Psyllid ID: psy11293

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-
MKTSFYCYQIFLILDFLYACYIFPPELTNPCQENTCQYGAKCIPSEDGTSYKCECPQECPNYGDHTGSRPVCGSNGVDYKDLCEFQRASCSTKTNLTIKYYGKCGKWILEI
cccccccHHHHHHHccccEEEEccccccccccccccccccEEEEcccccEEEEEccccccccccccccccEEcccccEEccHHHHHHHHHcccccEEEEEEccccccEEcc
cccHHHHHHHHHHHHHHHEEEcccccccccccccEcccccEEEEcccccccEEEccccccccccccccccEEcccccccccHHHHHHHHHHccccEEEEEcccccccEEEc
MKTSFYCYQIFLILDFLYacyifppeltnpcqentcqygakcipsedgtsykcecpqecpnygdhtgsrpvcgsngvdykdlcefqrascstktnltikyygkcgkWILEI
MKTSFYCYQIFLILDFLYACYIFPPELTNPCQENTCQYGAKCIPSEDGTSYKCECPQECPNYGDHTGSRPVCGSNGVDYKDLCEFQrascstktnltikyygkcgkwilei
MKTSFYCYQIFLILDFLYACYIFPPELTNPCQENTCQYGAKCIPSEDGTSYKCECPQECPNYGDHTGSRPVCGSNGVDYKDLCEFQRASCSTKTNLTIKYYGKCGKWILEI
***SFYCYQIFLILDFLYACYIFPPELTNPCQENTCQYGAKCIPSEDGTSYKCECPQECPNYGDHTGSRPVCGSNGVDYKDLCEFQRASCSTKTNLTIKYYGKCGKWIL**
****F**YQIFLILDFLYACYIFPPELTNPCQENTCQYGAKCIPSEDGTSYKCECPQECPNYGDHTGSRPVCGSNGVDYKDLCEFQRASCSTKTNLTIKYYGKCGKW*L*I
MKTSFYCYQIFLILDFLYACYIFPPELTNPCQENTCQYGAKCIPSEDGTSYKCECPQECPNYGDHTGSRPVCGSNGVDYKDLCEFQRASCSTKTNLTIKYYGKCGKWILEI
*KTSFYCYQIFLILDFLYACYIFPPELTNPCQENTCQYGAKCIPSEDGTSYKCECPQECPNYGDHTGSRPVCGSNGVDYKDLCEFQRASCSTKTNLTIKYYGKCGKWILEI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKTSFYCYQIFLILDFLYACYIFPPELTNPCQENTCQYGAKCIPSEDGTSYKCECPQECPNYGDHTGSRPVCGSNGVDYKDLCEFQRASCSTKTNLTIKYYGKCGKWILEI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query111 2.2.26 [Sep-21-2011]
A2ASQ1 1950 Agrin OS=Mus musculus GN= yes N/A 0.648 0.036 0.394 4e-10
P25304 1959 Agrin OS=Rattus norvegicu yes N/A 0.648 0.036 0.381 1e-09
P31696 2081 Agrin OS=Gallus gallus GN yes N/A 0.648 0.034 0.355 1e-08
O00468 2067 Agrin OS=Homo sapiens GN= yes N/A 0.648 0.034 0.368 3e-08
Q9QYV1 373 Tomoregulin-1 OS=Rattus n no N/A 0.603 0.179 0.405 2e-07
Q6PFE7 372 Tomoregulin-1 OS=Mus musc no N/A 0.603 0.180 0.405 2e-07
Q8IYR6 380 Tomoregulin-1 OS=Homo sap no N/A 0.603 0.176 0.405 3e-07
Q6MZW2 842 Follistatin-related prote no N/A 0.657 0.086 0.312 1e-06
Q5STE3 841 Follistatin-related prote no N/A 0.540 0.071 0.343 3e-06
Q91590 370 Tomoregulin-1 OS=Xenopus N/A N/A 0.603 0.181 0.364 2e-05
>sp|A2ASQ1|AGRIN_MOUSE Agrin OS=Mus musculus GN=Agrn PE=1 SV=1 Back     alignment and function desciption
 Score = 63.2 bits (152), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 30/76 (39%), Positives = 43/76 (56%), Gaps = 4/76 (5%)

Query: 29  NPCQENTCQYGAKCIPSEDGTSYKCECPQECPNYGDHTGSRPVCGSNGVDYKDLCEFQRA 88
           +PC   TC +G+ C+PS DG +  C CP  C    D T    VCGS+GVDY   C+  R 
Sbjct: 141 DPCANVTCSFGSTCVPSADGQTASCLCPTTCFGAPDGT----VCGSDGVDYPSECQLLRH 196

Query: 89  SCSTKTNLTIKYYGKC 104
           +C+ + ++  K+ G C
Sbjct: 197 ACANQEHIFKKFDGPC 212
Plays a central role in the formation and the maintenance of the neuromuscular junction (NMJ), the synapse between motor neuron and skeletal muscle. Ligand of the MUSK signaling complex that directly binds LRP4 in this complex and induces the phosphorylation of MUSK, the kinase of the complex. The activation of MUSK in myotubes induces the formation of NMJ by regulating different processes including the transcription of specific genes and the clustering of AChR in the postsynaptic membrane.
Mus musculus (taxid: 10090)
>sp|P25304|AGRIN_RAT Agrin OS=Rattus norvegicus GN=Agrn PE=1 SV=2 Back     alignment and function description
>sp|P31696|AGRIN_CHICK Agrin OS=Gallus gallus GN=AGRN PE=1 SV=3 Back     alignment and function description
>sp|O00468|AGRIN_HUMAN Agrin OS=Homo sapiens GN=AGRN PE=1 SV=5 Back     alignment and function description
>sp|Q9QYV1|TEFF1_RAT Tomoregulin-1 OS=Rattus norvegicus GN=Tmeff1 PE=2 SV=1 Back     alignment and function description
>sp|Q6PFE7|TEFF1_MOUSE Tomoregulin-1 OS=Mus musculus GN=Tmeff1 PE=2 SV=1 Back     alignment and function description
>sp|Q8IYR6|TEFF1_HUMAN Tomoregulin-1 OS=Homo sapiens GN=TMEFF1 PE=1 SV=1 Back     alignment and function description
>sp|Q6MZW2|FSTL4_HUMAN Follistatin-related protein 4 OS=Homo sapiens GN=FSTL4 PE=2 SV=3 Back     alignment and function description
>sp|Q5STE3|FSTL4_MOUSE Follistatin-related protein 4 OS=Mus musculus GN=Fstl4 PE=2 SV=1 Back     alignment and function description
>sp|Q91590|TEFF1_XENLA Tomoregulin-1 OS=Xenopus laevis GN=tmeff1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query111
242020688 1614 Agrin precursor, putative [Pediculus hum 0.801 0.055 0.557 3e-27
357602535 1088 putative agrin [Danaus plexippus] 0.792 0.080 0.515 2e-23
189233617 2027 PREDICTED: similar to agrin [Tribolium c 0.630 0.034 0.544 6e-21
270014663 1796 hypothetical protein TcasGA2_TC004709 [T 0.630 0.038 0.544 7e-21
383850257 1852 PREDICTED: agrin-like [Megachile rotunda 0.711 0.042 0.505 9e-21
307213744120 Agrin [Harpegnathos saltator] 0.837 0.775 0.451 3e-20
328787536 1900 PREDICTED: agrin-like isoform 1 [Apis me 0.774 0.045 0.467 5e-20
322800545 318 hypothetical protein SINV_04289 [Solenop 0.711 0.248 0.494 2e-18
345492515 720 PREDICTED: hypothetical protein LOC10067 0.693 0.106 0.481 1e-17
340723263 2243 PREDICTED: agrin-like [Bombus terrestris 0.657 0.032 0.481 7e-17
>gi|242020688|ref|XP_002430784.1| Agrin precursor, putative [Pediculus humanus corporis] gi|212515981|gb|EEB18046.1| Agrin precursor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 53/95 (55%), Positives = 71/95 (74%)

Query: 10  IFLILDFLYACYIFPPELTNPCQENTCQYGAKCIPSEDGTSYKCECPQECPNYGDHTGSR 69
           +  I     +CY+FP E  NPC++  CQYGA+C+PS DG S +C+CP+ CPN GDH GSR
Sbjct: 17  LLNISKIALSCYVFPTEQENPCKDKKCQYGARCVPSLDGKSSECKCPENCPNLGDHVGSR 76

Query: 70  PVCGSNGVDYKDLCEFQRASCSTKTNLTIKYYGKC 104
           PVCGS+G+DY+D CE +R++C T T ++IKY GKC
Sbjct: 77  PVCGSDGLDYRDSCELKRSACLTNTEISIKYQGKC 111

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|357602535|gb|EHJ63441.1| putative agrin [Danaus plexippus] Back     alignment and taxonomy information
>gi|189233617|ref|XP_001811978.1| PREDICTED: similar to agrin [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270014663|gb|EFA11111.1| hypothetical protein TcasGA2_TC004709 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|383850257|ref|XP_003700712.1| PREDICTED: agrin-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|307213744|gb|EFN89082.1| Agrin [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|328787536|ref|XP_391941.3| PREDICTED: agrin-like isoform 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|322800545|gb|EFZ21537.1| hypothetical protein SINV_04289 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|345492515|ref|XP_003426866.1| PREDICTED: hypothetical protein LOC100678146 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|340723263|ref|XP_003400011.1| PREDICTED: agrin-like [Bombus terrestris] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query111
WB|WBGene00018304 1473 agr-1 [Caenorhabditis elegans 0.729 0.054 0.433 1.3e-16
ZFIN|ZDB-GENE-030131-1033 2028 agrn "agrin" [Danio rerio (tax 0.693 0.037 0.432 1.2e-14
MGI|MGI:87961 1950 Agrn "agrin" [Mus musculus (ta 0.648 0.036 0.394 4.7e-11
UNIPROTKB|F1MSI2 2032 AGRN "Uncharacterized protein" 0.648 0.035 0.407 6.3e-11
MGI|MGI:1926810 372 Tmeff1 "transmembrane protein 0.603 0.180 0.405 8.1e-11
RGD|62005 373 Tmeff1 "transmembrane protein 0.603 0.179 0.405 8.2e-11
RGD|2067 1959 Agrn "agrin" [Rattus norvegicu 0.648 0.036 0.381 1.3e-10
UNIPROTKB|F1Q2Z6 2046 AGRN "Uncharacterized protein" 0.648 0.035 0.394 1.3e-10
UNIPROTKB|Q8IYR6 380 TMEFF1 "Tomoregulin-1" [Homo s 0.603 0.176 0.405 1.4e-10
UNIPROTKB|F1P3E3 1952 AGRN "Agrin" [Gallus gallus (t 0.648 0.036 0.355 3.3e-10
WB|WBGene00018304 agr-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
 Score = 220 (82.5 bits), Expect = 1.3e-16, P = 1.3e-16
 Identities = 36/83 (43%), Positives = 54/83 (65%)

Query:    24 PPELTNPCQENTCQYGAKCIPSE-DGTSY-KCECPQECPNYGDHTGSRPVCGSNGVDYKD 81
             P +  NPC++  C  G  C+ ++ +G    KC CP +CPNYGD   S PVC S+GVDY+ 
Sbjct:   219 PCKKRNPCEDLRCGPGEDCVVNQINGILLAKCVCPTQCPNYGDSVESSPVCSSHGVDYQS 278

Query:    82 LCEFQRASCSTKTNLTIKYYGKC 104
              C  +  +C +KTN+T+K++G+C
Sbjct:   279 SCHLRHHACESKTNITVKFFGRC 301
GO:0016021 "integral to membrane" evidence=IEA
GO:0009792 "embryo development ending in birth or egg hatching" evidence=IMP
GO:0005605 "basal lamina" evidence=IDA
ZFIN|ZDB-GENE-030131-1033 agrn "agrin" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:87961 Agrn "agrin" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1MSI2 AGRN "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1926810 Tmeff1 "transmembrane protein with EGF-like and two follistatin-like domains 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|62005 Tmeff1 "transmembrane protein with EGF-like and two follistatin-like domains 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|2067 Agrn "agrin" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1Q2Z6 AGRN "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q8IYR6 TMEFF1 "Tomoregulin-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1P3E3 AGRN "Agrin" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query111
smart0028046 smart00280, KAZAL, Kazal type serine protease inhi 5e-10
cd0010441 cd00104, KAZAL_FS, Kazal type serine protease inhi 2e-07
pfam0764842 pfam07648, Kazal_2, Kazal-type serine protease inh 2e-05
cd0132886 cd01328, FSL_SPARC, Follistatin-like SPARC (secret 2e-04
pfam0005048 pfam00050, Kazal_1, Kazal-type serine protease inh 0.003
>gnl|CDD|197624 smart00280, KAZAL, Kazal type serine protease inhibitors Back     alignment and domain information 
 Score = 50.4 bits (121), Expect = 5e-10
 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 5/51 (9%)

Query: 54  ECPQECPNYGDHTGSRPVCGSNGVDYKDLCEFQRASCSTKTNLTIKYYGKC 104
           +CP+ CP         PVCGS+GV Y + C   +A+C +  ++ +K+ G C
Sbjct: 1   DCPEACPRE-----YDPVCGSDGVTYSNECHLCKAACESGKSIEVKHDGPC 46

Kazal type serine protease inhibitors and follistatin-like domains. Length = 46
>gnl|CDD|238052 cd00104, KAZAL_FS, Kazal type serine protease inhibitors and follistatin-like domains Back     alignment and domain information
>gnl|CDD|191798 pfam07648, Kazal_2, Kazal-type serine protease inhibitor domain Back     alignment and domain information
>gnl|CDD|238649 cd01328, FSL_SPARC, Follistatin-like SPARC (secreted protein, acidic, and rich in cysteines) domain; SPARC/BM-40/osteonectin is a multifunctional glycoprotein which modulates cellular interaction with the extracellular matrix by its binding to structural matrix proteins such as collagen and vitronectin Back     alignment and domain information
>gnl|CDD|200959 pfam00050, Kazal_1, Kazal-type serine protease inhibitor domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 111
cd0132886 FSL_SPARC Follistatin-like SPARC (secreted protein 99.86
smart0028046 KAZAL Kazal type serine protease inhibitors. Kazal 99.64
cd0132745 KAZAL_PSTI Kazal-type pancreatic secretory trypsin 99.61
PF0764842 Kazal_2: Kazal-type serine protease inhibitor doma 99.44
KOG4004|consensus 259 99.42
cd0010441 KAZAL_FS Kazal type serine protease inhibitors and 99.41
PF0005048 Kazal_1: Kazal-type serine protease inhibitor doma 99.4
KOG3555|consensus 434 98.84
KOG4578|consensus 421 98.64
smart0005769 FIMAC factor I membrane attack complex. 98.59
cd0133054 KAZAL_SLC21 The kazal-type serine protease inhibit 97.51
smart0027426 FOLN Follistatin-N-terminal domain-like. Follistat 96.83
PF0928922 FOLN: Follistatin/Osteonectin-like EGF domain; Int 96.27
TIGR00805 633 oat sodium-independent organic anion transporter. 92.96
KOG4597|consensus 560 92.13
KOG3626|consensus 735 87.8
KOG3509|consensus 964 86.44
>cd01328 FSL_SPARC Follistatin-like SPARC (secreted protein, acidic, and rich in cysteines) domain; SPARC/BM-40/osteonectin is a multifunctional glycoprotein which modulates cellular interaction with the extracellular matrix by its binding to structural matrix proteins such as collagen and vitronectin Back     alignment and domain information 
Probab=99.86  E-value=4.9e-22  Score=131.15  Aligned_cols=74  Identities=31%  Similarity=0.813  Sum_probs=64.9

Q ss_pred             CCCCccCCCCCeeccCCCCCcceeecCCCCCCCCCCCCCCCeecCCCceeCCccHHHHHHhcCC-----------CceeE
Q psy11293         30 PCQENTCQYGAKCIPSEDGTSYKCECPQECPNYGDHTGSRPVCGSNGVDYKDLCEFQRASCSTK-----------TNLTI   98 (111)
Q Consensus        30 ~C~~~~C~~G~~C~~~~~g~~~~CvC~~~C~~~~~~~~~~pVCGsDG~TY~n~C~L~~~aC~~~-----------~~i~v   98 (111)
                      ||+++.|++|.+|+++..+ .|+|+|+..||...  .+..+||||||+||+|+|+|++++|..+           ..|+|
T Consensus         1 pC~~v~C~~G~~C~~d~~~-~p~CvC~~~Cp~~~--~~~~~VCGsDg~TY~s~C~L~r~~C~~~~~~~~~~~~~~~~l~i   77 (86)
T cd01328           1 PCENHHCGAGKVCEVDDEN-TPKCVCIDPCPEEV--DDRRKVCTNDNETFDSDCELYRTRCLCKGGKKGCRGPKYQHLHL   77 (86)
T ss_pred             CCCCcCCCCCCEeeECCCC-CeEEecCCcCCCCC--CCCCceeCCCCCCcccHhHHhhhHhccCCCCcCCCCCccCeEEE
Confidence            7999999999999997544 69999999999976  2357899999999999999999999731           48999


Q ss_pred             eeeccCCC
Q psy11293         99 KYYGKCGK  106 (111)
Q Consensus        99 ~~~G~C~~  106 (111)
                      .|+|+|..
T Consensus        78 ~Y~G~Ck~   85 (86)
T cd01328          78 DYYGECKE   85 (86)
T ss_pred             EeeccccC
Confidence            99999973

The protein it composed of an N-terminal acidic region, a follistatin (FS) domain and an EF-hand calcium binding domain. The FS domain consists of an N-terminal beta hairpin (FOLN/EGF-like domain) and a small hydrophobic core of alpha/beta structure (Kazal domain) and has five disulfide bonds and a conserved N-glycosylation site. The FSL_SPARC domain is a member of the superfamily of kazal-like proteinase inhibitors and follistatin-like proteins.
>smart00280 KAZAL Kazal type serine protease inhibitors Back     alignment and domain information
>cd01327 KAZAL_PSTI Kazal-type pancreatic secretory trypsin inhibitors (PSTI) and related proteins, including the second domain of the ovomucoid turkey inhibitor and the C-terminal domain of the esophagus cancer-related gene-2 protein (ECRG-2), are members of the superfamily of kazal-type proteinase inhibitors and follistatin-like proteins Back     alignment and domain information
>PF07648 Kazal_2: Kazal-type serine protease inhibitor domain; InterPro: IPR011497 This domain is usually indicative of serine protease inhibitors that belong to Merops inhibitor families: I1, I2, I17 and I31 Back     alignment and domain information
>KOG4004|consensus Back     alignment and domain information
>cd00104 KAZAL_FS Kazal type serine protease inhibitors and follistatin-like domains Back     alignment and domain information
>PF00050 Kazal_1: Kazal-type serine protease inhibitor domain; InterPro: IPR002350 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively Back     alignment and domain information
>KOG3555|consensus Back     alignment and domain information
>KOG4578|consensus Back     alignment and domain information
>smart00057 FIMAC factor I membrane attack complex Back     alignment and domain information
>cd01330 KAZAL_SLC21 The kazal-type serine protease inhibitor domain has been detected in an extracellular loop region of solute carrier 21 (SLC21) family members (organic anion transporters) , which may regulate the specificity of anion uptake Back     alignment and domain information
>smart00274 FOLN Follistatin-N-terminal domain-like Back     alignment and domain information
>PF09289 FOLN: Follistatin/Osteonectin-like EGF domain; InterPro: IPR015369 This domain is predominantly found in osteonectin and follistatin Back     alignment and domain information
>TIGR00805 oat sodium-independent organic anion transporter Back     alignment and domain information
>KOG4597|consensus Back     alignment and domain information
>KOG3626|consensus Back     alignment and domain information
>KOG3509|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query111
3sek_C209 Crystal Structure Of The Myostatin:follistatin-Like 4e-05
3b4v_C237 X-Ray Structure Of Activin In Complex With Fstl3 Le 4e-05
2kcx_A74 Solution Nmr Structure Of Kazal-1 Domain Of Human F 1e-04
2arp_F152 Activin A In Complex With Fs12 Fragment Of Follista 5e-04
2p6a_D 315 The Structure Of The Activin:follistatin 315 Comple 8e-04
>pdb|3SEK|C Chain C, Crystal Structure Of The Myostatin:follistatin-Like 3 Complex Length = 209 Back     alignment and structure 
Iteration: 1

 Score = 43.1 bits (100), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 41/94 (43%), Gaps = 7/94 (7%)
Query: 13  ILDFLYACYIFPPELTNPCQENTCQYGAKCIPSEDGTSYKCECPQECPNYGDHTGSRPVC 72
           +L FL   +  P    + C    C  G  C     G   +CEC  +C           VC
Sbjct: 48  LLGFLGLVHCLP--CKDSCDGVECGPGKAC--RMLGGRPRCECAPDCSGL---PARLQVC 100
Query: 73  GSNGVDYKDLCEFQRASCSTKTNLTIKYYGKCGK 106
           GS+G  Y+D CE + A C    +L++ Y G+C K
Sbjct: 101 GSDGATYRDECELRAARCRGHPDLSVMYRGRCRK 134
>pdb|3B4V|C Chain C, X-Ray Structure Of Activin In Complex With Fstl3 Length = 237 Back     alignment and structure
>pdb|2KCX|A Chain A, Solution Nmr Structure Of Kazal-1 Domain Of Human Follistatin-Related Protein 3 (Fstl-3). Northeast Structural Genomics Target Hr6186a Length = 74 Back     alignment and structure
>pdb|2ARP|F Chain F, Activin A In Complex With Fs12 Fragment Of Follistatin Length = 152 Back     alignment and structure
>pdb|2P6A|D Chain D, The Structure Of The Activin:follistatin 315 Complex Length = 315 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query111
1lr7_A74 Follistatin, FS1; heparin-binding, cystine-rich, s 7e-15
1nub_A 229 Basement membrane protein BM-40; extracellular mod 2e-10
1y1b_A48 Elastase inhibitor; non-classical, kazal-type, pro 4e-10
2arp_F152 Follistatin; cystine knot, disulfide rich, EGF dom 2e-09
2arp_F152 Follistatin; cystine knot, disulfide rich, EGF dom 6e-09
3b4v_C237 Follistatin-like 3; ligand-inhibitor signalling co 2e-08
3b4v_C237 Follistatin-like 3; ligand-inhibitor signalling co 5e-08
3sek_C209 Follistatin-related protein 3; protein-protein com 3e-08
3sek_C209 Follistatin-related protein 3; protein-protein com 1e-07
3hh2_C 288 Follistatin; protein-protein complex, TB domain, c 6e-08
3hh2_C288 Follistatin; protein-protein complex, TB domain, c 2e-06
3hh2_C288 Follistatin; protein-protein complex, TB domain, c 5e-06
1uvf_A61 Serine proteinase inhibitor kazal type 5; trypsin 4e-07
1uvg_A78 Serine proteinase inhibitor kazal type 5; trypsin 1e-06
1pce_A60 PEC-60; proteinase inhibitor(kazal type); NMR {Sus 1e-06
1tbr_R103 RHODNIIN; complex (serine protease-inhibitor), kaz 4e-06
1tbr_R103 RHODNIIN; complex (serine protease-inhibitor), kaz 4e-04
2f3c_I55 Thrombin inhibitor infestin; serine protease - inh 4e-06
2leo_A66 Serine protease inhibitor kazal-type 7; esophageal 6e-06
2jxd_A62 Serine protease inhibitor kazal-type 2; anti-paral 1e-05
1cgj_I56 Pancreatic secretory trypsin inhibitor (kazal type 2e-05
1r0r_I51 Ovomucoid, omtky3; high resolution, serine proteas 2e-05
1yu6_C185 Ovomucoid; protein proteinase inhibitor, protease, 3e-05
2erw_A56 Serine protease inhibitor infestin; kazal type dom 3e-05
1tgs_I56 Pancreatic secretory trypsin inhibitor (kazal type 7e-05
1bus_A57 Proteinase inhibitor IIA; HET: PCA; NMR {Bos tauru 8e-05
>1lr7_A Follistatin, FS1; heparin-binding, cystine-rich, sucrose octasulphate, hormone/growth factor complex; HET: SO4; 1.50A {Rattus norvegicus} SCOP: g.3.11.3 g.68.1.1 PDB: 1lr8_A* 1lr9_A Length = 74 Back     alignment and structure
 Score = 63.0 bits (153), Expect = 7e-15
 Identities = 24/76 (31%), Positives = 36/76 (47%), Gaps = 4/76 (5%)

Query: 29  NPCQENTCQYGAKCIPSEDGTSYKCECPQECPNYGDHTGSRPVCGSNGVDYKDLCEFQRA 88
             C+   C  G KC  ++     +C C  +C N    T   PVCG +G  Y++ C   +A
Sbjct: 2   ETCENVDCGPGKKCRMNKKNKP-RCVCAPDCSNI---TWKGPVCGLDGKTYRNECALLKA 57

Query: 89  SCSTKTNLTIKYYGKC 104
            C  +  L ++Y GKC
Sbjct: 58  RCKEQPELEVQYQGKC 73
>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* Length = 229 Back     alignment and structure
>1y1b_A Elastase inhibitor; non-classical, kazal-type, protease inhibitor, CSH motif, hydrolase inhibitor; NMR {Synthetic} PDB: 1y1c_A Length = 48 Back     alignment and structure
>2arp_F Follistatin; cystine knot, disulfide rich, EGF domain, kazal domain, PROT complex, hormone-growth factor complex; HET: 1PG; 2.00A {Rattus norvegicus} Length = 152 Back     alignment and structure
>2arp_F Follistatin; cystine knot, disulfide rich, EGF domain, kazal domain, PROT complex, hormone-growth factor complex; HET: 1PG; 2.00A {Rattus norvegicus} Length = 152 Back     alignment and structure
>3b4v_C Follistatin-like 3; ligand-inhibitor signalling complex, cleavage on PAIR of BAS residues, glycoprotein, growth factor, hormone, secreted; HET: NAG; 2.48A {Homo sapiens} Length = 237 Back     alignment and structure
>3b4v_C Follistatin-like 3; ligand-inhibitor signalling complex, cleavage on PAIR of BAS residues, glycoprotein, growth factor, hormone, secreted; HET: NAG; 2.48A {Homo sapiens} Length = 237 Back     alignment and structure
>3sek_C Follistatin-related protein 3; protein-protein complex, TB domain, cystine knot motif, TGF- fold, disulfide linked dimer, follistatin domain (FSD); HET: NAG; 2.40A {Homo sapiens} PDB: 2kcx_A Length = 209 Back     alignment and structure
>3sek_C Follistatin-related protein 3; protein-protein complex, TB domain, cystine knot motif, TGF- fold, disulfide linked dimer, follistatin domain (FSD); HET: NAG; 2.40A {Homo sapiens} PDB: 2kcx_A Length = 209 Back     alignment and structure
>3hh2_C Follistatin; protein-protein complex, TB domain, cystine knot motif, TGF- fold, disulfide linked dimer, CLE PAIR of basic residues, cytokine; HET: CIT; 2.15A {Homo sapiens} PDB: 2b0u_C* 2p6a_D Length = 288 Back     alignment and structure
>3hh2_C Follistatin; protein-protein complex, TB domain, cystine knot motif, TGF- fold, disulfide linked dimer, CLE PAIR of basic residues, cytokine; HET: CIT; 2.15A {Homo sapiens} PDB: 2b0u_C* 2p6a_D Length = 288 Back     alignment and structure
>3hh2_C Follistatin; protein-protein complex, TB domain, cystine knot motif, TGF- fold, disulfide linked dimer, CLE PAIR of basic residues, cytokine; HET: CIT; 2.15A {Homo sapiens} PDB: 2b0u_C* 2p6a_D Length = 288 Back     alignment and structure
>1pce_A PEC-60; proteinase inhibitor(kazal type); NMR {Sus scrofa} SCOP: g.68.1.1 Length = 60 Back     alignment and structure
>1tbr_R RHODNIIN; complex (serine protease-inhibitor), kazal-type inhibitor, T complex (serine protease-inhibitor) complex; 2.60A {Rhodnius prolixus} SCOP: g.68.1.1 g.68.1.1 PDB: 1tbq_R Length = 103 Back     alignment and structure
>1tbr_R RHODNIIN; complex (serine protease-inhibitor), kazal-type inhibitor, T complex (serine protease-inhibitor) complex; 2.60A {Rhodnius prolixus} SCOP: g.68.1.1 g.68.1.1 PDB: 1tbq_R Length = 103 Back     alignment and structure
>2f3c_I Thrombin inhibitor infestin; serine protease - inhibitor complex, kazal-type domain, hydrolase/hydrolase inhibitor complex; 2.50A {Triatoma infestans} SCOP: g.68.1.1 PDB: 1kma_A Length = 55 Back     alignment and structure
>2leo_A Serine protease inhibitor kazal-type 7; esophageal cancer-related gene 2, hydrol inhibitor; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>2jxd_A Serine protease inhibitor kazal-type 2; anti-parallel beta sheet, beta-bulge, disulfide bond, alpha helix, pyrrolidone carboxylic acid, secreted; NMR {Homo sapiens} Length = 62 Back     alignment and structure
>1cgj_I Pancreatic secretory trypsin inhibitor (kazal type) variant 4; serine protease/inhibitor complex; 2.30A {Homo sapiens} SCOP: g.68.1.1 Length = 56 Back     alignment and structure
>1r0r_I Ovomucoid, omtky3; high resolution, serine protease, protein inhibitor, hydrolase; 1.10A {Meleagris gallopavo} SCOP: g.68.1.1 PDB: 1sgr_I 2gkr_I 1cho_I 1omt_A 1omu_A 1ppf_I* 1tur_A 1tus_A 3sgb_I 2ovo_A 4ovo_A 1iy5_A 1cso_I 1ct4_I 2sgf_I 2gkt_I 2gkv_A 2nu0_I 1m8b_A 1m8c_A ... Length = 51 Back     alignment and structure
>1yu6_C Ovomucoid; protein proteinase inhibitor, protease, hydrolase; 1.55A {Meleagris gallopavo} SCOP: g.68.1.1 PDB: 1z7k_B* Length = 185 Back     alignment and structure
>2erw_A Serine protease inhibitor infestin; kazal type domain, blood clotting, hydrolase inhibitor; 1.40A {Triatoma infestans} SCOP: g.68.1.1 Length = 56 Back     alignment and structure
>1tgs_I Pancreatic secretory trypsin inhibitor (kazal type); complex (proteinase/inhibitor); 1.80A {Sus scrofa} SCOP: g.68.1.1 PDB: 1cgi_I 1hpt_A Length = 56 Back     alignment and structure
>1bus_A Proteinase inhibitor IIA; HET: PCA; NMR {Bos taurus} SCOP: g.68.1.1 PDB: 2bus_A* Length = 57 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query111
1lr7_A74 Follistatin, FS1; heparin-binding, cystine-rich, s 99.88
2arp_F152 Follistatin; cystine knot, disulfide rich, EGF dom 99.85
3hh2_C288 Follistatin; protein-protein complex, TB domain, c 99.82
3b4v_C237 Follistatin-like 3; ligand-inhibitor signalling co 99.82
3sek_C209 Follistatin-related protein 3; protein-protein com 99.81
2arp_F152 Follistatin; cystine knot, disulfide rich, EGF dom 99.8
3hh2_C288 Follistatin; protein-protein complex, TB domain, c 99.8
3sek_C209 Follistatin-related protein 3; protein-protein com 99.79
3b4v_C237 Follistatin-like 3; ligand-inhibitor signalling co 99.75
1nub_A 229 Basement membrane protein BM-40; extracellular mod 99.75
1cgj_I56 Pancreatic secretory trypsin inhibitor (kazal type 99.61
1tbr_R103 RHODNIIN; complex (serine protease-inhibitor), kaz 99.61
2jxd_A62 Serine protease inhibitor kazal-type 2; anti-paral 99.58
1tgs_I56 Pancreatic secretory trypsin inhibitor (kazal type 99.58
1y1b_A48 Elastase inhibitor; non-classical, kazal-type, pro 99.57
1pce_A60 PEC-60; proteinase inhibitor(kazal type); NMR {Sus 99.54
1yu6_C185 Ovomucoid; protein proteinase inhibitor, protease, 99.5
1r0r_I51 Ovomucoid, omtky3; high resolution, serine proteas 99.49
1uvf_A61 Serine proteinase inhibitor kazal type 5; trypsin 99.47
2leo_A66 Serine protease inhibitor kazal-type 7; esophageal 99.2
2f3c_I55 Thrombin inhibitor infestin; serine protease - inh 99.46
1bus_A57 Proteinase inhibitor IIA; HET: PCA; NMR {Bos tauru 99.44
2erw_A56 Serine protease inhibitor infestin; kazal type dom 99.43
1uvg_A78 Serine proteinase inhibitor kazal type 5; trypsin 99.39
1yu6_C185 Ovomucoid; protein proteinase inhibitor, protease, 99.38
3qtl_D75 Kazal-type serine protease inhibitor SPI-1; serine 99.28
3pis_D42 Kazal-type serine protease inhibitor SPI-1; typica 99.28
3qtl_D75 Kazal-type serine protease inhibitor SPI-1; serine 99.27
3tjq_A140 Serine protease HTRA1; hydrolase; 2.00A {Homo sapi 99.27
1tbr_R103 RHODNIIN; complex (serine protease-inhibitor), kaz 99.27
4gi3_C83 Greglin; kazal type inhibitor, hydrolase-hydrolase 99.23
1ldt_L46 LDTI, tryptase inhibitor; complex (hydrolase/inhib 99.2
1h0z_A68 Serine protease inhibitor kazal-type 5, contains h 99.0
2wcy_A155 Complement component C7; immune system, disulfide 98.88
2wcy_A155 Complement component C7; immune system, disulfide 98.1
1hdl_A55 HF6478, serine proteinase inhibitor lekti; putativ 98.04
2xrc_A 565 Human complement factor I; immune system, hydrolas 97.42
3t5o_A913 Complement component C6; macpf, MAC, membrane atta 94.69
>1lr7_A Follistatin, FS1; heparin-binding, cystine-rich, sucrose octasulphate, hormone/growth factor complex; HET: SO4; 1.50A {Rattus norvegicus} SCOP: g.3.11.3 g.68.1.1 PDB: 1lr8_A* 1lr9_A Back     alignment and structure
Probab=99.88  E-value=4.4e-23  Score=130.90  Aligned_cols=74  Identities=31%  Similarity=0.815  Sum_probs=66.1

Q ss_pred             CCCCCCccCCCCCeeccCCCCCcceeecCCCCCCCCCCCCCCCeecCCCceeCCccHHHHHHhcCCCceeEeeeccCC
Q psy11293         28 TNPCQENTCQYGAKCIPSEDGTSYKCECPQECPNYGDHTGSRPVCGSNGVDYKDLCEFQRASCSTKTNLTIKYYGKCG  105 (111)
Q Consensus        28 ~~~C~~~~C~~G~~C~~~~~g~~~~CvC~~~C~~~~~~~~~~pVCGsDG~TY~n~C~L~~~aC~~~~~i~v~~~G~C~  105 (111)
                      ++||+++.|++|++|+++.++ .++|+|+..|+...   .+.|||||||+||+|+|+|++++|+.+..|.++|+|+|+
T Consensus         1 ~~~C~~~~C~~g~~C~~~~~~-~~~C~C~~~C~~~~---~~~pVCGsDG~TY~n~C~l~~~~c~~~~~i~~~~~G~C~   74 (74)
T 1lr7_A            1 METCENVDCGPGKKCRMNKKN-KPRCVCAPDCSNIT---WKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGKCK   74 (74)
T ss_dssp             -CCSTTCCCCTTEEEEECTTS-CEEEEECCCGGGCC---CCSCEEETTSCEESSHHHHHHHHHHTCTTCCEEEESCCC
T ss_pred             CCCCCCCcCcCCCEEeECCCC-CeeecCCCCCCCCc---CCCceeCCCCCCcCChhHHHHHHhccCCceEEeecCcCC
Confidence            479999999999999997655 59999999999751   138999999999999999999999999999999999985
>2arp_F Follistatin; cystine knot, disulfide rich, EGF domain, kazal domain, PROT complex, hormone-growth factor complex; HET: 1PG; 2.00A {Rattus norvegicus} Back     alignment and structure
>3hh2_C Follistatin; protein-protein complex, TB domain, cystine knot motif, TGF- fold, disulfide linked dimer, CLE PAIR of basic residues, cytokine; HET: CIT; 2.15A {Homo sapiens} PDB: 2b0u_C* 2p6a_D Back     alignment and structure
>3b4v_C Follistatin-like 3; ligand-inhibitor signalling complex, cleavage on PAIR of BAS residues, glycoprotein, growth factor, hormone, secreted; HET: NAG; 2.48A {Homo sapiens} Back     alignment and structure
>3sek_C Follistatin-related protein 3; protein-protein complex, TB domain, cystine knot motif, TGF- fold, disulfide linked dimer, follistatin domain (FSD); HET: NAG; 2.40A {Homo sapiens} PDB: 2kcx_A Back     alignment and structure
>2arp_F Follistatin; cystine knot, disulfide rich, EGF domain, kazal domain, PROT complex, hormone-growth factor complex; HET: 1PG; 2.00A {Rattus norvegicus} Back     alignment and structure
>3hh2_C Follistatin; protein-protein complex, TB domain, cystine knot motif, TGF- fold, disulfide linked dimer, CLE PAIR of basic residues, cytokine; HET: CIT; 2.15A {Homo sapiens} PDB: 2b0u_C* 2p6a_D Back     alignment and structure
>3sek_C Follistatin-related protein 3; protein-protein complex, TB domain, cystine knot motif, TGF- fold, disulfide linked dimer, follistatin domain (FSD); HET: NAG; 2.40A {Homo sapiens} PDB: 2kcx_A Back     alignment and structure
>3b4v_C Follistatin-like 3; ligand-inhibitor signalling complex, cleavage on PAIR of BAS residues, glycoprotein, growth factor, hormone, secreted; HET: NAG; 2.48A {Homo sapiens} Back     alignment and structure
>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* Back     alignment and structure
>1cgj_I Pancreatic secretory trypsin inhibitor (kazal type) variant 4; serine protease/inhibitor complex; 2.30A {Homo sapiens} SCOP: g.68.1.1 Back     alignment and structure
>1tbr_R RHODNIIN; complex (serine protease-inhibitor), kazal-type inhibitor, T complex (serine protease-inhibitor) complex; 2.60A {Rhodnius prolixus} SCOP: g.68.1.1 g.68.1.1 PDB: 1tbq_R Back     alignment and structure
>2jxd_A Serine protease inhibitor kazal-type 2; anti-parallel beta sheet, beta-bulge, disulfide bond, alpha helix, pyrrolidone carboxylic acid, secreted; NMR {Homo sapiens} Back     alignment and structure
>1tgs_I Pancreatic secretory trypsin inhibitor (kazal type); complex (proteinase/inhibitor); 1.80A {Sus scrofa} SCOP: g.68.1.1 PDB: 1cgi_I 1hpt_A Back     alignment and structure
>1y1b_A Elastase inhibitor; non-classical, kazal-type, protease inhibitor, CSH motif, hydrolase inhibitor; NMR {Synthetic} PDB: 1y1c_A Back     alignment and structure
>1pce_A PEC-60; proteinase inhibitor(kazal type); NMR {Sus scrofa} SCOP: g.68.1.1 Back     alignment and structure
>1yu6_C Ovomucoid; protein proteinase inhibitor, protease, hydrolase; 1.55A {Meleagris gallopavo} SCOP: g.68.1.1 PDB: 1z7k_B* Back     alignment and structure
>1r0r_I Ovomucoid, omtky3; high resolution, serine protease, protein inhibitor, hydrolase; 1.10A {Meleagris gallopavo} SCOP: g.68.1.1 PDB: 1sgr_I 2gkr_I 1cho_I 1omt_A 1omu_A 1ppf_I* 1tur_A 1tus_A 3sgb_I 2ovo_A 4ovo_A 1iy5_A 1cso_I 1ct4_I 2sgf_I 2gkt_I 2gkv_A 2nu0_I 1m8b_A 1m8c_A ... Back     alignment and structure
>2leo_A Serine protease inhibitor kazal-type 7; esophageal cancer-related gene 2, hydrol inhibitor; NMR {Homo sapiens} Back     alignment and structure
>2f3c_I Thrombin inhibitor infestin; serine protease - inhibitor complex, kazal-type domain, hydrolase/hydrolase inhibitor complex; 2.50A {Triatoma infestans} SCOP: g.68.1.1 PDB: 1kma_A Back     alignment and structure
>1bus_A Proteinase inhibitor IIA; HET: PCA; NMR {Bos taurus} SCOP: g.68.1.1 PDB: 2bus_A* Back     alignment and structure
>2erw_A Serine protease inhibitor infestin; kazal type domain, blood clotting, hydrolase inhibitor; 1.40A {Triatoma infestans} SCOP: g.68.1.1 Back     alignment and structure
>1yu6_C Ovomucoid; protein proteinase inhibitor, protease, hydrolase; 1.55A {Meleagris gallopavo} SCOP: g.68.1.1 PDB: 1z7k_B* Back     alignment and structure
>3qtl_D Kazal-type serine protease inhibitor SPI-1; serine protease -kazal type serine protease inhibitor comple hydrolase inhibitor; 2.60A {Carcinoscorpius rotundicauda} Back     alignment and structure
>3pis_D Kazal-type serine protease inhibitor SPI-1; typical non-classical kazal type inhibitor fold; 2.00A {Carcinoscorpius rotundicauda} Back     alignment and structure
>3qtl_D Kazal-type serine protease inhibitor SPI-1; serine protease -kazal type serine protease inhibitor comple hydrolase inhibitor; 2.60A {Carcinoscorpius rotundicauda} Back     alignment and structure
>3tjq_A Serine protease HTRA1; hydrolase; 2.00A {Homo sapiens} Back     alignment and structure
>1tbr_R RHODNIIN; complex (serine protease-inhibitor), kazal-type inhibitor, T complex (serine protease-inhibitor) complex; 2.60A {Rhodnius prolixus} SCOP: g.68.1.1 g.68.1.1 PDB: 1tbq_R Back     alignment and structure
>4gi3_C Greglin; kazal type inhibitor, hydrolase-hydrolase inhibitor complex; 1.75A {Schistocerca gregaria} Back     alignment and structure
>1ldt_L LDTI, tryptase inhibitor; complex (hydrolase/inhibitor), hydrolase, inflammation; 1.90A {Hirudo medicinalis} SCOP: g.68.1.1 PDB: 1an1_I 2kmo_A 2kmp_A 2kmq_A 2kmr_A Back     alignment and structure
>1h0z_A Serine protease inhibitor kazal-type 5, contains hemofiltrate peptide HF6478, hemofiltrate...; serine proteinase inhibitor; NMR {Homo sapiens} SCOP: g.68.1.2 Back     alignment and structure
>2wcy_A Complement component C7; immune system, disulfide bond, immune response, factor I module, FIM, EGF, MAC, FOLN, sushi, fimac, kazal; NMR {Homo sapiens} Back     alignment and structure
>2wcy_A Complement component C7; immune system, disulfide bond, immune response, factor I module, FIM, EGF, MAC, FOLN, sushi, fimac, kazal; NMR {Homo sapiens} Back     alignment and structure
>1hdl_A HF6478, serine proteinase inhibitor lekti; putative serine proteinase inhibitor; NMR {Homo sapiens} SCOP: g.68.1.2 PDB: 1uuc_A Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Back     alignment and structure
>3t5o_A Complement component C6; macpf, MAC, membrane attack complex, innate IMMU system, blood, membrane, cytolysin, immune SYST; HET: NAG FUL FUC BGC MAN; 2.87A {Homo sapiens} PDB: 4a5w_B* 4e0s_B* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 111
d1pcea_60 g.68.1.1 (A:) PEC-60 peptide {Pig (Sus scrofa) [Ta 3e-10
d1nuba358 g.68.1.1 (A:78-135) Domain of BM-40/SPARC/osteonec 4e-10
d1tbrr252 g.68.1.1 (R:52-103) Blood-sucking insect-derived t 2e-09
d1lr7a248 g.68.1.1 (A:89-136) Domain of follistatin {Rat (Ra 2e-09
d1tgsi_56 g.68.1.1 (I:) Secretory trypsin inhibitor {Pig (Su 8e-09
d1z7kb162 g.68.1.1 (B:2-63) Ovomucoid domains {Turkey (Melea 2e-08
d1hpta_56 g.68.1.1 (A:) Secretory trypsin inhibitor {Human ( 2e-08
d2busa_57 g.68.1.1 (A:) Seminal plasma inhibitor IIa {Cow (B 7e-08
d2f3ci146 g.68.1.1 (I:5-50) Blood-sucking insect-derived try 8e-08
d1r0ri_51 g.68.1.1 (I:) Ovomucoid domains {Turkey (Meleagris 1e-07
d2erwa153 g.68.1.1 (A:4-56) Blood-sucking insect-derived try 1e-06
d1h0za_68 g.68.1.2 (A:) Serine proteinase inhibitor lekti {H 6e-05
>d1pcea_ g.68.1.1 (A:) PEC-60 peptide {Pig (Sus scrofa) [TaxId: 9823]} Length = 60 Back     information, alignment and structure

class: Small proteins
fold: Kazal-type serine protease inhibitors
superfamily: Kazal-type serine protease inhibitors
family: Ovomucoid domain III-like
domain: PEC-60 peptide
species: Pig (Sus scrofa) [TaxId: 9823]

 Score = 49.6 bits (118), Expect = 3e-10
 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 2/52 (3%)

Query: 53  CECPQECPNYGDHTGSRPVCGSNGVDYKDLCEFQRASCSTKTNLTIKYYGKC 104
           CE   E P+        PVCG++GV Y+  C+   A    K ++ I   G+C
Sbjct: 11  CEHMTESPDCSRI--YDPVCGTDGVTYESECKLCLARIENKQDIQIVKDGEC 60
>d1nuba3 g.68.1.1 (A:78-135) Domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1tbrr2 g.68.1.1 (R:52-103) Blood-sucking insect-derived tryptase inhibitor {Bug (Rhodnius prolixus), rhodniin [TaxId: 13249]} Length = 52 Back     information, alignment and structure
>d1lr7a2 g.68.1.1 (A:89-136) Domain of follistatin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 48 Back     information, alignment and structure
>d1tgsi_ g.68.1.1 (I:) Secretory trypsin inhibitor {Pig (Sus scrofa) [TaxId: 9823]} Length = 56 Back     information, alignment and structure
>d1z7kb1 g.68.1.1 (B:2-63) Ovomucoid domains {Turkey (Meleagris gallopavo) [TaxId: 9103]} Length = 62 Back     information, alignment and structure
>d1hpta_ g.68.1.1 (A:) Secretory trypsin inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d2busa_ g.68.1.1 (A:) Seminal plasma inhibitor IIa {Cow (Bos taurus) [TaxId: 9913]} Length = 57 Back     information, alignment and structure
>d2f3ci1 g.68.1.1 (I:5-50) Blood-sucking insect-derived tryptase inhibitor {Triatoma infestans [TaxId: 30076]} Length = 46 Back     information, alignment and structure
>d1r0ri_ g.68.1.1 (I:) Ovomucoid domains {Turkey (Meleagris gallopavo) [TaxId: 9103]} Length = 51 Back     information, alignment and structure
>d2erwa1 g.68.1.1 (A:4-56) Blood-sucking insect-derived tryptase inhibitor {Triatoma infestans [TaxId: 30076]} Length = 53 Back     information, alignment and structure
>d1h0za_ g.68.1.2 (A:) Serine proteinase inhibitor lekti {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query111
d1hpta_56 Secretory trypsin inhibitor {Human (Homo sapiens) 99.74
d1tgsi_56 Secretory trypsin inhibitor {Pig (Sus scrofa) [Tax 99.72
d1tbrr252 Blood-sucking insect-derived tryptase inhibitor {B 99.7
d1nuba358 Domain of BM-40/SPARC/osteonectin {Human (Homo sap 99.69
d1lr7a248 Domain of follistatin {Rat (Rattus norvegicus) [Ta 99.68
d1z7kb162 Ovomucoid domains {Turkey (Meleagris gallopavo) [T 99.68
d2f3ci146 Blood-sucking insect-derived tryptase inhibitor {T 99.65
d1pcea_60 PEC-60 peptide {Pig (Sus scrofa) [TaxId: 9823]} 99.64
d2busa_57 Seminal plasma inhibitor IIa {Cow (Bos taurus) [Ta 99.61
d1r0ri_51 Ovomucoid domains {Turkey (Meleagris gallopavo) [T 99.6
d2erwa153 Blood-sucking insect-derived tryptase inhibitor {T 99.59
d1h0za_68 Serine proteinase inhibitor lekti {Human (Homo sap 99.2
d1ldtl_46 Leech derived tryptase inhibitor (LDTI-C) {Medicin 98.94
d1hdla_55 Serine proteinase inhibitor lekti {Human (Homo sap 98.15
d1lr7a126 Domain of follistatin {Rat (Rattus norvegicus) [Ta 95.71
d1nuba226 Domain of BM-40/SPARC/osteonectin {Human (Homo sap 95.08
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 91.28
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 88.7
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 88.53
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 87.23
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 86.57
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 86.48
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 85.93
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 85.03
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 84.05
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 80.52
>d1hpta_ g.68.1.1 (A:) Secretory trypsin inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: Kazal-type serine protease inhibitors
superfamily: Kazal-type serine protease inhibitors
family: Ovomucoid domain III-like
domain: Secretory trypsin inhibitor
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.74  E-value=7.3e-19  Score=105.17  Aligned_cols=53  Identities=30%  Similarity=0.560  Sum_probs=47.9

Q ss_pred             CCCcceeecCC-CCCCCCCCCCCCCeecCCCceeCCccHHHHHHhcCCCceeEeeeccC
Q psy11293         47 DGTSYKCECPQ-ECPNYGDHTGSRPVCGSNGVDYKDLCEFQRASCSTKTNLTIKYYGKC  104 (111)
Q Consensus        47 ~g~~~~CvC~~-~C~~~~~~~~~~pVCGsDG~TY~n~C~L~~~aC~~~~~i~v~~~G~C  104 (111)
                      .|+++.|+|+. .|+..+     .|||||||+||.|+|+|++++|..+..|.|+|.|+|
T Consensus         3 ~gr~~~C~~~~~~C~~~~-----~PVCGsdG~TY~N~C~l~~~~C~~~~~i~v~~~G~C   56 (56)
T d1hpta_           3 LGREAKCYNELNGCTYEY-----RPVCGTDGDTYPNECVLCFENRKRQTSILIQKSGPC   56 (56)
T ss_dssp             SSBCCCCTTCSSCCCCCC-----BCEEETTSCEESBHHHHHHHHHHHTCCCCEEEESCC
T ss_pred             CCcCCcCCCCCCCCCCCC-----CcccCCCCcEeccHhHHHHHHhcCCCceEEeecCCC
Confidence            45568998864 599886     899999999999999999999999999999999987
>d1tgsi_ g.68.1.1 (I:) Secretory trypsin inhibitor {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1tbrr2 g.68.1.1 (R:52-103) Blood-sucking insect-derived tryptase inhibitor {Bug (Rhodnius prolixus), rhodniin [TaxId: 13249]} Back     information, alignment and structure
>d1nuba3 g.68.1.1 (A:78-135) Domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lr7a2 g.68.1.1 (A:89-136) Domain of follistatin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1z7kb1 g.68.1.1 (B:2-63) Ovomucoid domains {Turkey (Meleagris gallopavo) [TaxId: 9103]} Back     information, alignment and structure
>d2f3ci1 g.68.1.1 (I:5-50) Blood-sucking insect-derived tryptase inhibitor {Triatoma infestans [TaxId: 30076]} Back     information, alignment and structure
>d1pcea_ g.68.1.1 (A:) PEC-60 peptide {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2busa_ g.68.1.1 (A:) Seminal plasma inhibitor IIa {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1r0ri_ g.68.1.1 (I:) Ovomucoid domains {Turkey (Meleagris gallopavo) [TaxId: 9103]} Back     information, alignment and structure
>d2erwa1 g.68.1.1 (A:4-56) Blood-sucking insect-derived tryptase inhibitor {Triatoma infestans [TaxId: 30076]} Back     information, alignment and structure
>d1h0za_ g.68.1.2 (A:) Serine proteinase inhibitor lekti {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ldtl_ g.68.1.1 (L:) Leech derived tryptase inhibitor (LDTI-C) {Medicinal leech (Hirudo medicinalis) [TaxId: 6421]} Back     information, alignment and structure
>d1hdla_ g.68.1.2 (A:) Serine proteinase inhibitor lekti {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lr7a1 g.3.11.3 (A:64-88) Domain of follistatin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nuba2 g.3.11.3 (A:53-77) Domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure