} Length = 237 Back     alignment and structure
>3b4v_C Follistatin-like 3; ligand-inhibitor signalling complex, cleavage on PAIR of BAS residues, glycoprotein, growth factor, hormone, secreted; HET: NAG; 2.48A {Homo sapiens} Length = 237 Back     alignment and structure
>1cgj_I Pancreatic secretory trypsin inhibitor (kazal type) variant 4; serine protease/inhibitor complex; 2.30A {Homo sapiens} SCOP: g.68.1.1 Length = 56 Back     alignment and structure
>1y1b_A Elastase inhibitor; non-classical, kazal-type, protease inhibitor, CSH motif, hydrolase inhibitor; NMR {Synthetic} PDB: 1y1c_A Length = 48 Back     alignment and structure
>2jxd_A Serine protease inhibitor kazal-type 2; anti-parallel beta sheet, beta-bulge, disulfide bond, alpha helix, pyrrolidone carboxylic acid, secreted; NMR {Homo sapiens} Length = 62 Back     alignment and structure
>2arp_F Follistatin; cystine knot, disulfide rich, EGF domain, kazal domain, PROT complex, hormone-growth factor complex; HET: 1PG; 2.00A {Rattus norvegicus} Length = 152 Back     alignment and structure
>2arp_F Follistatin; cystine knot, disulfide rich, EGF domain, kazal domain, PROT complex, hormone-growth factor complex; HET: 1PG; 2.00A {Rattus norvegicus} Length = 152 Back     alignment and structure
>1tgs_I Pancreatic secretory trypsin inhibitor (kazal type); complex (proteinase/inhibitor); 1.80A {Sus scrofa} SCOP: g.68.1.1 PDB: 1cgi_I 1hpt_A Length = 56 Back     alignment and structure
>2leo_A Serine protease inhibitor kazal-type 7; esophageal cancer-related gene 2, hydrol inhibitor; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* Length = 229 Back     alignment and structure
>2f3c_I Thrombin inhibitor infestin; serine protease - inhibitor complex, kazal-type domain, hydrolase/hydrolase inhibitor complex; 2.50A {Triatoma infestans} SCOP: g.68.1.1 PDB: 1kma_A Length = 55 Back     alignment and structure
>2erw_A Serine protease inhibitor infestin; kazal type domain, blood clotting, hydrolase inhibitor; 1.40A {Triatoma infestans} SCOP: g.68.1.1 Length = 56 Back     alignment and structure
>1r0r_I Ovomucoid, omtky3; high resolution, serine protease, protein inhibitor, hydrolase; 1.10A {Meleagris gallopavo} SCOP: g.68.1.1 PDB: 1sgr_I 2gkr_I 1cho_I 1omt_A 1omu_A 1ppf_I* 1tur_A 1tus_A 3sgb_I 2ovo_A 4ovo_A 1iy5_A 1cso_I 1ct4_I 2sgf_I 2gkt_I 2gkv_A 2nu0_I 1m8b_A 1m8c_A ... Length = 51 Back     alignment and structure
>3hh2_C Follistatin; protein-protein complex, TB domain, cystine knot motif, TGF- fold, disulfide linked dimer, CLE PAIR of basic residues, cytokine; HET: CIT; 2.15A {Homo sapiens} PDB: 2b0u_C* 2p6a_D Length = 288 Back     alignment and structure
>3hh2_C Follistatin; protein-protein complex, TB domain, cystine knot motif, TGF- fold, disulfide linked dimer, CLE PAIR of basic residues, cytokine; HET: CIT; 2.15A {Homo sapiens} PDB: 2b0u_C* 2p6a_D Length = 288 Back     alignment and structure
>3hh2_C Follistatin; protein-protein complex, TB domain, cystine knot motif, TGF- fold, disulfide linked dimer, CLE PAIR of basic residues, cytokine; HET: CIT; 2.15A {Homo sapiens} PDB: 2b0u_C* 2p6a_D Length = 288 Back     alignment and structure
>3hh2_C Follistatin; protein-protein complex, TB domain, cystine knot motif, TGF- fold, disulfide linked dimer, CLE PAIR of basic residues, cytokine; HET: CIT; 2.15A {Homo sapiens} PDB: 2b0u_C* 2p6a_D Length = 288 Back     alignment and structure
>1bus_A Proteinase inhibitor IIA; HET: PCA; NMR {Bos taurus} SCOP: g.68.1.1 PDB: 2bus_A* Length = 57 Back     alignment and structure
>1tbr_R RHODNIIN; complex (serine protease-inhibitor), kazal-type inhibitor, T complex (serine protease-inhibitor) complex; 2.60A {Rhodnius prolixus} SCOP: g.68.1.1 g.68.1.1 PDB: 1tbq_R Length = 103 Back     alignment and structure
>1tbr_R RHODNIIN; complex (serine protease-inhibitor), kazal-type inhibitor, T complex (serine protease-inhibitor) complex; 2.60A {Rhodnius prolixus} SCOP: g.68.1.1 g.68.1.1 PDB: 1tbq_R Length = 103 Back     alignment and structure
>1yu6_C Ovomucoid; protein proteinase inhibitor, protease, hydrolase; 1.55A {Meleagris gallopavo} SCOP: g.68.1.1 PDB: 1z7k_B* Length = 185 Back     alignment and structure
>1yu6_C Ovomucoid; protein proteinase inhibitor, protease, hydrolase; 1.55A {Meleagris gallopavo} SCOP: g.68.1.1 PDB: 1z7k_B* Length = 185 Back     alignment and structure
>1yu6_C Ovomucoid; protein proteinase inhibitor, protease, hydrolase; 1.55A {Meleagris gallopavo} SCOP: g.68.1.1 PDB: 1z7k_B* Length = 185 Back     alignment and structure
>3qtl_D Kazal-type serine protease inhibitor SPI-1; serine protease -kazal type serine protease inhibitor comple hydrolase inhibitor; 2.60A {Carcinoscorpius rotundicauda} Length = 75 Back     alignment and structure
>3qtl_D Kazal-type serine protease inhibitor SPI-1; serine protease -kazal type serine protease inhibitor comple hydrolase inhibitor; 2.60A {Carcinoscorpius rotundicauda} Length = 75 Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Length = 410 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>1ldt_L LDTI, tryptase inhibitor; complex (hydrolase/inhibitor), hydrolase, inflammation; 1.90A {Hirudo medicinalis} SCOP: g.68.1.1 PDB: 1an1_I 2kmo_A 2kmp_A 2kmq_A 2kmr_A Length = 46 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query112
2arp_F152 Follistatin; cystine knot, disulfide rich, EGF dom 99.87
3sek_C209 Follistatin-related protein 3; protein-protein com 99.85
1lr7_A74 Follistatin, FS1; heparin-binding, cystine-rich, s 99.85
3hh2_C 288 Follistatin; protein-protein complex, TB domain, c 99.83
3b4v_C237 Follistatin-like 3; ligand-inhibitor signalling co 99.81
3hh2_C288 Follistatin; protein-protein complex, TB domain, c 99.81
2arp_F152 Follistatin; cystine knot, disulfide rich, EGF dom 99.78
1nub_A 229 Basement membrane protein BM-40; extracellular mod 99.73
3sek_C209 Follistatin-related protein 3; protein-protein com 99.72
3b4v_C237 Follistatin-like 3; ligand-inhibitor signalling co 99.65
1cgj_I56 Pancreatic secretory trypsin inhibitor (kazal type 99.63
1tgs_I56 Pancreatic secretory trypsin inhibitor (kazal type 99.6
2jxd_A62 Serine protease inhibitor kazal-type 2; anti-paral 99.6
1tbr_R103 RHODNIIN; complex (serine protease-inhibitor), kaz 99.6
1pce_A60 PEC-60; proteinase inhibitor(kazal type); NMR {Sus 99.59
1y1b_A48 Elastase inhibitor; non-classical, kazal-type, pro 99.59
1r0r_I51 Ovomucoid, omtky3; high resolution, serine proteas 99.55
1uvf_A61 Serine proteinase inhibitor kazal type 5; trypsin 99.55
1bus_A57 Proteinase inhibitor IIA; HET: PCA; NMR {Bos tauru 99.51
3qtl_D75 Kazal-type serine protease inhibitor SPI-1; serine 99.51
1yu6_C185 Ovomucoid; protein proteinase inhibitor, protease, 99.5
2leo_A66 Serine protease inhibitor kazal-type 7; esophageal 99.23
2f3c_I55 Thrombin inhibitor infestin; serine protease - inh 99.49
2erw_A56 Serine protease inhibitor infestin; kazal type dom 99.48
1tbr_R103 RHODNIIN; complex (serine protease-inhibitor), kaz 99.47
1uvg_A78 Serine proteinase inhibitor kazal type 5; trypsin 99.47
1yu6_C185 Ovomucoid; protein proteinase inhibitor, protease, 99.45
3pis_D42 Kazal-type serine protease inhibitor SPI-1; typica 99.36
4gi3_C83 Greglin; kazal type inhibitor, hydrolase-hydrolase 99.31
3qtl_D75 Kazal-type serine protease inhibitor SPI-1; serine 99.3
1ldt_L46 LDTI, tryptase inhibitor; complex (hydrolase/inhib 99.28
3tjq_A140 Serine protease HTRA1; hydrolase; 2.00A {Homo sapi 99.19
1h0z_A68 Serine protease inhibitor kazal-type 5, contains h 99.1
2wcy_A155 Complement component C7; immune system, disulfide 98.89
1hdl_A55 HF6478, serine proteinase inhibitor lekti; putativ 98.52
2wcy_A155 Complement component C7; immune system, disulfide 98.44
2xrc_A 565 Human complement factor I; immune system, hydrolas 97.11
3t5o_A913 Complement component C6; macpf, MAC, membrane atta 95.44
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 91.83
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 88.96
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 87.98
3t5o_A913 Complement component C6; macpf, MAC, membrane atta 86.15
1h0z_A68 Serine protease inhibitor kazal-type 5, contains h 84.26
2leo_A66 Serine protease inhibitor kazal-type 7; esophageal 83.82
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 81.28
>2arp_F Follistatin; cystine knot, disulfide rich, EGF domain, kazal domain, PROT complex, hormone-growth factor complex; HET: 1PG; 2.00A {Rattus norvegicus} Back     alignment and structure
Probab=99.87  E-value=4.5e-22  Score=140.91  Aligned_cols=94  Identities=29%  Similarity=0.606  Sum_probs=81.1

Q ss_pred             CCCCCCCCCCCCCCCccccc-CCeeeeeCC-CCCCC--CCCeEcccCcEechhhHHHHHHhhCCCCceEeeecCCCC---
Q psy11287         18 GETGPCSSNPCRNDGHCVVK-NGKAVCKCP-SCSAE--YNPVCGSDGISYENECKLNLEACQHSRQISVLYIGLCSK---   90 (112)
Q Consensus        18 ~~~~~C~~~~C~~g~~C~~~-~~~~~C~C~-~C~~~--~~pVCGSDG~TY~n~C~l~~~~C~~~~~i~i~~~G~C~~---   90 (112)
                      |+.++|.++.|++|++|+++ ++++.|+|+ .||..  +.|||||||+||.|+|+|++++|+.+..|.++|+|+|..   
T Consensus         1 ~~~~~C~~~~C~~g~~C~~~~~~~~~C~C~~~C~~~~~~~pVCGsDG~tY~N~C~l~~~~c~~~~~i~~~~~G~C~~~C~   80 (152)
T 2arp_F            1 GSMETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGKCKKTCR   80 (152)
T ss_dssp             ----CCTTCCCCTTEEEEECTTSCEEEEECCCCTTCSCCSCEEETTSCEESSHHHHHHHHHHTCTTCCEEEESSCCBSST
T ss_pred             CCcCCCCCCcCCCCCEeeeCCCCCeeecCCCcCCCCCCCCceEcCCCCEeCCHhHHHHHHhhcCCceEEEeccccccccc
Confidence            56789999999999999984 788999998 89987  899999999999999999999999998999999999974   


Q ss_pred             ------CCccccCCCcccccc-cCCCCC
Q psy11287         91 ------GLLREIDKARQENEI-PPGKLQ  111 (112)
Q Consensus        91 ------~~~C~~d~~~~~~C~-cp~~~~  111 (112)
                            +..|..|+.+.++|+ |+..++
T Consensus        81 ~~~C~~g~~C~~~~~~~~~C~~C~~~C~  108 (152)
T 2arp_F           81 DVFCPGSSTCVVDQTNNAYCVTCNRICP  108 (152)
T ss_dssp             TCCCCTTCEEEECTTSBEEEECCCCCCC
T ss_pred             cccCCCCCcccccccCccccCcCCCcCC
Confidence                  567888888899999 765544
>3sek_C Follistatin-related protein 3; protein-protein complex, TB domain, cystine knot motif, TGF- fold, disulfide linked dimer, follistatin domain (FSD); HET: NAG; 2.40A {Homo sapiens} PDB: 2kcx_A Back     alignment and structure
>1lr7_A Follistatin, FS1; heparin-binding, cystine-rich, sucrose octasulphate, hormone/growth factor complex; HET: SO4; 1.50A {Rattus norvegicus} SCOP: g.3.11.3 g.68.1.1 PDB: 1lr8_A* 1lr9_A Back     alignment and structure
>3hh2_C Follistatin; protein-protein complex, TB domain, cystine knot motif, TGF- fold, disulfide linked dimer, CLE PAIR of basic residues, cytokine; HET: CIT; 2.15A {Homo sapiens} PDB: 2b0u_C* 2p6a_D Back     alignment and structure
>3b4v_C Follistatin-like 3; ligand-inhibitor signalling complex, cleavage on PAIR of BAS residues, glycoprotein, growth factor, hormone, secreted; HET: NAG; 2.48A {Homo sapiens} Back     alignment and structure
>3hh2_C Follistatin; protein-protein complex, TB domain, cystine knot motif, TGF- fold, disulfide linked dimer, CLE PAIR of basic residues, cytokine; HET: CIT; 2.15A {Homo sapiens} PDB: 2b0u_C* 2p6a_D Back     alignment and structure
>2arp_F Follistatin; cystine knot, disulfide rich, EGF domain, kazal domain, PROT complex, hormone-growth factor complex; HET: 1PG; 2.00A {Rattus norvegicus} Back     alignment and structure
>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* Back     alignment and structure
>3sek_C Follistatin-related protein 3; protein-protein complex, TB domain, cystine knot motif, TGF- fold, disulfide linked dimer, follistatin domain (FSD); HET: NAG; 2.40A {Homo sapiens} PDB: 2kcx_A Back     alignment and structure
>3b4v_C Follistatin-like 3; ligand-inhibitor signalling complex, cleavage on PAIR of BAS residues, glycoprotein, growth factor, hormone, secreted; HET: NAG; 2.48A {Homo sapiens} Back     alignment and structure
>1cgj_I Pancreatic secretory trypsin inhibitor (kazal type) variant 4; serine protease/inhibitor complex; 2.30A {Homo sapiens} SCOP: g.68.1.1 Back     alignment and structure
>1tgs_I Pancreatic secretory trypsin inhibitor (kazal type); complex (proteinase/inhibitor); 1.80A {Sus scrofa} SCOP: g.68.1.1 PDB: 1cgi_I 1hpt_A Back     alignment and structure
>2jxd_A Serine protease inhibitor kazal-type 2; anti-parallel beta sheet, beta-bulge, disulfide bond, alpha helix, pyrrolidone carboxylic acid, secreted; NMR {Homo sapiens} Back     alignment and structure
>1tbr_R RHODNIIN; complex (serine protease-inhibitor), kazal-type inhibitor, T complex (serine protease-inhibitor) complex; 2.60A {Rhodnius prolixus} SCOP: g.68.1.1 g.68.1.1 PDB: 1tbq_R Back     alignment and structure
>1pce_A PEC-60; proteinase inhibitor(kazal type); NMR {Sus scrofa} SCOP: g.68.1.1 Back     alignment and structure
>1y1b_A Elastase inhibitor; non-classical, kazal-type, protease inhibitor, CSH motif, hydrolase inhibitor; NMR {Synthetic} PDB: 1y1c_A Back     alignment and structure
>1r0r_I Ovomucoid, omtky3; high resolution, serine protease, protein inhibitor, hydrolase; 1.10A {Meleagris gallopavo} SCOP: g.68.1.1 PDB: 1sgr_I 2gkr_I 1cho_I 1omt_A 1omu_A 1ppf_I* 1tur_A 1tus_A 3sgb_I 2ovo_A 4ovo_A 1iy5_A 1cso_I 1ct4_I 2sgf_I 2gkt_I 2gkv_A 2nu0_I 1m8b_A 1m8c_A ... Back     alignment and structure
>1bus_A Proteinase inhibitor IIA; HET: PCA; NMR {Bos taurus} SCOP: g.68.1.1 PDB: 2bus_A* Back     alignment and structure
>3qtl_D Kazal-type serine protease inhibitor SPI-1; serine protease -kazal type serine protease inhibitor comple hydrolase inhibitor; 2.60A {Carcinoscorpius rotundicauda} Back     alignment and structure
>1yu6_C Ovomucoid; protein proteinase inhibitor, protease, hydrolase; 1.55A {Meleagris gallopavo} SCOP: g.68.1.1 PDB: 1z7k_B* Back     alignment and structure
>2leo_A Serine protease inhibitor kazal-type 7; esophageal cancer-related gene 2, hydrol inhibitor; NMR {Homo sapiens} Back     alignment and structure
>2f3c_I Thrombin inhibitor infestin; serine protease - inhibitor complex, kazal-type domain, hydrolase/hydrolase inhibitor complex; 2.50A {Triatoma infestans} SCOP: g.68.1.1 PDB: 1kma_A Back     alignment and structure
>2erw_A Serine protease inhibitor infestin; kazal type domain, blood clotting, hydrolase inhibitor; 1.40A {Triatoma infestans} SCOP: g.68.1.1 Back     alignment and structure
>1tbr_R RHODNIIN; complex (serine protease-inhibitor), kazal-type inhibitor, T complex (serine protease-inhibitor) complex; 2.60A {Rhodnius prolixus} SCOP: g.68.1.1 g.68.1.1 PDB: 1tbq_R Back     alignment and structure
>1yu6_C Ovomucoid; protein proteinase inhibitor, protease, hydrolase; 1.55A {Meleagris gallopavo} SCOP: g.68.1.1 PDB: 1z7k_B* Back     alignment and structure
>3pis_D Kazal-type serine protease inhibitor SPI-1; typical non-classical kazal type inhibitor fold; 2.00A {Carcinoscorpius rotundicauda} Back     alignment and structure
>4gi3_C Greglin; kazal type inhibitor, hydrolase-hydrolase inhibitor complex; 1.75A {Schistocerca gregaria} Back     alignment and structure
>3qtl_D Kazal-type serine protease inhibitor SPI-1; serine protease -kazal type serine protease inhibitor comple hydrolase inhibitor; 2.60A {Carcinoscorpius rotundicauda} Back     alignment and structure
>1ldt_L LDTI, tryptase inhibitor; complex (hydrolase/inhibitor), hydrolase, inflammation; 1.90A {Hirudo medicinalis} SCOP: g.68.1.1 PDB: 1an1_I 2kmo_A 2kmp_A 2kmq_A 2kmr_A Back     alignment and structure
>3tjq_A Serine protease HTRA1; hydrolase; 2.00A {Homo sapiens} Back     alignment and structure
>1h0z_A Serine protease inhibitor kazal-type 5, contains hemofiltrate peptide HF6478, hemofiltrate...; serine proteinase inhibitor; NMR {Homo sapiens} SCOP: g.68.1.2 Back     alignment and structure
>2wcy_A Complement component C7; immune system, disulfide bond, immune response, factor I module, FIM, EGF, MAC, FOLN, sushi, fimac, kazal; NMR {Homo sapiens} Back     alignment and structure
>1hdl_A HF6478, serine proteinase inhibitor lekti; putative serine proteinase inhibitor; NMR {Homo sapiens} SCOP: g.68.1.2 PDB: 1uuc_A Back     alignment and structure
>2wcy_A Complement component C7; immune system, disulfide bond, immune response, factor I module, FIM, EGF, MAC, FOLN, sushi, fimac, kazal; NMR {Homo sapiens} Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Back     alignment and structure
>3t5o_A Complement component C6; macpf, MAC, membrane attack complex, innate IMMU system, blood, membrane, cytolysin, immune SYST; HET: NAG FUL FUC BGC MAN; 2.87A {Homo sapiens} PDB: 4a5w_B* 4e0s_B* Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>3t5o_A Complement component C6; macpf, MAC, membrane attack complex, innate IMMU system, blood, membrane, cytolysin, immune SYST; HET: NAG FUL FUC BGC MAN; 2.87A {Homo sapiens} PDB: 4a5w_B* 4e0s_B* Back     alignment and structure
>1h0z_A Serine protease inhibitor kazal-type 5, contains hemofiltrate peptide HF6478, hemofiltrate...; serine proteinase inhibitor; NMR {Homo sapiens} SCOP: g.68.1.2 Back     alignment and structure
>2leo_A Serine protease inhibitor kazal-type 7; esophageal cancer-related gene 2, hydrol inhibitor; NMR {Homo sapiens} Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 112
d1z7kb162 g.68.1.1 (B:2-63) Ovomucoid domains {Turkey (Melea 4e-13
d1hpta_56 g.68.1.1 (A:) Secretory trypsin inhibitor {Human ( 1e-12
d1pcea_60 g.68.1.1 (A:) PEC-60 peptide {Pig (Sus scrofa) [Ta 2e-12
d1tgsi_56 g.68.1.1 (I:) Secretory trypsin inhibitor {Pig (Su 2e-12
d1r0ri_51 g.68.1.1 (I:) Ovomucoid domains {Turkey (Meleagris 2e-11
d1tbrr252 g.68.1.1 (R:52-103) Blood-sucking insect-derived t 8e-11
d2busa_57 g.68.1.1 (A:) Seminal plasma inhibitor IIa {Cow (B 1e-10
d2erwa153 g.68.1.1 (A:4-56) Blood-sucking insect-derived try 5e-10
d2f3ci146 g.68.1.1 (I:5-50) Blood-sucking insect-derived try 2e-09
d1lr7a248 g.68.1.1 (A:89-136) Domain of follistatin {Rat (Ra 2e-09
d1nuba358 g.68.1.1 (A:78-135) Domain of BM-40/SPARC/osteonec 1e-08
d1h0za_68 g.68.1.2 (A:) Serine proteinase inhibitor lekti {H 4e-08
d1hdla_55 g.68.1.2 (A:) Serine proteinase inhibitor lekti {H 6e-05
d1ldtl_46 g.68.1.1 (L:) Leech derived tryptase inhibitor (LD 4e-04
d1g1ta239 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human 8e-04
d1g1sa240 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human 0.002
d1edmb_39 g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens 0.002
d2vj3a239 g.3.11.1 (A:453-491) Neurogenic locus notch homolo 0.002
>d1z7kb1 g.68.1.1 (B:2-63) Ovomucoid domains {Turkey (Meleagris gallopavo) [TaxId: 9103]} Length = 62 Back     information, alignment and structure

class: Small proteins
fold: Kazal-type serine protease inhibitors
superfamily: Kazal-type serine protease inhibitors
family: Ovomucoid domain III-like
domain: Ovomucoid domains
species: Turkey (Meleagris gallopavo) [TaxId: 9103]

 Score = 57.3 bits (138), Expect = 4e-13
 Identities = 18/61 (29%), Positives = 28/61 (45%), Gaps = 3/61 (4%)

Query: 28 CRNDGHCVVKNGKAVCKCPSCSAEYNPVCGSDGISYENECKLNLEACQHSRQISVLYIGL 87
          C    +   + GK +  C       NPVCG+DG++Y+NEC L     +    +   + G 
Sbjct: 5  CSRYPNTTSEEGKVMILCNK---ALNPVCGTDGVTYDNECVLCAHNLEQGTSVGKKHDGE 61

Query: 88 C 88
          C
Sbjct: 62 C 62
>d1hpta_ g.68.1.1 (A:) Secretory trypsin inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1pcea_ g.68.1.1 (A:) PEC-60 peptide {Pig (Sus scrofa) [TaxId: 9823]} Length = 60 Back     information, alignment and structure
>d1tgsi_ g.68.1.1 (I:) Secretory trypsin inhibitor {Pig (Sus scrofa) [TaxId: 9823]} Length = 56 Back     information, alignment and structure
>d1r0ri_ g.68.1.1 (I:) Ovomucoid domains {Turkey (Meleagris gallopavo) [TaxId: 9103]} Length = 51 Back     information, alignment and structure
>d1tbrr2 g.68.1.1 (R:52-103) Blood-sucking insect-derived tryptase inhibitor {Bug (Rhodnius prolixus), rhodniin [TaxId: 13249]} Length = 52 Back     information, alignment and structure
>d2busa_ g.68.1.1 (A:) Seminal plasma inhibitor IIa {Cow (Bos taurus) [TaxId: 9913]} Length = 57 Back     information, alignment and structure
>d2erwa1 g.68.1.1 (A:4-56) Blood-sucking insect-derived tryptase inhibitor {Triatoma infestans [TaxId: 30076]} Length = 53 Back     information, alignment and structure
>d2f3ci1 g.68.1.1 (I:5-50) Blood-sucking insect-derived tryptase inhibitor {Triatoma infestans [TaxId: 30076]} Length = 46 Back     information, alignment and structure
>d1lr7a2 g.68.1.1 (A:89-136) Domain of follistatin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 48 Back     information, alignment and structure
>d1nuba3 g.68.1.1 (A:78-135) Domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1h0za_ g.68.1.2 (A:) Serine proteinase inhibitor lekti {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1hdla_ g.68.1.2 (A:) Serine proteinase inhibitor lekti {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d1ldtl_ g.68.1.1 (L:) Leech derived tryptase inhibitor (LDTI-C) {Medicinal leech (Hirudo medicinalis) [TaxId: 6421]} Length = 46 Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query112
d1tgsi_56 Secretory trypsin inhibitor {Pig (Sus scrofa) [Tax 99.73
d1hpta_56 Secretory trypsin inhibitor {Human (Homo sapiens) 99.73
d1z7kb162 Ovomucoid domains {Turkey (Meleagris gallopavo) [T 99.73
d1tbrr252 Blood-sucking insect-derived tryptase inhibitor {B 99.71
d2erwa153 Blood-sucking insect-derived tryptase inhibitor {T 99.66
d1r0ri_51 Ovomucoid domains {Turkey (Meleagris gallopavo) [T 99.65
d2f3ci146 Blood-sucking insect-derived tryptase inhibitor {T 99.65
d1lr7a248 Domain of follistatin {Rat (Rattus norvegicus) [Ta 99.65
d1pcea_60 PEC-60 peptide {Pig (Sus scrofa) [TaxId: 9823]} 99.65
d2busa_57 Seminal plasma inhibitor IIa {Cow (Bos taurus) [Ta 99.64
d1nuba358 Domain of BM-40/SPARC/osteonectin {Human (Homo sap 99.62
d1h0za_68 Serine proteinase inhibitor lekti {Human (Homo sap 99.3
d1ldtl_46 Leech derived tryptase inhibitor (LDTI-C) {Medicin 99.07
d1hdla_55 Serine proteinase inhibitor lekti {Human (Homo sap 98.59
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 94.18
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 93.42
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 92.5
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 92.41
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 91.44
d1lr7a126 Domain of follistatin {Rat (Rattus norvegicus) [Ta 91.24
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 90.92
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 90.89
d1nuba226 Domain of BM-40/SPARC/osteonectin {Human (Homo sap 90.25
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 88.86
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 88.83
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 81.52
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 80.21
>d1tgsi_ g.68.1.1 (I:) Secretory trypsin inhibitor {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
class: Small proteins
fold: Kazal-type serine protease inhibitors
superfamily: Kazal-type serine protease inhibitors
family: Ovomucoid domain III-like
domain: Secretory trypsin inhibitor
species: Pig (Sus scrofa) [TaxId: 9823]

Probab=99.73  E-value=1.1e-18  Score=103.95  Aligned_cols=51  Identities=39%  Similarity=0.815  Sum_probs=48.1

Q ss_pred             CCeeeeeCC--CCCCCCCCeEcccCcEechhhHHHHHHhhCCCCceEeeecCC
Q psy11287         38 NGKAVCKCP--SCSAEYNPVCGSDGISYENECKLNLEACQHSRQISVLYIGLC   88 (112)
Q Consensus        38 ~~~~~C~C~--~C~~~~~pVCGSDG~TY~n~C~l~~~~C~~~~~i~i~~~G~C   88 (112)
                      .+++.|+|+  .||..+.|||||||+||.|+|+|++++|..+..|.++|.|+|
T Consensus         4 ~r~~~C~c~~~~C~~~~~PVCGsdG~TY~N~C~l~~~~C~~~~~i~~~~~G~C   56 (56)
T d1tgsi_           4 QREATCTSEVSGCPKIYNPVCGTDGITYSNECVLCSENKKRQTPVLIQKSGPC   56 (56)
T ss_dssp             CCCCCCCCSSSSEECCCCCEEETTSCEESSHHHHHHHHHTCSSCCCEEEESCC
T ss_pred             CcCCccccCCCCCCCCCCccCCCCCCEeccHhHHHHHHhcCCCceEEeecCCC
Confidence            468999997  599999999999999999999999999999999999999987
>d1hpta_ g.68.1.1 (A:) Secretory trypsin inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7kb1 g.68.1.1 (B:2-63) Ovomucoid domains {Turkey (Meleagris gallopavo) [TaxId: 9103]} Back     information, alignment and structure
>d1tbrr2 g.68.1.1 (R:52-103) Blood-sucking insect-derived tryptase inhibitor {Bug (Rhodnius prolixus), rhodniin [TaxId: 13249]} Back     information, alignment and structure
>d2erwa1 g.68.1.1 (A:4-56) Blood-sucking insect-derived tryptase inhibitor {Triatoma infestans [TaxId: 30076]} Back     information, alignment and structure
>d1r0ri_ g.68.1.1 (I:) Ovomucoid domains {Turkey (Meleagris gallopavo) [TaxId: 9103]} Back     information, alignment and structure
>d2f3ci1 g.68.1.1 (I:5-50) Blood-sucking insect-derived tryptase inhibitor {Triatoma infestans [TaxId: 30076]} Back     information, alignment and structure
>d1lr7a2 g.68.1.1 (A:89-136) Domain of follistatin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pcea_ g.68.1.1 (A:) PEC-60 peptide {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2busa_ g.68.1.1 (A:) Seminal plasma inhibitor IIa {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nuba3 g.68.1.1 (A:78-135) Domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h0za_ g.68.1.2 (A:) Serine proteinase inhibitor lekti {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ldtl_ g.68.1.1 (L:) Leech derived tryptase inhibitor (LDTI-C) {Medicinal leech (Hirudo medicinalis) [TaxId: 6421]} Back     information, alignment and structure
>d1hdla_ g.68.1.2 (A:) Serine proteinase inhibitor lekti {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lr7a1 g.3.11.3 (A:64-88) Domain of follistatin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nuba2 g.3.11.3 (A:53-77) Domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure