Psyllid ID: psy11678

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-----
MSLYSSSLNKNPQMQYSKFSPGHNLSGFDKEKQDVVKVYAGPNLTKKLTFGPPPAKSMKTEYGSLECAIEVVGDLQEAVDHIHTYGSSHTDVISAKSMKTEYGSLECAIEVVGDLQEAVDHIHTYGSSHTDVIVTENARDSKCDYPAACNAMETLLIHEDHMACT
ccccccccccccHHHHHcccccccHHHHHHHHHcccEEEccccHHHHccccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHccEEEEccHHHHHHHHHHcccccccEEEEcccccccccccccccEEEEEEEEEEccccc
ccccccccccccccEEEEcccHHHHHHHHHHHHcccEEEccHHHHHHcccccccHHHHHHHHccHHHHHHEHHcHHHHHHHHHHcccccccEEEEccccHHHccHEEEEHHHccHHHHHHHHHHcccccccEEEEccccccccccHHHHHHHHHHHHHHHHHccc
mslyssslnknpqmqyskfspghnlsgfdkekqDVVKvyagpnltkkltfgpppaksmkteygsLECAIEVVGDLQEAVDHIHTYGSSHTDVISAKSMKTEYGSLECAIEVVGDLQEAVDHIhtygsshtdvivtenardskcdypaACNAMETLLIHEDHMACT
mslyssslnknpqmqySKFSPGHNLSGFDKEKQDVVKVYAGpnltkkltfgpppaKSMKTEYGSLECAIEVVGDLQEAVDHIHTYGSSHTDVISAKSMKTEYGSLECAIEVVGDLQEAVDHIHTYGSSHTDVIVTENARDSKCDYPAACNAMETLLIHEDHMACT
MSLYSSSLNKNPQMQYSKFSPGHNLSGFDKEKQDVVKVYAGPNLTKKLTFGPPPAKSMKTEYGSLECAIEVVGDLQEAVDHIHTYGSSHTDVISAKSMKTEYGSLECAIEVVGDLQEAVDHIHTYGSSHTDVIVTENARDSKCDYPAACNAMETLLIHEDHMACT
**********************************VVKVYAGPNLTKKL************EYGSLECAIEVVGDLQEAVDHIHTYGSSHTDVISAKSMKTEYGSLECAIEVVGDLQEAVDHIHTYGSSHTDVIVTENARDSKCDYPAACNAMETLLIH*******
*********KNPQMQYSKFSPGHNLSGFDKEKQDVVKVYAGPNLTKKLTFGPPPAKSMKTEYGSLECAIEVVGDLQEAVDHIHTYGSSHTDVISAKSMKTEYGSLECAIEVVGDLQEAVDHIHTYGSSHTDVIVTENARDSKCDYPAACNAMETLLIHEDHMAC*
*********KNPQMQYSKFSPGHNLSGFDKEKQDVVKVYAGPNLTKKLTFGPPPAKSMKTEYGSLECAIEVVGDLQEAVDHIHTYGSSHTDVISAKSMKTEYGSLECAIEVVGDLQEAVDHIHTYGSSHTDVIVTENARDSKCDYPAACNAMETLLIHEDHMACT
****SSSLNKNPQMQYSKFSPGHNLSGFDKEKQDVVKVYAGPNLTKKLTFGPPPAKSMKTEYGSLECAIEVVGDLQEAVDHIHTYGSSHTDVISAKSMKTEYGSLECAIEVVGDLQEAVDHIHTYGSSHTDVIVTENARDSKCDYPAACNAMETLLIHEDHMA**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLYSSSLNKNPQMQYSKFSPGHNLSGFDKEKQDVVKVYAGPNLTKKLTFGPPPAKSMKTEYGSLECAIEVVGDLQEAVDHIHTYGSSHTDVISAKSMKTEYGSLECAIEVVGDLQEAVDHIHTYGSSHTDVIVTENARDSKCDYPAACNAMETLLIHEDHMACT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query165 2.2.26 [Sep-21-2011]
Q9Z110795 Delta-1-pyrroline-5-carbo yes N/A 0.369 0.076 0.555 8e-17
Q5R4M8795 Delta-1-pyrroline-5-carbo yes N/A 0.369 0.076 0.527 7e-16
P54886795 Delta-1-pyrroline-5-carbo yes N/A 0.369 0.076 0.527 8e-16
P54889800 Probable delta-1-pyrrolin yes N/A 0.357 0.073 0.536 2e-14
O04226716 Delta-1-pyrroline-5-carbo yes N/A 0.363 0.083 0.5 4e-10
O04015717 Delta-1-pyrroline-5-carbo N/A N/A 0.430 0.099 0.438 3e-09
Q96480717 Delta-1-pyrroline-5-carbo N/A N/A 0.339 0.078 0.465 1e-08
P54888726 Delta-1-pyrroline-5-carbo yes N/A 0.339 0.077 0.465 3e-08
P54887717 Delta-1-pyrroline-5-carbo no N/A 0.339 0.078 0.465 7e-08
P32296671 Delta-1-pyrroline-5-carbo N/A N/A 0.357 0.087 0.459 2e-07
>sp|Q9Z110|P5CS_MOUSE Delta-1-pyrroline-5-carboxylate synthase OS=Mus musculus GN=Aldh18a1 PE=2 SV=2 Back     alignment and function desciption
 Score = 86.3 bits (212), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 40/72 (55%), Positives = 50/72 (69%)

Query: 29  DKEKQDVVKVYAGPNLTKKLTFGPPPAKSMKTEYGSLECAIEVVGDLQEAVDHIHTYGSS 88
           D  + + VK++AGP     LTF P   KS++TEYG LE  IEVV  +QEA+DHIH YGSS
Sbjct: 635 DMLRVEQVKIHAGPKFASYLTFSPSEVKSLRTEYGDLEVCIEVVDSVQEAIDHIHKYGSS 694

Query: 89  HTDVISAKSMKT 100
           HTDVI  ++ KT
Sbjct: 695 HTDVIVTENEKT 706

Mus musculus (taxid: 10090)
EC: 1EC: .EC: 2EC: .EC: 1EC: .EC: 4EC: 1
>sp|Q5R4M8|P5CS_PONAB Delta-1-pyrroline-5-carboxylate synthase OS=Pongo abelii GN=ALDH18A1 PE=2 SV=1 Back     alignment and function description
>sp|P54886|P5CS_HUMAN Delta-1-pyrroline-5-carboxylate synthase OS=Homo sapiens GN=ALDH18A1 PE=1 SV=2 Back     alignment and function description
>sp|P54889|ALH13_CAEEL Probable delta-1-pyrroline-5-carboxylate synthase OS=Caenorhabditis elegans GN=alh-13 PE=2 SV=1 Back     alignment and function description
>sp|O04226|P5CS_ORYSJ Delta-1-pyrroline-5-carboxylate synthase OS=Oryza sativa subsp. japonica GN=P5CS PE=2 SV=2 Back     alignment and function description
>sp|O04015|P5CS_ACTDE Delta-1-pyrroline-5-carboxylate synthase OS=Actinidia deliciosa PE=2 SV=1 Back     alignment and function description
>sp|Q96480|P5CS_SOLLC Delta-1-pyrroline-5-carboxylate synthase OS=Solanum lycopersicum GN=PRO2 PE=2 SV=1 Back     alignment and function description
>sp|P54888|P5CS2_ARATH Delta-1-pyrroline-5-carboxylate synthase B OS=Arabidopsis thaliana GN=P5CSB PE=2 SV=1 Back     alignment and function description
>sp|P54887|P5CS1_ARATH Delta-1-pyrroline-5-carboxylate synthase A OS=Arabidopsis thaliana GN=P5CSA PE=1 SV=1 Back     alignment and function description
>sp|P32296|P5CS_VIGAC Delta-1-pyrroline-5-carboxylate synthase OS=Vigna aconitifolia PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query165
357609554 780 glutamate semialdehyde dehydrogenase [Da 0.284 0.060 0.709 6e-20
195496667 776 GE22600 [Drosophila yakuba] gi|194181891 0.466 0.099 0.6 6e-19
194876081 776 GG16239 [Drosophila erecta] gi|190655493 0.466 0.099 0.6 6e-19
195348707 776 GM22423 [Drosophila sechellia] gi|194122 0.466 0.099 0.6 6e-19
195480859 704 GE23278 [Drosophila yakuba] gi|194186487 0.466 0.109 0.6 6e-19
21357643 776 CG7470, isoform A [Drosophila melanogast 0.375 0.079 0.709 6e-19
260817561 1027 hypothetical protein BRAFLDRAFT_128677 [ 0.787 0.126 0.348 1e-18
156538301 786 PREDICTED: delta-1-pyrroline-5-carboxyla 0.327 0.068 0.623 1e-18
321477377 781 hypothetical protein DAPPUDRAFT_41805 [D 0.369 0.078 0.693 1e-18
242010763 740 delta 1-pyrroline-5-carboxylate syntheta 0.309 0.068 0.693 2e-18
>gi|357609554|gb|EHJ66511.1| glutamate semialdehyde dehydrogenase [Danaus plexippus] Back     alignment and taxonomy information
 Score =  102 bits (254), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 44/62 (70%), Positives = 53/62 (85%)

Query: 32  KQDVVKVYAGPNLTKKLTFGPPPAKSMKTEYGSLECAIEVVGDLQEAVDHIHTYGSSHTD 91
           KQ+ VK++AGP L  +LTFGPPPA++MK EYG LEC+IEVV DL EA+DHIH +GSSHTD
Sbjct: 629 KQEGVKIHAGPKLASQLTFGPPPARTMKYEYGDLECSIEVVKDLDEAIDHIHKFGSSHTD 688

Query: 92  VI 93
           VI
Sbjct: 689 VI 690

Source: Danaus plexippus

Species: Danaus plexippus

Genus: Danaus

Family: Nymphalidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|195496667|ref|XP_002095790.1| GE22600 [Drosophila yakuba] gi|194181891|gb|EDW95502.1| GE22600 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|194876081|ref|XP_001973710.1| GG16239 [Drosophila erecta] gi|190655493|gb|EDV52736.1| GG16239 [Drosophila erecta] Back     alignment and taxonomy information
>gi|195348707|ref|XP_002040889.1| GM22423 [Drosophila sechellia] gi|194122399|gb|EDW44442.1| GM22423 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|195480859|ref|XP_002086697.1| GE23278 [Drosophila yakuba] gi|194186487|gb|EDX00099.1| GE23278 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|21357643|ref|NP_649375.1| CG7470, isoform A [Drosophila melanogaster] gi|386771600|ref|NP_001246877.1| CG7470, isoform B [Drosophila melanogaster] gi|7296514|gb|AAF51799.1| CG7470, isoform A [Drosophila melanogaster] gi|17861556|gb|AAL39255.1| GH12632p [Drosophila melanogaster] gi|220946916|gb|ACL86001.1| CG7470-PA [synthetic construct] gi|383292069|gb|AFH04548.1| CG7470, isoform B [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|260817561|ref|XP_002603654.1| hypothetical protein BRAFLDRAFT_128677 [Branchiostoma floridae] gi|229288976|gb|EEN59665.1| hypothetical protein BRAFLDRAFT_128677 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|156538301|ref|XP_001603792.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|321477377|gb|EFX88336.1| hypothetical protein DAPPUDRAFT_41805 [Daphnia pulex] Back     alignment and taxonomy information
>gi|242010763|ref|XP_002426128.1| delta 1-pyrroline-5-carboxylate synthetase, putative [Pediculus humanus corporis] gi|212510175|gb|EEB13390.1| delta 1-pyrroline-5-carboxylate synthetase, putative [Pediculus humanus corporis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query165
FB|FBgn0037146776 CG7470 [Drosophila melanogaste 0.375 0.079 0.709 2.9e-19
ZFIN|ZDB-GENE-030131-5602784 aldh18a1 "aldehyde dehydrogena 0.436 0.091 0.555 1.1e-16
UNIPROTKB|E1C8Q3808 ALDH18A1 "Uncharacterized prot 0.436 0.089 0.569 1.1e-16
UNIPROTKB|E2R3N2747 ALDH18A1 "Uncharacterized prot 0.436 0.096 0.555 5.7e-16
UNIPROTKB|E2QYZ0795 ALDH18A1 "Uncharacterized prot 0.436 0.090 0.555 6.3e-16
MGI|MGI:1888908795 Aldh18a1 "aldehyde dehydrogena 0.436 0.090 0.555 6.3e-16
RGD|1311431795 Aldh18a1 "aldehyde dehydrogena 0.436 0.090 0.555 6.3e-16
UNIPROTKB|F1SC47795 ALDH18A1 "Uncharacterized prot 0.436 0.090 0.555 6.3e-16
UNIPROTKB|Q2KJH7795 ALDH18A1 "Aldehyde dehydrogena 0.436 0.090 0.541 1.3e-15
UNIPROTKB|Q5R4M8795 ALDH18A1 "Delta-1-pyrroline-5- 0.436 0.090 0.527 3.5e-15
FB|FBgn0037146 CG7470 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 241 (89.9 bits), Expect = 2.9e-19, P = 2.9e-19
 Identities = 44/62 (70%), Positives = 53/62 (85%)

Query:    32 KQDVVKVYAGPNLTKKLTFGPPPAKSMKTEYGSLECAIEVVGDLQEAVDHIHTYGSSHTD 91
             K++ VK+YAGP L ++LTFGPP AKS+K EYG+LEC IEVV  L EA++HIHTYGSSHTD
Sbjct:   624 KREGVKIYAGPRLNQQLTFGPPAAKSLKHEYGALECCIEVVPSLDEAINHIHTYGSSHTD 683

Query:    92 VI 93
             VI
Sbjct:   684 VI 685
GO:0005739 "mitochondrion" evidence=ISS
GO:0004350 "glutamate-5-semialdehyde dehydrogenase activity" evidence=ISS
GO:0004349 "glutamate 5-kinase activity" evidence=ISS
GO:0006561 "proline biosynthetic process" evidence=ISS
GO:0017084 "delta1-pyrroline-5-carboxylate synthetase activity" evidence=ISS
GO:0005743 "mitochondrial inner membrane" evidence=ISS
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0005811 "lipid particle" evidence=IDA
ZFIN|ZDB-GENE-030131-5602 aldh18a1 "aldehyde dehydrogenase 18 family, member A1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1C8Q3 ALDH18A1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E2R3N2 ALDH18A1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E2QYZ0 ALDH18A1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1888908 Aldh18a1 "aldehyde dehydrogenase 18 family, member A1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1311431 Aldh18a1 "aldehyde dehydrogenase 18 family, member A1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1SC47 ALDH18A1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q2KJH7 ALDH18A1 "Aldehyde dehydrogenase 18 family, member A1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q5R4M8 ALDH18A1 "Delta-1-pyrroline-5-carboxylate synthase" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer1.2.1.41LOW CONFIDENCE prediction!
3rd Layer1.2.10.691

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query165
TIGR01092715 TIGR01092, P5CS, delta l-pyrroline-5-carboxylate s 1e-19
cd07079406 cd07079, ALDH_F18-19_ProA-GPR, Gamma-glutamyl phos 1e-17
PLN02418718 PLN02418, PLN02418, delta-1-pyrroline-5-carboxylat 5e-17
cd07079406 cd07079, ALDH_F18-19_ProA-GPR, Gamma-glutamyl phos 1e-16
PLN02418718 PLN02418, PLN02418, delta-1-pyrroline-5-carboxylat 2e-15
TIGR01092715 TIGR01092, P5CS, delta l-pyrroline-5-carboxylate s 6e-15
PRK00197417 PRK00197, proA, gamma-glutamyl phosphate reductase 1e-14
TIGR00407398 TIGR00407, proA, gamma-glutamyl phosphate reductas 5e-12
COG0014417 COG0014, ProA, Gamma-glutamyl phosphate reductase 1e-11
PRK00197417 PRK00197, proA, gamma-glutamyl phosphate reductase 2e-11
TIGR01092 715 TIGR01092, P5CS, delta l-pyrroline-5-carboxylate s 1e-09
cd07079 406 cd07079, ALDH_F18-19_ProA-GPR, Gamma-glutamyl phos 5e-09
COG0014417 COG0014, ProA, Gamma-glutamyl phosphate reductase 1e-08
PLN02418 718 PLN02418, PLN02418, delta-1-pyrroline-5-carboxylat 2e-08
PRK00197 417 PRK00197, proA, gamma-glutamyl phosphate reductase 1e-06
COG0014 417 COG0014, ProA, Gamma-glutamyl phosphate reductase 2e-06
cd07077397 cd07077, ALDH-like, NAD(P)+-dependent aldehyde deh 2e-06
cd07077397 cd07077, ALDH-like, NAD(P)+-dependent aldehyde deh 2e-05
TIGR00407 398 TIGR00407, proA, gamma-glutamyl phosphate reductas 0.003
cd07077 397 cd07077, ALDH-like, NAD(P)+-dependent aldehyde deh 0.004
>gnl|CDD|130164 TIGR01092, P5CS, delta l-pyrroline-5-carboxylate synthetase Back     alignment and domain information 
 Score = 84.2 bits (208), Expect = 1e-19
 Identities = 28/65 (43%), Positives = 39/65 (60%)

Query: 36  VKVYAGPNLTKKLTFGPPPAKSMKTEYGSLECAIEVVGDLQEAVDHIHTYGSSHTDVISA 95
           V ++ GP     LTF     KS +TEY SL C +E+V D+ +A+DHIH +GS+HTD I  
Sbjct: 566 VTIHGGPRFAAYLTFNISETKSFRTEYSSLACTVEIVDDVYDAIDHIHKHGSAHTDCIVT 625

Query: 96  KSMKT 100
           +    
Sbjct: 626 EDENV 630

This protein contains a glutamate 5-kinase (ProB, EC 2.7.2.11) region followed by a gamma-glutamyl phosphate reductase (ProA, EC 1.2.1.41) region [Amino acid biosynthesis, Glutamate family]. Length = 715
>gnl|CDD|143398 cd07079, ALDH_F18-19_ProA-GPR, Gamma-glutamyl phosphate reductase (GPR), aldehyde dehydrogenase families 18 and 19 Back     alignment and domain information
>gnl|CDD|215230 PLN02418, PLN02418, delta-1-pyrroline-5-carboxylate synthase Back     alignment and domain information
>gnl|CDD|143398 cd07079, ALDH_F18-19_ProA-GPR, Gamma-glutamyl phosphate reductase (GPR), aldehyde dehydrogenase families 18 and 19 Back     alignment and domain information
>gnl|CDD|215230 PLN02418, PLN02418, delta-1-pyrroline-5-carboxylate synthase Back     alignment and domain information
>gnl|CDD|130164 TIGR01092, P5CS, delta l-pyrroline-5-carboxylate synthetase Back     alignment and domain information
>gnl|CDD|234685 PRK00197, proA, gamma-glutamyl phosphate reductase; Provisional Back     alignment and domain information
>gnl|CDD|161862 TIGR00407, proA, gamma-glutamyl phosphate reductase Back     alignment and domain information
>gnl|CDD|223093 COG0014, ProA, Gamma-glutamyl phosphate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|234685 PRK00197, proA, gamma-glutamyl phosphate reductase; Provisional Back     alignment and domain information
>gnl|CDD|130164 TIGR01092, P5CS, delta l-pyrroline-5-carboxylate synthetase Back     alignment and domain information
>gnl|CDD|143398 cd07079, ALDH_F18-19_ProA-GPR, Gamma-glutamyl phosphate reductase (GPR), aldehyde dehydrogenase families 18 and 19 Back     alignment and domain information
>gnl|CDD|223093 COG0014, ProA, Gamma-glutamyl phosphate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|215230 PLN02418, PLN02418, delta-1-pyrroline-5-carboxylate synthase Back     alignment and domain information
>gnl|CDD|234685 PRK00197, proA, gamma-glutamyl phosphate reductase; Provisional Back     alignment and domain information
>gnl|CDD|223093 COG0014, ProA, Gamma-glutamyl phosphate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|143396 cd07077, ALDH-like, NAD(P)+-dependent aldehyde dehydrogenase-like (ALDH-like) family Back     alignment and domain information
>gnl|CDD|143396 cd07077, ALDH-like, NAD(P)+-dependent aldehyde dehydrogenase-like (ALDH-like) family Back     alignment and domain information
>gnl|CDD|161862 TIGR00407, proA, gamma-glutamyl phosphate reductase Back     alignment and domain information
>gnl|CDD|143396 cd07077, ALDH-like, NAD(P)+-dependent aldehyde dehydrogenase-like (ALDH-like) family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 165
COG0014417 ProA Gamma-glutamyl phosphate reductase [Amino aci 99.97
KOG4165|consensus433 99.92
COG0014417 ProA Gamma-glutamyl phosphate reductase [Amino aci 99.48
KOG4165|consensus433 99.19
TIGR02518488 EutH_ACDH acetaldehyde dehydrogenase (acetylating) 99.06
TIGR00407398 proA gamma-glutamyl phosphate reductase. The prosi 98.29
PRK13805 862 bifunctional acetaldehyde-CoA/alcohol dehydrogenas 98.06
PRK15398465 aldehyde dehydrogenase EutE; Provisional 98.05
PRK00197417 proA gamma-glutamyl phosphate reductase; Provision 98.0
cd07121429 ALDH_EutE Ethanolamine utilization protein EutE-li 97.98
PLN02418718 delta-1-pyrroline-5-carboxylate synthase 97.94
TIGR01092715 P5CS delta l-pyrroline-5-carboxylate synthetase. T 97.85
cd07079406 ALDH_F18-19_ProA-GPR Gamma-glutamyl phosphate redu 97.78
cd07131478 ALDH_AldH-CAJ73105 Uncharacterized Candidatus kuen 97.59
cd07090457 ALDH_F9_TMBADH NAD+-dependent 4-trimethylaminobuty 97.55
TIGR01722477 MMSDH methylmalonic acid semialdehyde dehydrogenas 97.46
cd07125518 ALDH_PutA-P5CDH Delta(1)-pyrroline-5-carboxylate d 97.43
cd06534367 ALDH-SF NAD(P)+-dependent aldehyde dehydrogenase s 97.41
cd07122436 ALDH_F20_ACDH Coenzyme A acylating aldehyde dehydr 97.37
cd07147452 ALDH_F21_RNP123 Aldehyde dehydrogenase family 21A1 97.37
cd07115453 ALDH_HMSADH_HapE Pseudomonas fluorescens 4-hydroxy 97.32
TIGR02299488 HpaE 5-carboxymethyl-2-hydroxymuconate semialdehyd 97.32
cd07106446 ALDH_AldA-AAD23400 Streptomyces aureofaciens putat 97.32
PRK09847494 gamma-glutamyl-gamma-aminobutyraldehyde dehydrogen 97.31
cd07108457 ALDH_MGR_2402 Magnetospirillum NAD(P)+-dependent a 97.31
cd07144484 ALDH_ALD2-YMR170C Saccharomyces cerevisiae aldehyd 97.28
TIGR01804467 BADH glycine betaine aldehyde dehydrogenase. Betai 97.26
cd07081439 ALDH_F20_ACDH_EutE-like Coenzyme A acylating aldeh 97.22
cd07148455 ALDH_RL0313 Uncharacterized ALDH ( RL0313) with si 97.2
TIGR03216481 OH_muco_semi_DH 2-hydroxymuconic semialdehyde dehy 97.2
cd07101454 ALDH_SSADH2_GabD2 Mycobacterium tuberculosis succi 97.19
PLN00412496 NADP-dependent glyceraldehyde-3-phosphate dehydrog 97.18
TIGR03240484 arg_catab_astD succinylglutamic semialdehyde dehyd 97.17
cd07085478 ALDH_F6_MMSDH Methylmalonate semialdehyde dehydrog 97.17
cd07102452 ALDH_EDX86601 Uncharacterized aldehyde dehydrogena 97.16
cd07143481 ALDH_AldA_AN0554 Aspergillus nidulans aldehyde deh 97.15
cd07150451 ALDH_VaniDH_like Pseudomonas putida vanillin dehyd 97.14
cd07088468 ALDH_LactADH-AldA Escherichia coli lactaldehyde de 97.14
cd07091476 ALDH_F1-2_Ald2-like ALDH subfamily: ALDH families 97.14
cd07092450 ALDH_ABALDH-YdcW Escherichia coli NAD+-dependent g 97.14
cd07114457 ALDH_DhaS Uncharacterized Candidatus pelagibacter 97.13
cd07135436 ALDH_F14-YMR110C Saccharomyces cerevisiae aldehyde 97.12
cd07132443 ALDH_F3AB Aldehyde dehydrogenase family 3 members 97.11
cd07099453 ALDH_DDALDH Methylomonas sp. 4,4'-diapolycopene-di 97.1
cd07111480 ALDH_F16 Aldehyde dehydrogenase family 16A1-like. 97.1
cd07093455 ALDH_F8_HMSADH Human aldehyde dehydrogenase family 97.08
cd07104431 ALDH_BenzADH-like ALDH subfamily: NAD(P)+-dependen 97.05
PRK13252488 betaine aldehyde dehydrogenase; Provisional 97.05
cd07086478 ALDH_F7_AASADH-like NAD+-dependent alpha-aminoadip 97.05
cd07120455 ALDH_PsfA-ACA09737 Pseudomonas putida aldehyde deh 97.04
cd07077397 ALDH-like NAD(P)+-dependent aldehyde dehydrogenase 97.04
cd07094453 ALDH_F21_LactADH-like ALDH subfamily: NAD+-depende 97.02
cd07109454 ALDH_AAS00426 Uncharacterized Saccharopolyspora sp 97.01
TIGR01238500 D1pyr5carbox3 delta-1-pyrroline-5-carboxylate dehy 96.97
PLN02466538 aldehyde dehydrogenase family 2 member 96.92
cd07103451 ALDH_F5_SSADH_GabD Mitochondrial succinate-semiald 96.92
cd07130474 ALDH_F7_AASADH NAD+-dependent alpha-aminoadipic se 96.91
PRK13473475 gamma-aminobutyraldehyde dehydrogenase; Provisiona 96.9
PRK10090409 aldehyde dehydrogenase A; Provisional 96.87
PRK09407524 gabD2 succinic semialdehyde dehydrogenase; Reviewe 96.87
cd07082473 ALDH_F11_NP-GAPDH NADP+-dependent non-phosphorylat 96.86
cd07137432 ALDH_F3FHI Plant aldehyde dehydrogenase family 3 m 96.85
cd07149453 ALDH_y4uC Uncharacterized ALDH (y4uC) with similar 96.83
cd07145456 ALDH_LactADH_F420-Bios Methanocaldococcus jannasch 96.82
cd07146451 ALDH_PhpJ Streptomyces putative phosphonoformaldeh 96.82
cd07118454 ALDH_SNDH Gluconobacter oxydans L-sorbosone dehydr 96.81
cd07078432 ALDH NAD(P)+ dependent aldehyde dehydrogenase fami 96.8
cd07138466 ALDH_CddD_SSP0762 Rhodococcus ruber 6-oxolauric ac 96.79
cd07097473 ALDH_KGSADH-YcbD Bacillus subtilis NADP+-dependent 96.77
cd07139471 ALDH_AldA-Rv0768 Mycobacterium tuberculosis aldehy 96.77
cd07116479 ALDH_ACDHII-AcoD Ralstonia eutrophus NAD+-dependen 96.76
PRK13968462 putative succinate semialdehyde dehydrogenase; Pro 96.75
cd07152443 ALDH_BenzADH NAD-dependent benzaldehyde dehydrogen 96.75
cd07119482 ALDH_BADH-GbsA Bacillus subtilis NAD+-dependent be 96.75
cd07113477 ALDH_PADH_NahF Escherichia coli NAD+-dependent phe 96.67
cd07112462 ALDH_GABALDH-PuuC Escherichia coli NADP+-dependent 96.65
cd07110456 ALDH_F10_BADH Arabidopsis betaine aldehyde dehydro 96.63
cd07098465 ALDH_F15-22 Aldehyde dehydrogenase family 15A1 and 96.62
cd07136449 ALDH_YwdH-P39616 Bacillus subtilis aldehyde dehydr 96.61
cd07559480 ALDH_ACDHII_AcoD-like Ralstonia eutrophus NAD+-dep 96.6
PTZ00381493 aldehyde dehydrogenase family protein; Provisional 96.57
cd07142476 ALDH_F2BC Arabidosis aldehyde dehydrogenase family 96.56
cd07133434 ALDH_CALDH_CalB Coniferyl aldehyde dehydrogenase-l 96.56
cd07083500 ALDH_P5CDH ALDH subfamily NAD+-dependent delta(1)- 96.55
cd07087426 ALDH_F3-13-14_CALDH-like ALDH subfamily: Coniferyl 96.55
cd07151465 ALDH_HBenzADH NADP+-dependent p-hydroxybenzaldehyd 96.54
cd07107456 ALDH_PhdK-like Nocardioides 2-carboxybenzaldehyde 96.53
cd07089459 ALDH_CddD-AldA-like Rhodococcus ruber 6-oxolauric 96.5
PLN02467503 betaine aldehyde dehydrogenase 96.47
cd07117475 ALDH_StaphAldA1 Uncharacterized Staphylococcus aur 96.47
cd07124512 ALDH_PutA-P5CDH-RocA Delta(1)-pyrroline-5-carboxyl 96.37
PLN02315508 aldehyde dehydrogenase family 7 member 96.37
PLN02278498 succinic semialdehyde dehydrogenase 96.28
PRK09406457 gabD1 succinic semialdehyde dehydrogenase; Reviewe 96.27
cd07134433 ALDH_AlkH-like Pseudomonas putida Aldehyde dehydro 96.18
cd07105432 ALDH_SaliADH Salicylaldehyde dehydrogenase, DoxF-l 96.17
PRK09457487 astD succinylglutamic semialdehyde dehydrogenase; 96.14
cd07141481 ALDH_F1AB_F2_RALDH1 NAD+-dependent retinal dehydro 96.1
cd07100429 ALDH_SSADH1_GabD1 Mycobacterium tuberculosis succi 96.05
TIGR01237511 D1pyr5carbox2 delta-1-pyrroline-5-carboxylate dehy 96.02
TIGR02518488 EutH_ACDH acetaldehyde dehydrogenase (acetylating) 96.02
PLN02203484 aldehyde dehydrogenase 95.98
PLN02418718 delta-1-pyrroline-5-carboxylate synthase 95.98
PRK03137514 1-pyrroline-5-carboxylate dehydrogenase; Provision 95.91
cd07095431 ALDH_SGSD_AstD N-succinylglutamate 5-semialdehyde 95.83
TIGR01092715 P5CS delta l-pyrroline-5-carboxylate synthetase. T 95.44
TIGR03250472 PhnAcAld_DH putative phosphonoacetaldehyde dehydro 94.91
PLN02174484 aldehyde dehydrogenase family 3 member H1 94.07
PF00171462 Aldedh: Aldehyde dehydrogenase family; InterPro: I 93.75
COG0151 428 PurD Phosphoribosylamine-glycine ligase [Nucleotid 92.88
PLN02766501 coniferyl-aldehyde dehydrogenase 92.79
PRK119041038 bifunctional proline dehydrogenase/pyrroline-5-car 92.64
PRK11905 1208 bifunctional proline dehydrogenase/pyrroline-5-car 92.45
PRK11809 1318 putA trifunctional transcriptional regulator/proli 91.68
TIGR03374472 ABALDH 1-pyrroline dehydrogenase. Members of this 90.4
COG1012472 PutA NAD-dependent aldehyde dehydrogenases [Energy 87.62
PRK13805 862 bifunctional acetaldehyde-CoA/alcohol dehydrogenas 87.52
cd07086478 ALDH_F7_AASADH-like NAD+-dependent alpha-aminoadip 86.95
PRK09847494 gamma-glutamyl-gamma-aminobutyraldehyde dehydrogen 86.94
PLN02419604 methylmalonate-semialdehyde dehydrogenase [acylati 86.86
TIGR02288551 PaaN_2 phenylacetic acid degradation protein paaN. 86.78
PRK15398465 aldehyde dehydrogenase EutE; Provisional 86.78
cd07131478 ALDH_AldH-CAJ73105 Uncharacterized Candidatus kuen 85.99
TIGR01722477 MMSDH methylmalonic acid semialdehyde dehydrogenas 85.69
cd06534367 ALDH-SF NAD(P)+-dependent aldehyde dehydrogenase s 84.73
TIGR02299488 HpaE 5-carboxymethyl-2-hydroxymuconate semialdehyd 83.91
cd07101454 ALDH_SSADH2_GabD2 Mycobacterium tuberculosis succi 83.53
TIGR00407398 proA gamma-glutamyl phosphate reductase. The prosi 83.19
cd07098465 ALDH_F15-22 Aldehyde dehydrogenase family 15A1 and 81.52
cd07121429 ALDH_EutE Ethanolamine utilization protein EutE-li 81.46
>COG0014 ProA Gamma-glutamyl phosphate reductase [Amino acid transport and metabolism] Back     alignment and domain information 
Probab=99.97  E-value=5.1e-32  Score=240.95  Aligned_cols=100  Identities=29%  Similarity=0.363  Sum_probs=91.0

Q ss_pred             hhhhhccCCCCCchhHhhhhhCCcEEEcCcchhhhhcCCCCCccchHHhhccceeehhhhhcHHHHHHhHhhhCCCCccc
Q psy11678         13 QMQYSKFSPGHNLSGFDKEKQDVVKVYAGPNLTKKLTFGPPPAKSMKTEYGSLECAIEVVGDLQEAVDHIHTYGSSHTDV   92 (165)
Q Consensus        13 ~~~a~~~lp~~~~~l~~~L~~~gV~l~~d~~~~~~l~~~pa~~~dl~~Eyl~l~~avkvV~~l~eAI~HIn~ygS~Htea   92 (165)
                      +.||+.|||+|    .+.|.++||++|||++++++++-                        .              ...
T Consensus       266 ~~ia~~fLp~l----~~~l~~~gvelr~d~~~~~~~~~------------------------~--------------~~~  303 (417)
T COG0014         266 RAIAKSFLPKL----ANALQEAGVELRGDAEALALLPD------------------------A--------------VKP  303 (417)
T ss_pred             HHHHHHhHHHH----HHHHHhcCeEEEcCHHHHHhccc------------------------c--------------CCC
Confidence            56999999999    99999999999999999987631                        0              034


Q ss_pred             ccccccccccccceeeEEEcCCHHHHHHHHHHhcCCCceeEEeccc---------CCccceeccccchhhH
Q psy11678         93 ISAKSMKTEYGSLECAIEVVGDLQEAVDHIHTYGSSHTDVIVTENA---------RDSKCDYPAACNAMET  154 (165)
Q Consensus        93 IiteD~~tEyl~~~~~vk~V~~~~eAi~hI~~~gs~Hte~IiT~~~---------~dsa~v~~Na~~~~~~  154 (165)
                      +.++||++||||++++||+|+|+|+||+|||+|||+|||+|+|+|+         +|||+|||||||||+-
T Consensus       304 A~e~Dw~tEyLd~ilavkvVd~ld~AI~HIn~y~S~HsdaIiTe~~~~a~~F~~~VDSAaVyvNASTRFtD  374 (417)
T COG0014         304 ATEEDWDTEYLDLILAVKVVDSLDEAIAHINTYGSGHSDAIITEDYANAERFVNEVDSAAVYVNASTRFTD  374 (417)
T ss_pred             CchhhHHHHhhhheeEEEEeCCHHHHHHHHHHhCCCCCcceeeCCHHHHHHHHhhcchheEEEeccccccc
Confidence            5889999999999999999999999999999999999999999999         5999999999999973

>KOG4165|consensus Back     alignment and domain information
>COG0014 ProA Gamma-glutamyl phosphate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG4165|consensus Back     alignment and domain information
>TIGR02518 EutH_ACDH acetaldehyde dehydrogenase (acetylating) Back     alignment and domain information
>TIGR00407 proA gamma-glutamyl phosphate reductase Back     alignment and domain information
>PRK13805 bifunctional acetaldehyde-CoA/alcohol dehydrogenase; Provisional Back     alignment and domain information
>PRK15398 aldehyde dehydrogenase EutE; Provisional Back     alignment and domain information
>PRK00197 proA gamma-glutamyl phosphate reductase; Provisional Back     alignment and domain information
>cd07121 ALDH_EutE Ethanolamine utilization protein EutE-like Back     alignment and domain information
>PLN02418 delta-1-pyrroline-5-carboxylate synthase Back     alignment and domain information
>TIGR01092 P5CS delta l-pyrroline-5-carboxylate synthetase Back     alignment and domain information
>cd07079 ALDH_F18-19_ProA-GPR Gamma-glutamyl phosphate reductase (GPR), aldehyde dehydrogenase families 18 and 19 Back     alignment and domain information
>cd07131 ALDH_AldH-CAJ73105 Uncharacterized Candidatus kuenenia aldehyde dehydrogenase AldH (CAJ73105)-like Back     alignment and domain information
>cd07090 ALDH_F9_TMBADH NAD+-dependent 4-trimethylaminobutyraldehyde dehydrogenase, ALDH family 9A1 Back     alignment and domain information
>TIGR01722 MMSDH methylmalonic acid semialdehyde dehydrogenase Back     alignment and domain information
>cd07125 ALDH_PutA-P5CDH Delta(1)-pyrroline-5-carboxylate dehydrogenase, PutA Back     alignment and domain information
>cd06534 ALDH-SF NAD(P)+-dependent aldehyde dehydrogenase superfamily Back     alignment and domain information
>cd07122 ALDH_F20_ACDH Coenzyme A acylating aldehyde dehydrogenase (ACDH), ALDH family 20-like Back     alignment and domain information
>cd07147 ALDH_F21_RNP123 Aldehyde dehydrogenase family 21A1-like Back     alignment and domain information
>cd07115 ALDH_HMSADH_HapE Pseudomonas fluorescens 4-hydroxymuconic semialdehyde dehydrogenase-like Back     alignment and domain information
>TIGR02299 HpaE 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase Back     alignment and domain information
>cd07106 ALDH_AldA-AAD23400 Streptomyces aureofaciens putative aldehyde dehydrogenase AldA (AAD23400)-like Back     alignment and domain information
>PRK09847 gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase; Provisional Back     alignment and domain information
>cd07108 ALDH_MGR_2402 Magnetospirillum NAD(P)+-dependent aldehyde dehydrogenase MSR-1-like Back     alignment and domain information
>cd07144 ALDH_ALD2-YMR170C Saccharomyces cerevisiae aldehyde dehydrogenase 2 (YMR170c)-like Back     alignment and domain information
>TIGR01804 BADH glycine betaine aldehyde dehydrogenase Back     alignment and domain information
>cd07081 ALDH_F20_ACDH_EutE-like Coenzyme A acylating aldehyde dehydrogenase (ACDH), Ethanolamine utilization protein EutE, and related proteins Back     alignment and domain information
>cd07148 ALDH_RL0313 Uncharacterized ALDH ( RL0313) with similarity to Tortula ruralis aldehyde dehydrogenase ALDH21A1 Back     alignment and domain information
>TIGR03216 OH_muco_semi_DH 2-hydroxymuconic semialdehyde dehydrogenase Back     alignment and domain information
>cd07101 ALDH_SSADH2_GabD2 Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 2-like Back     alignment and domain information
>PLN00412 NADP-dependent glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03240 arg_catab_astD succinylglutamic semialdehyde dehydrogenase Back     alignment and domain information
>cd07085 ALDH_F6_MMSDH Methylmalonate semialdehyde dehydrogenase and ALDH family members 6A1 and 6B2 Back     alignment and domain information
>cd07102 ALDH_EDX86601 Uncharacterized aldehyde dehydrogenase of Synechococcus sp Back     alignment and domain information
>cd07143 ALDH_AldA_AN0554 Aspergillus nidulans aldehyde dehydrogenase, AldA (AN0554)-like Back     alignment and domain information
>cd07150 ALDH_VaniDH_like Pseudomonas putida vanillin dehydrogenase-like Back     alignment and domain information
>cd07088 ALDH_LactADH-AldA Escherichia coli lactaldehyde dehydrogenase AldA-like Back     alignment and domain information
>cd07091 ALDH_F1-2_Ald2-like ALDH subfamily: ALDH families 1and 2, including 10-formyltetrahydrofolate dehydrogenase, NAD+-dependent retinal dehydrogenase 1 and related proteins Back     alignment and domain information
>cd07092 ALDH_ABALDH-YdcW Escherichia coli NAD+-dependent gamma-aminobutyraldehyde dehydrogenase YdcW-like Back     alignment and domain information
>cd07114 ALDH_DhaS Uncharacterized Candidatus pelagibacter aldehyde dehydrogenase, DhaS-like Back     alignment and domain information
>cd07135 ALDH_F14-YMR110C Saccharomyces cerevisiae aldehyde dehydrogenase family 14 and related proteins Back     alignment and domain information
>cd07132 ALDH_F3AB Aldehyde dehydrogenase family 3 members A1, A2, and B1 and related proteins Back     alignment and domain information
>cd07099 ALDH_DDALDH Methylomonas sp Back     alignment and domain information
>cd07111 ALDH_F16 Aldehyde dehydrogenase family 16A1-like Back     alignment and domain information
>cd07093 ALDH_F8_HMSADH Human aldehyde dehydrogenase family 8 member A1-like Back     alignment and domain information
>cd07104 ALDH_BenzADH-like ALDH subfamily: NAD(P)+-dependent benzaldehyde dehydrogenase II, vanillin dehydrogenase, p-hydroxybenzaldehyde dehydrogenase and related proteins Back     alignment and domain information
>PRK13252 betaine aldehyde dehydrogenase; Provisional Back     alignment and domain information
>cd07086 ALDH_F7_AASADH-like NAD+-dependent alpha-aminoadipic semialdehyde dehydrogenase and related proteins Back     alignment and domain information
>cd07120 ALDH_PsfA-ACA09737 Pseudomonas putida aldehyde dehydrogenase PsfA (ACA09737)-like Back     alignment and domain information
>cd07077 ALDH-like NAD(P)+-dependent aldehyde dehydrogenase-like (ALDH-like) family Back     alignment and domain information
>cd07094 ALDH_F21_LactADH-like ALDH subfamily: NAD+-dependent, lactaldehyde dehydrogenase, ALDH family 21 A1, and related proteins Back     alignment and domain information
>cd07109 ALDH_AAS00426 Uncharacterized Saccharopolyspora spinosa aldehyde dehydrogenase (AAS00426)-like Back     alignment and domain information
>TIGR01238 D1pyr5carbox3 delta-1-pyrroline-5-carboxylate dehydrogenase (PutA C-terminal domain) Back     alignment and domain information
>PLN02466 aldehyde dehydrogenase family 2 member Back     alignment and domain information
>cd07103 ALDH_F5_SSADH_GabD Mitochondrial succinate-semialdehyde dehydrogenase and ALDH family members 5A1 and 5F1-like Back     alignment and domain information
>cd07130 ALDH_F7_AASADH NAD+-dependent alpha-aminoadipic semialdehyde dehydrogenase, ALDH family members 7A1 and 7B Back     alignment and domain information
>PRK13473 gamma-aminobutyraldehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK10090 aldehyde dehydrogenase A; Provisional Back     alignment and domain information
>PRK09407 gabD2 succinic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>cd07082 ALDH_F11_NP-GAPDH NADP+-dependent non-phosphorylating glyceraldehyde 3-phosphate dehydrogenase and ALDH family 11 Back     alignment and domain information
>cd07137 ALDH_F3FHI Plant aldehyde dehydrogenase family 3 members F1, H1, and I1 and related proteins Back     alignment and domain information
>cd07149 ALDH_y4uC Uncharacterized ALDH (y4uC) with similarity to Tortula ruralis aldehyde dehydrogenase ALDH21A1 Back     alignment and domain information
>cd07145 ALDH_LactADH_F420-Bios Methanocaldococcus jannaschii NAD+-dependent lactaldehyde dehydrogenase-like Back     alignment and domain information
>cd07146 ALDH_PhpJ Streptomyces putative phosphonoformaldehyde dehydrogenase PhpJ-like Back     alignment and domain information
>cd07118 ALDH_SNDH Gluconobacter oxydans L-sorbosone dehydrogenase-like Back     alignment and domain information
>cd07078 ALDH NAD(P)+ dependent aldehyde dehydrogenase family Back     alignment and domain information
>cd07138 ALDH_CddD_SSP0762 Rhodococcus ruber 6-oxolauric acid dehydrogenase-like Back     alignment and domain information
>cd07097 ALDH_KGSADH-YcbD Bacillus subtilis NADP+-dependent alpha-ketoglutaric semialdehyde dehydrogenase ycbD-like Back     alignment and domain information
>cd07139 ALDH_AldA-Rv0768 Mycobacterium tuberculosis aldehyde dehydrogenase AldA-like Back     alignment and domain information
>cd07116 ALDH_ACDHII-AcoD Ralstonia eutrophus NAD+-dependent acetaldehyde dehydrogenase II-like Back     alignment and domain information
>PRK13968 putative succinate semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>cd07152 ALDH_BenzADH NAD-dependent benzaldehyde dehydrogenase II-like Back     alignment and domain information
>cd07119 ALDH_BADH-GbsA Bacillus subtilis NAD+-dependent betaine aldehyde dehydrogenase-like Back     alignment and domain information
>cd07113 ALDH_PADH_NahF Escherichia coli NAD+-dependent phenylacetaldehyde dehydrogenase PadA-like Back     alignment and domain information
>cd07112 ALDH_GABALDH-PuuC Escherichia coli NADP+-dependent gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase PuuC-like Back     alignment and domain information
>cd07110 ALDH_F10_BADH Arabidopsis betaine aldehyde dehydrogenase 1 and 2, ALDH family 10A8 and 10A9-like Back     alignment and domain information
>cd07098 ALDH_F15-22 Aldehyde dehydrogenase family 15A1 and 22A1-like Back     alignment and domain information
>cd07136 ALDH_YwdH-P39616 Bacillus subtilis aldehyde dehydrogenase ywdH-like Back     alignment and domain information
>cd07559 ALDH_ACDHII_AcoD-like Ralstonia eutrophus NAD+-dependent acetaldehyde dehydrogenase II and Staphylococcus aureus AldA1 (SACOL0154)-like Back     alignment and domain information
>PTZ00381 aldehyde dehydrogenase family protein; Provisional Back     alignment and domain information
>cd07142 ALDH_F2BC Arabidosis aldehyde dehydrogenase family 2 B4, B7, C4-like Back     alignment and domain information
>cd07133 ALDH_CALDH_CalB Coniferyl aldehyde dehydrogenase-like Back     alignment and domain information
>cd07083 ALDH_P5CDH ALDH subfamily NAD+-dependent delta(1)-pyrroline-5-carboxylate dehydrogenase-like Back     alignment and domain information
>cd07087 ALDH_F3-13-14_CALDH-like ALDH subfamily: Coniferyl aldehyde dehydrogenase, ALDH families 3, 13, and 14, and other related proteins Back     alignment and domain information
>cd07151 ALDH_HBenzADH NADP+-dependent p-hydroxybenzaldehyde dehydrogenase-like Back     alignment and domain information
>cd07107 ALDH_PhdK-like Nocardioides 2-carboxybenzaldehyde dehydrogenase, PhdK-like Back     alignment and domain information
>cd07089 ALDH_CddD-AldA-like Rhodococcus ruber 6-oxolauric acid dehydrogenase-like and related proteins Back     alignment and domain information
>PLN02467 betaine aldehyde dehydrogenase Back     alignment and domain information
>cd07117 ALDH_StaphAldA1 Uncharacterized Staphylococcus aureus AldA1 (SACOL0154) aldehyde dehydrogenase-like Back     alignment and domain information
>cd07124 ALDH_PutA-P5CDH-RocA Delta(1)-pyrroline-5-carboxylate dehydrogenase, RocA Back     alignment and domain information
>PLN02315 aldehyde dehydrogenase family 7 member Back     alignment and domain information
>PLN02278 succinic semialdehyde dehydrogenase Back     alignment and domain information
>PRK09406 gabD1 succinic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>cd07134 ALDH_AlkH-like Pseudomonas putida Aldehyde dehydrogenase AlkH-like Back     alignment and domain information
>cd07105 ALDH_SaliADH Salicylaldehyde dehydrogenase, DoxF-like Back     alignment and domain information
>PRK09457 astD succinylglutamic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>cd07141 ALDH_F1AB_F2_RALDH1 NAD+-dependent retinal dehydrogenase 1, ALDH families 1A, 1B, and 2-like Back     alignment and domain information
>cd07100 ALDH_SSADH1_GabD1 Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 1-like Back     alignment and domain information
>TIGR01237 D1pyr5carbox2 delta-1-pyrroline-5-carboxylate dehydrogenase, group 2, putative Back     alignment and domain information
>TIGR02518 EutH_ACDH acetaldehyde dehydrogenase (acetylating) Back     alignment and domain information
>PLN02203 aldehyde dehydrogenase Back     alignment and domain information
>PLN02418 delta-1-pyrroline-5-carboxylate synthase Back     alignment and domain information
>PRK03137 1-pyrroline-5-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>cd07095 ALDH_SGSD_AstD N-succinylglutamate 5-semialdehyde dehydrogenase, AstD-like Back     alignment and domain information
>TIGR01092 P5CS delta l-pyrroline-5-carboxylate synthetase Back     alignment and domain information
>TIGR03250 PhnAcAld_DH putative phosphonoacetaldehyde dehydrogenase Back     alignment and domain information
>PLN02174 aldehyde dehydrogenase family 3 member H1 Back     alignment and domain information
>PF00171 Aldedh: Aldehyde dehydrogenase family; InterPro: IPR015590 Aldehyde dehydrogenases (1 Back     alignment and domain information
>COG0151 PurD Phosphoribosylamine-glycine ligase [Nucleotide transport and metabolism] Back     alignment and domain information
>PLN02766 coniferyl-aldehyde dehydrogenase Back     alignment and domain information
>PRK11904 bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>PRK11905 bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>PRK11809 putA trifunctional transcriptional regulator/proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR03374 ABALDH 1-pyrroline dehydrogenase Back     alignment and domain information
>COG1012 PutA NAD-dependent aldehyde dehydrogenases [Energy production and conversion] Back     alignment and domain information
>PRK13805 bifunctional acetaldehyde-CoA/alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd07086 ALDH_F7_AASADH-like NAD+-dependent alpha-aminoadipic semialdehyde dehydrogenase and related proteins Back     alignment and domain information
>PRK09847 gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase; Provisional Back     alignment and domain information
>PLN02419 methylmalonate-semialdehyde dehydrogenase [acylating] Back     alignment and domain information
>TIGR02288 PaaN_2 phenylacetic acid degradation protein paaN Back     alignment and domain information
>PRK15398 aldehyde dehydrogenase EutE; Provisional Back     alignment and domain information
>cd07131 ALDH_AldH-CAJ73105 Uncharacterized Candidatus kuenenia aldehyde dehydrogenase AldH (CAJ73105)-like Back     alignment and domain information
>TIGR01722 MMSDH methylmalonic acid semialdehyde dehydrogenase Back     alignment and domain information
>cd06534 ALDH-SF NAD(P)+-dependent aldehyde dehydrogenase superfamily Back     alignment and domain information
>TIGR02299 HpaE 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase Back     alignment and domain information
>cd07101 ALDH_SSADH2_GabD2 Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 2-like Back     alignment and domain information
>TIGR00407 proA gamma-glutamyl phosphate reductase Back     alignment and domain information
>cd07098 ALDH_F15-22 Aldehyde dehydrogenase family 15A1 and 22A1-like Back     alignment and domain information
>cd07121 ALDH_EutE Ethanolamine utilization protein EutE-like Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query165
2h5g_A463 Crystal Structure Of Human Pyrroline-5-carboxylate 1e-16
2h5g_A 463 Crystal Structure Of Human Pyrroline-5-carboxylate 7e-08
4ghk_A444 X-Ray Crystal Structure Of Gamma-Glutamyl Phosphate 2e-04
1o20_A427 Crystal Structure Of Gamma-glutamyl Phosphate Reduc 4e-04
>pdb|2H5G|A Chain A, Crystal Structure Of Human Pyrroline-5-carboxylate Synthetase Length = 463 Back     alignment and structure 
Iteration: 1

 Score = 82.4 bits (202), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 47/66 (71%)
Query: 28  FDKEKQDVVKVYAGPNLTKKLTFGPPPAKSMKTEYGSLECAIEVVGDLQEAVDHIHTYGS 87
            D  + + VK++AGP     LTF P   KS++TEYG LE  IEVV ++Q+A+DHIH YGS
Sbjct: 302 IDXLRVEQVKIHAGPKFASYLTFSPSEVKSLRTEYGDLELCIEVVDNVQDAIDHIHKYGS 361
Query: 88  SHTDVI 93
           SHTDVI
Sbjct: 362 SHTDVI 367
>pdb|2H5G|A Chain A, Crystal Structure Of Human Pyrroline-5-carboxylate Synthetase Length = 463 Back     alignment and structure
>pdb|4GHK|A Chain A, X-Ray Crystal Structure Of Gamma-Glutamyl Phosphate Reductase From Burkholderia Thailandensis Length = 444 Back     alignment and structure
>pdb|1O20|A Chain A, Crystal Structure Of Gamma-glutamyl Phosphate Reductase (tm0293) From Thermotoga Maritima At 2.00 A Resolution Length = 427 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query165
2h5g_A463 Delta 1-pyrroline-5-carboxylate synthetase; dehydr 1e-17
2h5g_A463 Delta 1-pyrroline-5-carboxylate synthetase; dehydr 1e-17
2h5g_A 463 Delta 1-pyrroline-5-carboxylate synthetase; dehydr 8e-09
1vlu_A468 Gamma-glutamyl phosphate reductase; YOR323C, struc 1e-15
1vlu_A468 Gamma-glutamyl phosphate reductase; YOR323C, struc 2e-12
1vlu_A 468 Gamma-glutamyl phosphate reductase; YOR323C, struc 6e-08
1o20_A427 Gamma-glutamyl phosphate reductase; TM0293, struct 2e-14
1o20_A427 Gamma-glutamyl phosphate reductase; TM0293, struct 3e-11
1o20_A 427 Gamma-glutamyl phosphate reductase; TM0293, struct 4e-05
>2h5g_A Delta 1-pyrroline-5-carboxylate synthetase; dehydrogenase, structural genomics, structural genomics CONS SGC, oxidoreductase; 2.25A {Homo sapiens} Length = 463 Back     alignment and structure
 Score = 78.0 bits (193), Expect = 1e-17
 Identities = 36/58 (62%), Positives = 44/58 (75%)

Query: 36  VKVYAGPNLTKKLTFGPPPAKSMKTEYGSLECAIEVVGDLQEAVDHIHTYGSSHTDVI 93
           VK++AGP     LTF P   KS++TEYG LE  IEVV ++Q+A+DHIH YGSSHTDVI
Sbjct: 310 VKIHAGPKFASYLTFSPSEVKSLRTEYGDLELCIEVVDNVQDAIDHIHKYGSSHTDVI 367
>2h5g_A Delta 1-pyrroline-5-carboxylate synthetase; dehydrogenase, structural genomics, structural genomics CONS SGC, oxidoreductase; 2.25A {Homo sapiens} Length = 463 Back     alignment and structure
>2h5g_A Delta 1-pyrroline-5-carboxylate synthetase; dehydrogenase, structural genomics, structural genomics CONS SGC, oxidoreductase; 2.25A {Homo sapiens} Length = 463 Back     alignment and structure
>1vlu_A Gamma-glutamyl phosphate reductase; YOR323C, structural GENO JCSG, protein structure initiative, PSI, joint center for S genomics; 2.29A {Saccharomyces cerevisiae} SCOP: c.82.1.1 Length = 468 Back     alignment and structure
>1vlu_A Gamma-glutamyl phosphate reductase; YOR323C, structural GENO JCSG, protein structure initiative, PSI, joint center for S genomics; 2.29A {Saccharomyces cerevisiae} SCOP: c.82.1.1 Length = 468 Back     alignment and structure
>1vlu_A Gamma-glutamyl phosphate reductase; YOR323C, structural GENO JCSG, protein structure initiative, PSI, joint center for S genomics; 2.29A {Saccharomyces cerevisiae} SCOP: c.82.1.1 Length = 468 Back     alignment and structure
>1o20_A Gamma-glutamyl phosphate reductase; TM0293, structural genom JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: c.82.1.1 Length = 427 Back     alignment and structure
>1o20_A Gamma-glutamyl phosphate reductase; TM0293, structural genom JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: c.82.1.1 Length = 427 Back     alignment and structure
>1o20_A Gamma-glutamyl phosphate reductase; TM0293, structural genom JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: c.82.1.1 Length = 427 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query165
4ghk_A444 Gamma-glutamyl phosphate reductase; structural gen 98.05
1o20_A427 Gamma-glutamyl phosphate reductase; TM0293, struct 97.97
2h5g_A463 Delta 1-pyrroline-5-carboxylate synthetase; dehydr 97.95
3k9d_A464 LMO1179 protein, aldehyde dehydrogenase; structura 97.93
1vlu_A468 Gamma-glutamyl phosphate reductase; YOR323C, struc 97.72
3k2w_A497 Betaine-aldehyde dehydrogenase; structural genomic 97.61
4dng_A485 Uncharacterized aldehyde dehydrogenase ALDY; struc 97.47
3rh9_A506 Succinate-semialdehyde dehydrogenase (NAD(P)(+)); 97.47
3ros_A484 NAD-dependent aldehyde dehydrogenase; nysgrc, PSI- 97.47
3ty7_A478 Putative aldehyde dehydrogenase SAV2122; structura 97.44
2ve5_A490 BADH, betaine aldehyde dehydrogenase; aldehyde oxi 97.43
3lns_A457 Benzaldehyde dehydrogenase; oxidoreductase, NADP+, 97.42
3my7_A452 Alcohol dehydrogenase/acetaldehyde dehydrogenase; 97.42
3etf_A462 Putative succinate-semialdehyde dehydrogenase; cen 97.38
3v4c_A528 Aldehyde dehydrogenase (NADP+); structural genomic 97.37
3r64_A508 NAD dependent benzaldehyde dehydrogenase; structur 97.35
4e4g_A521 Methylmalonate-semialdehyde dehydrogenase; structu 97.33
3ju8_A490 Succinylglutamic semialdehyde dehydrogenase; alpha 97.31
3r31_A517 BADH, betaine aldehyde dehydrogenase; structural g 97.3
2w8n_A487 Succinate-semialdehyde dehydrogenase, mitochondria 97.28
3jz4_A481 Succinate-semialdehyde dehydrogenase [NADP+]; tetr 97.24
3u4j_A528 NAD-dependent aldehyde dehydrogenase; PSI-biology, 97.24
2d4e_A515 5-carboxymethyl-2-hydroxymuconate semialdehyde deh 97.16
1wnd_A495 Putative betaine aldehyde dehydrogenase; NADH, flu 97.11
1t90_A486 MMSDH, probable methylmalonate-semialdehyde dehydr 97.1
3sza_A469 Aldehyde dehydrogenase, dimeric NADP-preferring; A 97.09
1uzb_A516 1-pyrroline-5-carboxylate dehydrogenase; oxidoredu 97.08
1bxs_A501 Aldehyde dehydrogenase; retinal, class 1, tetramer 97.07
1o04_A500 Aldehyde dehydrogenase, mitochondrial precursor; A 97.06
1euh_A475 NADP dependent non phosphorylating glyceraldehyde- 96.98
3b4w_A495 Aldehyde dehydrogenase; RV0223C-NAD complex, struc 96.96
1a4s_A503 ALDH, betaine aldehyde dehydrogenase; oxidoreducta 96.95
2imp_A479 Lactaldehyde dehydrogenase; protein-lactate-NADH t 96.9
3prl_A505 NADP-dependent glyceraldehyde-3-phosphate dehydro; 96.86
1uxt_A501 Glyceraldehyde-3-phosphate dehydrogenase (NADP+); 96.82
1ez0_A510 ALDH, aldehyde dehydrogenase; nucleotide binding d 96.82
3iwj_A503 Putative aminoaldehyde dehydrogenase; rossmann fol 96.81
2wme_A490 BADH, betaine aldehyde dehydrogenase; aldehyde oxi 96.79
2y53_A534 Aldehyde dehydrogenase (BOX pathway); oxidoreducta 96.69
2j6l_A500 Aldehyde dehydrogenase family 7 member A1; NAD, re 96.67
3haz_A1001 Proline dehydrogenase; proline utilization A, PUTA 96.67
3ek1_A504 Aldehyde dehydrogenase; ssgcid, oxidoreductase, st 96.65
3qan_A538 1-pyrroline-5-carboxylate dehydrogenase 1; proline 96.65
3pqa_A486 Lactaldehyde dehydrogenase; structural genomics, p 96.63
3ifg_A484 Succinate-semialdehyde dehydrogenase (NADP+); niai 96.5
4f9i_A1026 Proline dehydrogenase/delta-1-pyrroline-5-carboxy 96.39
3ed6_A520 Betaine aldehyde dehydrogenase; structural genomic 96.36
4h7n_A474 Aldehyde dehydrogenase; structural genomics, PSI-b 96.35
3i44_A497 Aldehyde dehydrogenase; oxidoreductase, structural 96.13
4f3x_A498 Putative aldehyde dehydrogenase; structural genomi 95.91
1vlu_A468 Gamma-glutamyl phosphate reductase; YOR323C, struc 95.65
2h5g_A463 Delta 1-pyrroline-5-carboxylate synthetase; dehydr 95.65
2o2p_A517 Formyltetrahydrofolate dehydrogenase; aldehyde deh 95.57
4e3x_A563 Delta-1-pyrroline-5-carboxylate dehydrogenase, mit 93.9
3ty7_A478 Putative aldehyde dehydrogenase SAV2122; structura 92.5
3lns_A457 Benzaldehyde dehydrogenase; oxidoreductase, NADP+, 91.86
3v4c_A528 Aldehyde dehydrogenase (NADP+); structural genomic 91.01
3u4j_A528 NAD-dependent aldehyde dehydrogenase; PSI-biology, 90.52
3k2w_A497 Betaine-aldehyde dehydrogenase; structural genomic 88.08
3etf_A462 Putative succinate-semialdehyde dehydrogenase; cen 86.93
3b4w_A495 Aldehyde dehydrogenase; RV0223C-NAD complex, struc 86.61
3jz4_A481 Succinate-semialdehyde dehydrogenase [NADP+]; tetr 83.45
3ros_A484 NAD-dependent aldehyde dehydrogenase; nysgrc, PSI- 83.01
1a4s_A503 ALDH, betaine aldehyde dehydrogenase; oxidoreducta 82.79
3rh9_A506 Succinate-semialdehyde dehydrogenase (NAD(P)(+)); 82.64
4dng_A485 Uncharacterized aldehyde dehydrogenase ALDY; struc 81.61
>4ghk_A Gamma-glutamyl phosphate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.25A {Burkholderia thailandensis} Back     alignment and structure
Probab=98.05  E-value=6.5e-06  Score=72.76  Aligned_cols=104  Identities=24%  Similarity=0.243  Sum_probs=78.0

Q ss_pred             chhhhhccCCCCCchhHhhhhhCCcEEEcCcchhhhhcCCCCCccchHHhhccceeehhhhhcHHHHHHhHhhhCCCCcc
Q psy11678         12 PQMQYSKFSPGHNLSGFDKEKQDVVKVYAGPNLTKKLTFGPPPAKSMKTEYGSLECAIEVVGDLQEAVDHIHTYGSSHTD   91 (165)
Q Consensus        12 ~~~~a~~~lp~~~~~l~~~L~~~gV~l~~d~~~~~~l~~~pa~~~dl~~Eyl~l~~avkvV~~l~eAI~HIn~ygS~Hte   91 (165)
                      ++.++++|+..+    .+++++.++.+.|||....+++-..        .                        |  -..
T Consensus       288 ~~~i~d~f~~~l----~~~~~~~~~~~~g~p~~~~~i~~a~--------~------------------------G--~~~  329 (444)
T 4ghk_A          288 ARGIAPAVLSPL----GRLYREKGVELRVDADARAVLEAAG--------V------------------------G--PLV  329 (444)
T ss_dssp             EGGGHHHHHHHH----HHHHHHTTCEEEECHHHHHHHHHTT--------C------------------------C--CCE
T ss_pred             eHHHHHHHHHHH----HHHHHHcCCeecCCHHHHHHHHhcc--------c------------------------C--ccc
Confidence            467899999888    8888888888888887654432000        0                        0  000


Q ss_pred             cccccccccccccceeeEEEcCCHHHHHHHHHHhcCCCceeEEeccc---------CCccceeccccchhh
Q psy11678         92 VISAKSMKTEYGSLECAIEVVGDLQEAVDHIHTYGSSHTDVIVTENA---------RDSKCDYPAACNAME  153 (165)
Q Consensus        92 aIiteD~~tEyl~~~~~vk~V~~~~eAi~hI~~~gs~Hte~IiT~~~---------~dsa~v~~Na~~~~~  153 (165)
                      ......|..|...+++.|..++|+||||+++|....|++-+|.|+|.         .++..|+||.++.|.
T Consensus       330 ~~~~~~~~eEiFGPVl~v~~~~~~deAi~~aN~~~~gL~a~v~t~d~~~a~~~a~~l~aG~V~vN~~~~~~  400 (444)
T 4ghk_A          330 DATDEDWRTEYLAPVLAIKIVDGIDAAIEHINEYGSHHTDAIVTEDHDRAMRFLREVDSASVMVNASTRFA  400 (444)
T ss_dssp             ECCSGGGTCC---CEEEEEEESSHHHHHHHHHHHSCSSEEEEECSBHHHHHHHHHHCCSSEEEEEECGGGC
T ss_pred             CCCchhhhccccCceEEEEEeCCHHHHHHHHHhCCCCceEEEEeCCHHHHHHHHHhCCcceEEEcCCCccC
Confidence            11234578899999999999999999999999999999999999998         399999999998763
>1o20_A Gamma-glutamyl phosphate reductase; TM0293, structural genom JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: c.82.1.1 Back     alignment and structure
>2h5g_A Delta 1-pyrroline-5-carboxylate synthetase; dehydrogenase, structural genomics, structural genomics CONS SGC, oxidoreductase; 2.25A {Homo sapiens} Back     alignment and structure
>3k9d_A LMO1179 protein, aldehyde dehydrogenase; structural genomics, PSI-2, protein initiative; 2.00A {Listeria monocytogenes} Back     alignment and structure
>1vlu_A Gamma-glutamyl phosphate reductase; YOR323C, structural GENO JCSG, protein structure initiative, PSI, joint center for S genomics; 2.29A {Saccharomyces cerevisiae} SCOP: c.82.1.1 Back     alignment and structure
>3k2w_A Betaine-aldehyde dehydrogenase; structural genomics, PSI-2, protein initiative; 1.90A {Pseudoalteromonas atlantica T6C} Back     alignment and structure
>4dng_A Uncharacterized aldehyde dehydrogenase ALDY; structural genomics, protein structure initiative, nysgrc, P biology; 2.50A {Bacillus subtilis} Back     alignment and structure
>3rh9_A Succinate-semialdehyde dehydrogenase (NAD(P)(+)); structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.63A {Marinobacter aquaeolei} Back     alignment and structure
>3ros_A NAD-dependent aldehyde dehydrogenase; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Lactobacillus acidophilus} Back     alignment and structure
>3ty7_A Putative aldehyde dehydrogenase SAV2122; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 2.40A {Staphylococcus aureus} Back     alignment and structure
>3lns_A Benzaldehyde dehydrogenase; oxidoreductase, NADP+, class 3 aldehyde dehyd adduct, covalent catalysis, mandelate racemase pathway; HET: ZBZ NAP; 2.50A {Pseudomonas putida} PDB: 3lv1_A* Back     alignment and structure
>3my7_A Alcohol dehydrogenase/acetaldehyde dehydrogenase; ACDH, PSI, MCSG, structural genomics, midwest center for STR genomics; 2.30A {Vibrio parahaemolyticus} Back     alignment and structure
>3etf_A Putative succinate-semialdehyde dehydrogenase; center for ST genomics of infectious diseases, oxidoreductase, csgid; 1.85A {Salmonella typhimurium} PDB: 3efv_A Back     alignment and structure
>3v4c_A Aldehyde dehydrogenase (NADP+); structural genomics, PSI-biology, nysgrc, NEW YORK structura genomics research consortium; HET: PE4; 1.91A {Sinorhizobium meliloti} Back     alignment and structure
>3r64_A NAD dependent benzaldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.57A {Corynebacterium glutamicum} Back     alignment and structure
>4e4g_A Methylmalonate-semialdehyde dehydrogenase; structural genomics, protein structure INI nysgrc, PSI-biology; 2.90A {Sinorhizobium meliloti} Back     alignment and structure
>3ju8_A Succinylglutamic semialdehyde dehydrogenase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: NAD; 1.82A {Pseudomonas aeruginosa} Back     alignment and structure
>3r31_A BADH, betaine aldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>2w8n_A Succinate-semialdehyde dehydrogenase, mitochondrial; mitochondrion, oxidoreductase, transit peptide, disease mutation, SSA, NAD, ssadh; 2.00A {Homo sapiens} PDB: 2w8o_A 2w8p_A 2w8q_A 2w8r_A* Back     alignment and structure
>3jz4_A Succinate-semialdehyde dehydrogenase [NADP+]; tetramer, NADP binding, oxidoreductase; HET: NAP; 2.30A {Escherichia coli} Back     alignment and structure
>3u4j_A NAD-dependent aldehyde dehydrogenase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, tetramer; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>2d4e_A 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase; HPCC; HET: NAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>1wnd_A Putative betaine aldehyde dehydrogenase; NADH, fluorescence, kinetics, oxidor; 2.10A {Escherichia coli} SCOP: c.82.1.1 PDB: 1wnb_A Back     alignment and structure
>1t90_A MMSDH, probable methylmalonate-semialdehyde dehydrogenase; oxidoreductase, NAD; HET: NAD; 2.50A {Bacillus subtilis} Back     alignment and structure
>3sza_A Aldehyde dehydrogenase, dimeric NADP-preferring; ALDH, rossmann fold, oxidoreductase; 1.48A {Homo sapiens} SCOP: c.82.1.1 PDB: 3szb_A* 1ad3_A* Back     alignment and structure
>1uzb_A 1-pyrroline-5-carboxylate dehydrogenase; oxidoreductase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.4A {Thermus thermophilus} SCOP: c.82.1.1 PDB: 2eiw_A 2bhq_A* 2bhp_A* 2bja_A* 2bjk_A* 2ehq_A* 2ehu_A* 2eii_A* 2eit_A* 2ej6_A 2ejd_A* 2ejl_A 2iy6_A* 2j40_A* 2j5n_A* Back     alignment and structure
>1bxs_A Aldehyde dehydrogenase; retinal, class 1, tetramer, NAD, cytosolic, oxidoreductase; HET: NAD; 2.35A {Ovis aries} SCOP: c.82.1.1 PDB: 1o9j_A* 1bi9_A* Back     alignment and structure
>1o04_A Aldehyde dehydrogenase, mitochondrial precursor; ALDH, NAD, NADH, isomerization, oxidoreductase; HET: NAD; 1.42A {Homo sapiens} SCOP: c.82.1.1 PDB: 1nzw_A* 3inl_A* 3n80_A* 1nzz_A* 1o00_A* 1nzx_A* 1o01_A* 1o05_A 1of7_A* 1o02_A* 3inj_A* 3sz9_A* 1zum_A 2onm_A* 2onp_A* 2onn_A 2ono_A* 3n81_A 3n82_A* 3n83_A* ... Back     alignment and structure
>1euh_A NADP dependent non phosphorylating glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase; 1.82A {Streptococcus mutans} SCOP: c.82.1.1 PDB: 1qi6_A 2euh_A* 2id2_A* 2qe0_A* 2esd_A* 1qi1_A* Back     alignment and structure
>3b4w_A Aldehyde dehydrogenase; RV0223C-NAD complex, structural genomics, PSI-2, protein STR initiative; HET: NAD GOL; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>1a4s_A ALDH, betaine aldehyde dehydrogenase; oxidoreductase, aldehyde oxidation; 2.10A {Gadus callarias} SCOP: c.82.1.1 PDB: 1bpw_A* Back     alignment and structure
>2imp_A Lactaldehyde dehydrogenase; protein-lactate-NADH ternary complex, oxidoreductase; HET: NAI; 2.10A {Escherichia coli} PDB: 2ilu_A* 2hg2_A* 2opx_A* Back     alignment and structure
>3prl_A NADP-dependent glyceraldehyde-3-phosphate dehydro; structural genomics, protein structure initiative, dehydroge PSI-biology; 2.00A {Bacillus halodurans} PDB: 3rhh_A* Back     alignment and structure
>1uxt_A Glyceraldehyde-3-phosphate dehydrogenase (NADP+); GAPN, ALDH, glucose 1-phosphate, glycolysis, regulation, catatysis, oxidoreductase; HET: G1P NAD; 2.2A {Thermoproteus tenax} SCOP: c.82.1.1 PDB: 1uxp_A* 1uxq_A* 1uxr_A* 1uxn_A* 1uxu_A* 1uxv_A* 1ky8_A* Back     alignment and structure
>1ez0_A ALDH, aldehyde dehydrogenase; nucleotide binding domain, NADP+, oxidoreductase; HET: NAP; 2.10A {Vibrio harveyi} SCOP: c.82.1.1 PDB: 1eyy_A* Back     alignment and structure
>3iwj_A Putative aminoaldehyde dehydrogenase; rossmann fold, dimer, betaine aldehyde dehydrogenase, NAD, oxidoreductase; HET: NAD; 2.15A {Pisum sativum} SCOP: c.82.1.0 PDB: 3iwk_A* 4a0m_A* Back     alignment and structure
>2wme_A BADH, betaine aldehyde dehydrogenase; aldehyde oxidation, NAD, NADP complex, oxidoreductase; HET: NAP CSO; 2.10A {Pseudomonas aeruginosa} PDB: 2wox_A* 3zqa_A* 2xdr_A* Back     alignment and structure
>2y53_A Aldehyde dehydrogenase (BOX pathway); oxidoreductase, NADP, nucleotide-binding; HET: NAP; 1.40A {Burkholderia xenovorans LB400} PDB: 2y52_A 2y51_A 2vro_A* 2y5d_A* Back     alignment and structure
>2j6l_A Aldehyde dehydrogenase family 7 member A1; NAD, reductase, oxidoreductase, lysine catabolism; HET: NAI; 1.3A {Homo sapiens} PDB: 2jg7_A* Back     alignment and structure
>3haz_A Proline dehydrogenase; proline utilization A, PUTA, flavoenzyme, 1-pyrroline-5-carboxylate dehydrogenase, oxidoreductase; HET: FAD NAD; 2.10A {Bradyrhizobium japonicum usda 110} Back     alignment and structure
>3ek1_A Aldehyde dehydrogenase; ssgcid, oxidoreductase, structural genomics; HET: MES; 2.10A {Brucella melitensis biovar ABORTUS2308} Back     alignment and structure
>3qan_A 1-pyrroline-5-carboxylate dehydrogenase 1; proline oxidation, redox control, apoptosis, NAD binding, oxidoreductase, PSI-biology; 1.95A {Bacillus halodurans} PDB: 3rjl_A Back     alignment and structure
>3pqa_A Lactaldehyde dehydrogenase; structural genomics, protein structure initiative, nysgrc, P biology, oxidoreductase; 1.50A {Methanocaldococcus jannaschii} PDB: 3rhd_A* Back     alignment and structure
>3ifg_A Succinate-semialdehyde dehydrogenase (NADP+); niaid,.infectious disease, ssgcid, seattle structural genomi for infectious disease; 2.70A {Burkholderia pseudomallei} PDB: 3ifh_Q Back     alignment and structure
>4f9i_A Proline dehydrogenase/delta-1-pyrroline-5-carboxy dehydrogenase; proline utilization A, PUTA, flavoenzyme, structural genomic biology; HET: FAD MES; 2.20A {Geobacter sulfurreducens} Back     alignment and structure
>3ed6_A Betaine aldehyde dehydrogenase; structural genomics, infecti deseases, NAD, oxidoreductase, PSI; 1.70A {Staphylococcus aureus} PDB: 3fg0_A* Back     alignment and structure
>4h7n_A Aldehyde dehydrogenase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, ALDH_ddaldh, COG1012, glyco_hydro_97; 2.00A {Anabaena variabilis} Back     alignment and structure
>3i44_A Aldehyde dehydrogenase; oxidoreductase, structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.00A {Bartonella henselae} Back     alignment and structure
>4f3x_A Putative aldehyde dehydrogenase; structural genomics, protein structure initiative, nysgrc, P biology; HET: MSE NAD; 2.01A {Sinorhizobium meliloti} PDB: 4dal_A* Back     alignment and structure
>1vlu_A Gamma-glutamyl phosphate reductase; YOR323C, structural GENO JCSG, protein structure initiative, PSI, joint center for S genomics; 2.29A {Saccharomyces cerevisiae} SCOP: c.82.1.1 Back     alignment and structure
>2h5g_A Delta 1-pyrroline-5-carboxylate synthetase; dehydrogenase, structural genomics, structural genomics CONS SGC, oxidoreductase; 2.25A {Homo sapiens} Back     alignment and structure
>2o2p_A Formyltetrahydrofolate dehydrogenase; aldehyde dehydrogenase, FDH, oxidoreductase; 1.70A {Rattus norvegicus} PDB: 2o2q_A* 2o2r_A* 3rho_A* 3rhm_A* 3rhj_A* 3rhq_A* 3rhp_A* 3rhr_A* 3rhl_A* Back     alignment and structure
>4e3x_A Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial; amino acid metabolism, proline inhibition, oxidoreductase; HET: 16P PGE; 1.24A {Mus musculus} PDB: 3v9k_A* 3v9l_A* 3v9j_A* 3v9g_A 3v9h_A 3v9i_A Back     alignment and structure
>3ty7_A Putative aldehyde dehydrogenase SAV2122; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 2.40A {Staphylococcus aureus} Back     alignment and structure
>3lns_A Benzaldehyde dehydrogenase; oxidoreductase, NADP+, class 3 aldehyde dehyd adduct, covalent catalysis, mandelate racemase pathway; HET: ZBZ NAP; 2.50A {Pseudomonas putida} PDB: 3lv1_A* Back     alignment and structure
>3v4c_A Aldehyde dehydrogenase (NADP+); structural genomics, PSI-biology, nysgrc, NEW YORK structura genomics research consortium; HET: PE4; 1.91A {Sinorhizobium meliloti} Back     alignment and structure
>3u4j_A NAD-dependent aldehyde dehydrogenase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, tetramer; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>3k2w_A Betaine-aldehyde dehydrogenase; structural genomics, PSI-2, protein initiative; 1.90A {Pseudoalteromonas atlantica T6C} Back     alignment and structure
>3etf_A Putative succinate-semialdehyde dehydrogenase; center for ST genomics of infectious diseases, oxidoreductase, csgid; 1.85A {Salmonella typhimurium} PDB: 3efv_A Back     alignment and structure
>3b4w_A Aldehyde dehydrogenase; RV0223C-NAD complex, structural genomics, PSI-2, protein STR initiative; HET: NAD GOL; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3jz4_A Succinate-semialdehyde dehydrogenase [NADP+]; tetramer, NADP binding, oxidoreductase; HET: NAP; 2.30A {Escherichia coli} Back     alignment and structure
>3ros_A NAD-dependent aldehyde dehydrogenase; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Lactobacillus acidophilus} Back     alignment and structure
>1a4s_A ALDH, betaine aldehyde dehydrogenase; oxidoreductase, aldehyde oxidation; 2.10A {Gadus callarias} SCOP: c.82.1.1 PDB: 1bpw_A* Back     alignment and structure
>3rh9_A Succinate-semialdehyde dehydrogenase (NAD(P)(+)); structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.63A {Marinobacter aquaeolei} Back     alignment and structure
>4dng_A Uncharacterized aldehyde dehydrogenase ALDY; structural genomics, protein structure initiative, nysgrc, P biology; 2.50A {Bacillus subtilis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 165
d1vlua_436 c.82.1.1 (A:) Gamma-glutamyl phosphate reductase { 7e-11
d1vlua_436 c.82.1.1 (A:) Gamma-glutamyl phosphate reductase { 3e-09
d1o20a_414 c.82.1.1 (A:) Gamma-glutamyl phosphate reductase { 2e-06
d1o20a_414 c.82.1.1 (A:) Gamma-glutamyl phosphate reductase { 7e-05
>d1vlua_ c.82.1.1 (A:) Gamma-glutamyl phosphate reductase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 436 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: ALDH-like
superfamily: ALDH-like
family: ALDH-like
domain: Gamma-glutamyl phosphate reductase
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 57.2 bits (137), Expect = 7e-11
 Identities = 19/47 (40%), Positives = 27/47 (57%)

Query: 91  DVISAKSMKTEYGSLECAIEVVGDLQEAVDHIHTYGSSHTDVIVTEN 137
           D    +    E+ SL+ A + V   + A+ HI+T+ S HTD IVTEN
Sbjct: 319 DADEEQDFDKEFLSLDLAAKFVTSTESAIQHINTHSSRHTDAIVTEN 365
>d1vlua_ c.82.1.1 (A:) Gamma-glutamyl phosphate reductase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 436 Back     information, alignment and structure
>d1o20a_ c.82.1.1 (A:) Gamma-glutamyl phosphate reductase {Thermotoga maritima [TaxId: 2336]} Length = 414 Back     information, alignment and structure
>d1o20a_ c.82.1.1 (A:) Gamma-glutamyl phosphate reductase {Thermotoga maritima [TaxId: 2336]} Length = 414 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query165
d1vlua_436 Gamma-glutamyl phosphate reductase {Baker's yeast 99.8
d1o20a_414 Gamma-glutamyl phosphate reductase {Thermotoga mar 98.8
d1vlua_436 Gamma-glutamyl phosphate reductase {Baker's yeast 98.56
d1euha_474 Aldehyde reductase (dehydrogenase), ALDH {Streptoc 97.75
d1ad3a_446 Aldehyde reductase (dehydrogenase), ALDH {Rat (Rat 97.7
d1a4sa_503 Aldehyde reductase (dehydrogenase), ALDH {Baltic c 97.12
d1wnda_474 Putative betaine aldehyde dehydrogenase YdcW {Esch 97.07
d1bxsa_494 Aldehyde reductase (dehydrogenase), ALDH {Sheep (O 96.63
d1o04a_494 Aldehyde reductase (dehydrogenase), ALDH {Human (H 95.66
d1ky8a_499 Non-phosphorylating glyceraldehyde-3-phosphate deh 94.63
d1uzba_516 1-pyrroline-5-carboxylate dehydrogenase {Thermus t 93.85
d1ez0a_504 Aldehyde reductase (dehydrogenase), ALDH {Vibrio h 81.03
>d1vlua_ c.82.1.1 (A:) Gamma-glutamyl phosphate reductase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: ALDH-like
superfamily: ALDH-like
family: ALDH-like
domain: Gamma-glutamyl phosphate reductase
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.80  E-value=2.6e-21  Score=169.83  Aligned_cols=103  Identities=30%  Similarity=0.343  Sum_probs=68.4

Q ss_pred             HhhhhhCCcEEEcCcchhhhhcCCCCCccchHHhhccceeehhhhhcHHHHHHhHhhhCCCCccccccccccccccccee
Q psy11678         28 FDKEKQDVVKVYAGPNLTKKLTFGPPPAKSMKTEYGSLECAIEVVGDLQEAVDHIHTYGSSHTDVISAKSMKTEYGSLEC  107 (165)
Q Consensus        28 ~~~L~~~gV~l~~d~~~~~~l~~~pa~~~dl~~Eyl~l~~avkvV~~l~eAI~HIn~ygS~HteaIiteD~~tEyl~~~~  107 (165)
                      ...|.++||++++|+........      .+. +..          ....+..      ..-.....++||.+||+++++
T Consensus       279 ~~~~~~~gv~l~~~~~~~~~~~~------~~~-~~~----------~~~~~~~------~~~~~~~~~~d~~~E~l~pvl  335 (436)
T d1vlua_         279 ENLTLEGGVTIHATKDLKTAYFD------KLN-ELG----------KLTEAIQ------CKTVDADEEQDFDKEFLSLDL  335 (436)
T ss_dssp             HHHHHHHCCCBEECHHHHHHHHH------HHH-HHT----------CCCHHHH------TTBC-------------CCCC
T ss_pred             HHHHHhCCcEEEeCHHHHHHhhh------hhh-hcc----------ccccccc------ccccCCCcccchhhhhhCcce
Confidence            78888999999999988765420      000 000          0000000      011233467899999999999


Q ss_pred             eEEEcCCHHHHHHHHHHhcCCCceeEEeccc---------CCccceeccccchhh
Q psy11678        108 AIEVVGDLQEAVDHIHTYGSSHTDVIVTENA---------RDSKCDYPAACNAME  153 (165)
Q Consensus       108 ~vk~V~~~~eAi~hI~~~gs~Hte~IiT~~~---------~dsa~v~~Na~~~~~  153 (165)
                      +|+.|+|+||||+|||+||+|||++|+|+|.         .||++|||||||||+
T Consensus       336 ~v~~v~~~eEAI~~in~~g~ghta~I~T~d~~~a~~F~~~vda~~V~vNasTrf~  390 (436)
T d1vlua_         336 AAKFVTSTESAIQHINTHSSRHTDAIVTENKANAEKFMKGVDSSGVYWNASTRFA  390 (436)
T ss_dssp             EEEECCSHHHHHHHHTTSCSSCEEEEECSCHHHHHHHHHHCCCSEEEESSCGGGC
T ss_pred             eEEEECCHHHHHHHHHHhCCCCceEEEECCHHHHHHHHHhCCceEEEEcCCCccC
Confidence            9999999999999999999999999999999         499999999999995
>d1o20a_ c.82.1.1 (A:) Gamma-glutamyl phosphate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vlua_ c.82.1.1 (A:) Gamma-glutamyl phosphate reductase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1euha_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1ad3a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a4sa_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Baltic cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1wnda_ c.82.1.1 (A:) Putative betaine aldehyde dehydrogenase YdcW {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bxsa_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1o04a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d1ky8a_ c.82.1.1 (A:) Non-phosphorylating glyceraldehyde-3-phosphate dehydrogenase GapN {Archaeon Thermoproteus tenax [TaxId: 2271]} Back     information, alignment and structure
>d1uzba_ c.82.1.1 (A:) 1-pyrroline-5-carboxylate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ez0a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure