Psyllid ID: psy11761


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------20
MFTQTPNLVLFSQQTLLCIHGNDNAYKCHQCQRLIFLSANAGVHKCEYCHKVFDQQSSLLSHNCPQMKPRPYKCDTCEKSFTNSQNLNTHQLIHSGIRPFKCTTCDKSFVNQINPTSTHTPTYTKSNLAQHSCMNSHFPKPYQCDRCSQFFGDRMNLISHHCHKHKQSCLPFISRLFGFDDGDKVAKFSGRVVDTPNQ
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccccccHHHHHHHHHHHHHcccccccccccccccEcccccccEEEccccccEEccHHHHHHHcHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEcccccHHHEHEEEccccHHEEHEEEEccccccccccHccccEccccHHHHHHHHcccccccccccccccccHccccEccccHHHHHccc
mftqtpnlvlFSQQTLLCihgndnaykchqcqrLIFLsanagvhkceycHKVFdqqssllshncpqmkprpykcdtceksftnsqnlnthqlihsgirpfkcttcdksfvnqinptsthtptytksnlaqhscmnshfpkpyqcdrcsqffgdrmnlishhchkhkqsclpfisrlfgfddgdkvakfsgrvvdtpnq
mftqtpnlvLFSQQTLLCIHGNDNAYKCHQCQRLIFLSANAGVHKCEYCHKVFDQQSSLLSHNCPQMKPRPYKCDTCEKSFTNSQNLNTHQLIHSGIRPFKCTTCDKSFVNQINPTSTHTPTYTKSNLAQHSCMNSHFPKPYQCDRCSQFFGDRMNLISHHCHKHKQSCLPFISRLFGFDDGDKVAKfsgrvvdtpnq
MFTQTPNLVLFSQQTLLCIHGNDNAYKCHQCQRLIFLSANAGVHKCEYCHKVFDQQSSLLSHNCPQMKPRPYKCDTCEKSFTNSQNLNTHQLIHSGIRPFKCTTCDKSFVNQINPTSTHTPTYTKSNLAQHSCMNSHFPKPYQCDRCSQFFGDRMNLISHHCHKHKQSCLPFISRLFGFDDGDKVAKFSGRVVDTPNQ
******NLVLFSQQTLLCIHGNDNAYKCHQCQRLIFLSANAGVHKCEYCHKVFDQQSSLLSHNC******PYKCDTCEKSFTNSQNLNTHQLIHSGIRPFKCTTCDKSFVNQINPTSTH**TYTKSNLAQHSCMNSHFPKPYQCDRCSQFFGDRMNLISHHCHKHKQSCLPFISRLFGFDDGDKVAKF**********
MFTQTPNLVLFSQQTLLCIHGNDNAYKCHQCQRLIFLSANAGVHKCEYCHKVFDQQSSLLSHNCPQMKPRPYKCDTCEKSFTNSQNLNTHQLIHSGIRPFKCTTCDKSFVNQINPTSTHTPTYTKSNLAQHSCMNSHFPKPYQCDRCSQFFGDRMNLISHHCHKHKQSCLPFISRLFGFDDGDKVAKFSG*V******
MFTQTPNLVLFSQQTLLCIHGNDNAYKCHQCQRLIFLSANAGVHKCEYCHKVFDQQSSLLSHNCPQMKPRPYKCDTCEKSFTNSQNLNTHQLIHSGIRPFKCTTCDKSFVNQINPTSTHTPTYTKSNLAQHSCMNSHFPKPYQCDRCSQFFGDRMNLISHHCHKHKQSCLPFISRLFGFDDGDKVAKFSGRVVDTPNQ
****TPNLVLFSQQTLLCIHGNDNAYKCHQCQRLIFLSANAGVHKCEYCHKVFDQQSSLLSHNCPQMKPRPYKCDTCEKSFTNSQNLNTHQLIHSGIRPFKCTTCDKSFVNQINPTSTHTPTYTKSNLAQHSCMNSHFPKPYQCDRCSQFFGDRMNLISHHCHKHKQSCLPFISRLFGFDDGDKVAKFS*********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFTQTPNLVLFSQQTLLCIHGNDNAYKCHQCQRLIFLSANAGVHKCEYCHKVFDQQSSLLSHNCPQMKPRPYKCDTCEKSFTNSQNLNTHQLIHSGIRPFKCTTCDKSFVNQINPTSTHTPTYTKSNLAQHSCMNSHFPKPYQCDRCSQFFGDRMNLISHHCHKHKQSCLPFISRLFGFDDGDKVAKFSGRVVDTPNQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query198 2.2.26 [Sep-21-2011]
Q8N823705 Zinc finger protein 611 O yes N/A 0.681 0.191 0.351 7e-20
A6NNF4738 Zinc finger protein 726 O no N/A 0.676 0.181 0.339 6e-19
Q86V71674 Zinc finger protein 429 O no N/A 0.722 0.212 0.316 2e-18
A8MTY0619 Putative zinc finger prot no N/A 0.772 0.247 0.317 4e-18
Q6ZNA1 936 Zinc finger protein 836 O no N/A 0.767 0.162 0.324 6e-18
Q68DY1528 Zinc finger protein 626 O no N/A 0.707 0.265 0.333 7e-18
Q03923 595 Zinc finger protein 85 OS no N/A 0.707 0.235 0.325 9e-18
Q8TF32576 Zinc finger protein 431 O no N/A 0.712 0.244 0.323 1e-17
Q9HCG1 818 Zinc finger protein 160 O no N/A 0.646 0.156 0.342 1e-17
Q9NV72465 Zinc finger protein 701 O no N/A 0.717 0.305 0.329 1e-17
>sp|Q8N823|ZN611_HUMAN Zinc finger protein 611 OS=Homo sapiens GN=ZNF611 PE=2 SV=2 Back     alignment and function desciption
 Score = 97.1 bits (240), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 57/162 (35%), Positives = 82/162 (50%), Gaps = 27/162 (16%)

Query: 13  QQTLLC---IHGNDNAYKCHQCQRLIFLSANAGVH----------KCEYCHKVFDQQSSL 59
           + +L+C   +HG + +YKC  C +    S+    H          KC  C K F Q S L
Sbjct: 438 KSSLVCHHRLHGGEKSYKCKVCDKAFVWSSQLAKHTRIDCGEKPYKCNECGKTFGQNSDL 497

Query: 60  LSHNCPQMKPRPYKCDTCEKSFTNSQNLNTHQLIHSGIRPFKCTTCDKSFVNQINPTSTH 119
           L H       +PYKCD CEK F+   +L TH++ H+G +P+KC  CDK+F          
Sbjct: 498 LIHKSIHTGEQPYKCDECEKVFSRKSSLETHKIGHTGEKPYKCKVCDKAFA--------- 548

Query: 120 TPTYTKSNLAQHSCMNSHFPKPYQCDRCSQFFGDRMNLISHH 161
                 S LA+H+ ++S   KPY+C+ CS+ F  R  L+ HH
Sbjct: 549 ----CHSYLAKHTRIHS-GEKPYKCNECSKTFSHRSYLVCHH 585




May be involved in transcriptional regulation.
Homo sapiens (taxid: 9606)
>sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=3 Back     alignment and function description
>sp|Q86V71|ZN429_HUMAN Zinc finger protein 429 OS=Homo sapiens GN=ZNF429 PE=2 SV=2 Back     alignment and function description
>sp|A8MTY0|ZN724_HUMAN Putative zinc finger protein 724 OS=Homo sapiens GN=ZNF724P PE=5 SV=3 Back     alignment and function description
>sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 Back     alignment and function description
>sp|Q68DY1|ZN626_HUMAN Zinc finger protein 626 OS=Homo sapiens GN=ZNF626 PE=2 SV=2 Back     alignment and function description
>sp|Q03923|ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens GN=ZNF85 PE=2 SV=3 Back     alignment and function description
>sp|Q8TF32|ZN431_HUMAN Zinc finger protein 431 OS=Homo sapiens GN=ZNF431 PE=2 SV=2 Back     alignment and function description
>sp|Q9HCG1|ZN160_HUMAN Zinc finger protein 160 OS=Homo sapiens GN=ZNF160 PE=2 SV=3 Back     alignment and function description
>sp|Q9NV72|ZN701_HUMAN Zinc finger protein 701 OS=Homo sapiens GN=ZNF701 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query198
358417009 1448 PREDICTED: LOW QUALITY PROTEIN: zinc fin 0.767 0.104 0.324 2e-18
296477336 699 TPA: zinc finger protein 107 [Bos taurus 0.772 0.218 0.322 3e-18
410054428 813 PREDICTED: LOW QUALITY PROTEIN: zinc fin 0.681 0.166 0.351 3e-18
21757193 705 unnamed protein product [Homo sapiens] 0.681 0.191 0.351 3e-18
239787080 705 zinc finger protein 611 isoform a [Homo 0.681 0.191 0.351 4e-18
239787086 636 zinc finger protein 611 isoform b [Homo 0.681 0.212 0.351 4e-18
50949560 598 hypothetical protein [Homo sapiens] 0.681 0.225 0.351 5e-18
296477354 691 TPA: zinc finger protein 347-like [Bos t 0.722 0.206 0.341 7e-18
344243619 629 Zinc finger protein 160 [Cricetulus gris 0.717 0.225 0.345 1e-17
327281828 876 PREDICTED: zinc finger protein 268-like 0.777 0.175 0.362 1e-17
>gi|358417009|ref|XP_002702020.2| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein 91, partial [Bos taurus] Back     alignment and taxonomy information
 Score = 98.2 bits (243), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 60/185 (32%), Positives = 87/185 (47%), Gaps = 33/185 (17%)

Query: 2   FTQTPNLVLFSQQTLLCIHGNDNAYKCHQCQRLIFLSANAGVH----------KCEYCHK 51
           F++T NL +  +     +H  +  YKC  C +   +S+N  VH          KC+ C K
Sbjct: 755 FSRTGNLTVHRR-----VHTGEKPYKCDMCGKAFRVSSNLAVHQRVHTGEKPYKCDVCGK 809

Query: 52  VFDQQSSLLSHNCPQMKPRPYKCDTCEKSFTNSQNLNTHQLIHSGIRPFKCTTCDKSFVN 111
            F Q + L  H       +PYKCD C K+F ++  L  HQ IH+G +P+KC  CDK+F++
Sbjct: 810 AFSQATGLAVHQRIHTGEKPYKCDVCGKAFNHTTRLQLHQRIHTGEKPYKCNVCDKAFIS 869

Query: 112 QINPTSTHTPTYT----------------KSNLAQHSCMNSHFPKPYQCDRCSQFFGDRM 155
             N  S H   +T                 SNL  H  +++   KPY+CD C + F    
Sbjct: 870 AAN-LSVHRKLHTGEKPYKCDICGKGFRVSSNLGIHRSVHT-GEKPYKCDVCGKAFSHTG 927

Query: 156 NLISH 160
           NL  H
Sbjct: 928 NLAVH 932




Source: Bos taurus

Species: Bos taurus

Genus: Bos

Family: Bovidae

Order:

Class: Mammalia

Phylum: Chordata

Superkingdom: Eukaryota

>gi|296477336|tpg|DAA19451.1| TPA: zinc finger protein 107 [Bos taurus] Back     alignment and taxonomy information
>gi|410054428|ref|XP_003316675.2| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein 611 [Pan troglodytes] Back     alignment and taxonomy information
>gi|21757193|dbj|BAC05052.1| unnamed protein product [Homo sapiens] Back     alignment and taxonomy information
>gi|239787080|ref|NP_112234.3| zinc finger protein 611 isoform a [Homo sapiens] gi|239787082|ref|NP_001154971.1| zinc finger protein 611 isoform a [Homo sapiens] gi|239787084|ref|NP_001154972.1| zinc finger protein 611 isoform a [Homo sapiens] gi|269849530|sp|Q8N823.2|ZN611_HUMAN RecName: Full=Zinc finger protein 611 gi|119592500|gb|EAW72094.1| zinc finger protein 611, isoform CRA_b [Homo sapiens] Back     alignment and taxonomy information
>gi|239787086|ref|NP_001154973.1| zinc finger protein 611 isoform b [Homo sapiens] gi|119592499|gb|EAW72093.1| zinc finger protein 611, isoform CRA_a [Homo sapiens] gi|193787141|dbj|BAG52347.1| unnamed protein product [Homo sapiens] gi|223459598|gb|AAI36344.1| ZNF611 protein [Homo sapiens] Back     alignment and taxonomy information
>gi|50949560|emb|CAH10596.1| hypothetical protein [Homo sapiens] Back     alignment and taxonomy information
>gi|296477354|tpg|DAA19469.1| TPA: zinc finger protein 347-like [Bos taurus] Back     alignment and taxonomy information
>gi|344243619|gb|EGV99722.1| Zinc finger protein 160 [Cricetulus griseus] Back     alignment and taxonomy information
>gi|327281828|ref|XP_003225647.1| PREDICTED: zinc finger protein 268-like [Anolis carolinensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query198
UNIPROTKB|Q8N823705 ZNF611 "Zinc finger protein 61 0.691 0.194 0.363 8.1e-22
UNIPROTKB|F1M3L0375 LOC100365021 "Protein LOC10036 0.717 0.378 0.349 1.9e-21
UNIPROTKB|F1LV11351 LOC100365021 "Protein LOC10036 0.646 0.364 0.348 6.3e-21
UNIPROTKB|F1M3T5454 LOC100365021 "Protein LOC10036 0.717 0.312 0.349 6.3e-21
UNIPROTKB|F1LT28545 LOC100365021 "Protein LOC10036 0.717 0.260 0.349 1.1e-20
UNIPROTKB|Q6ZNA1 936 ZNF836 "Zinc finger protein 83 0.767 0.162 0.340 1.2e-20
RGD|2319849 624 LOC100365021 "rCG64132-like" [ 0.717 0.227 0.349 1.6e-20
UNIPROTKB|A6NNF4738 ZNF726 "Zinc finger protein 72 0.702 0.188 0.339 2.2e-20
UNIPROTKB|F1MX341053 F1MX34 "Uncharacterized protei 0.767 0.144 0.324 5.1e-20
UNIPROTKB|F1SRB1522 ZNF502 "Uncharacterized protei 0.722 0.273 0.335 5.9e-20
UNIPROTKB|Q8N823 ZNF611 "Zinc finger protein 611" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 264 (98.0 bits), Expect = 8.1e-22, P = 8.1e-22
 Identities = 60/165 (36%), Positives = 86/165 (52%)

Query:    11 FSQQT-LLC---IHGNDNAYKCHQCQRLIFLSANAGVH----------KCEYCHKVFDQQ 56
             FS ++ L+C   +HG + +YKC  C +    S+    H          KC  C K F Q 
Sbjct:   435 FSHKSSLVCHHRLHGGEKSYKCKVCDKAFVWSSQLAKHTRIDCGEKPYKCNECGKTFGQN 494

Query:    57 SSLLSHNCPQMKPRPYKCDTCEKSFTNSQNLNTHQLIHSGIRPFKCTTCDKSFVNQINPT 116
             S LL H       +PYKCD CEK F+   +L TH++ H+G +P+KC  CDK+F       
Sbjct:   495 SDLLIHKSIHTGEQPYKCDECEKVFSRKSSLETHKIGHTGEKPYKCKVCDKAF------- 547

Query:   117 STHTPTYTKSNLAQHSCMNSHFPKPYQCDRCSQFFGDRMNLISHH 161
             + H      S LA+H+ ++S   KPY+C+ CS+ F  R  L+ HH
Sbjct:   548 ACH------SYLAKHTRIHSG-EKPYKCNECSKTFSHRSYLVCHH 585


GO:0008270 "zinc ion binding" evidence=IEA
GO:0003677 "DNA binding" evidence=IEA
GO:0006351 "transcription, DNA-dependent" evidence=IEA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
UNIPROTKB|F1M3L0 LOC100365021 "Protein LOC100365021" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1LV11 LOC100365021 "Protein LOC100365021" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1M3T5 LOC100365021 "Protein LOC100365021" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1LT28 LOC100365021 "Protein LOC100365021" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q6ZNA1 ZNF836 "Zinc finger protein 836" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|2319849 LOC100365021 "rCG64132-like" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|A6NNF4 ZNF726 "Zinc finger protein 726" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1MX34 F1MX34 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1SRB1 ZNF502 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query198
pfam1346526 pfam13465, zf-H2C2_2, Zinc-finger double domain 0.003
>gnl|CDD|222150 pfam13465, zf-H2C2_2, Zinc-finger double domain Back     alignment and domain information
 Score = 33.9 bits (78), Expect = 0.003
 Identities = 12/26 (46%), Positives = 16/26 (61%)

Query: 86  NLNTHQLIHSGIRPFKCTTCDKSFVN 111
           NL  H   H+G +P+KC  C KSF +
Sbjct: 1   NLRRHMRTHTGEKPYKCPVCGKSFSS 26


Length = 26

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 198
KOG2462|consensus279 99.93
KOG2462|consensus279 99.91
KOG3608|consensus467 99.83
KOG1074|consensus 958 99.79
KOG1074|consensus 958 99.69
KOG3608|consensus467 99.63
KOG3576|consensus267 99.62
KOG3576|consensus267 99.6
KOG3623|consensus1007 99.44
PLN03086567 PRLI-interacting factor K; Provisional 99.4
KOG3623|consensus1007 99.37
PHA00733128 hypothetical protein 99.07
PLN03086567 PRLI-interacting factor K; Provisional 98.94
KOG3993|consensus500 98.74
PHA00733128 hypothetical protein 98.67
PHA0276855 hypothetical protein; Provisional 98.64
PHA0276855 hypothetical protein; Provisional 98.51
PHA0061644 hypothetical protein 98.5
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.46
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.46
PHA0061644 hypothetical protein 98.09
KOG3993|consensus500 98.07
PHA0073279 hypothetical protein 98.03
PHA0073279 hypothetical protein 98.01
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.96
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.92
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.81
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.7
COG5189423 SFP1 Putative transcriptional repressor regulating 97.42
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.29
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 97.27
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.16
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.04
smart0035526 ZnF_C2H2 zinc finger. 96.9
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 96.82
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 96.62
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 96.57
COG5189423 SFP1 Putative transcriptional repressor regulating 96.53
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 96.4
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.23
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 95.87
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 95.83
smart0035526 ZnF_C2H2 zinc finger. 95.45
PRK04860160 hypothetical protein; Provisional 95.24
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 94.61
PRK04860160 hypothetical protein; Provisional 94.48
PRK1489059 putative Zn-ribbon RNA-binding protein; Provisiona 94.25
COG5048467 FOG: Zn-finger [General function prediction only] 94.18
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 94.05
COG288861 Predicted Zn-ribbon RNA-binding protein with a fun 94.0
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 93.94
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 93.77
PRK0039846 rpoP DNA-directed RNA polymerase subunit P; Provis 93.5
KOG2231|consensus 669 93.33
COG404965 Uncharacterized protein containing archaeal-type C 93.25
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 93.03
KOG2893|consensus 341 91.89
KOG2893|consensus 341 91.8
COG5048467 FOG: Zn-finger [General function prediction only] 91.74
COG199789 RPL43A Ribosomal protein L37AE/L43A [Translation, 91.18
PF0775424 DUF1610: Domain of unknown function (DUF1610); Int 91.09
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 90.93
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 90.77
KOG1146|consensus 1406 90.43
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 90.15
cd0072934 rubredoxin_SM Rubredoxin, Small Modular nonheme ir 89.92
PF09986214 DUF2225: Uncharacterized protein conserved in bact 89.12
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 89.02
PF1436935 zf-RING_3: zinc-finger 88.85
KOG4173|consensus253 88.51
smart0065944 RPOLCX RNA polymerase subunit CX. present in RNA p 88.11
PF0178090 Ribosomal_L37ae: Ribosomal L37ae protein family; I 87.95
COG199649 RPC10 DNA-directed RNA polymerase, subunit RPC10 ( 87.79
COG5236 493 Uncharacterized conserved protein, contains RING Z 87.3
KOG2231|consensus 669 85.94
PF0360432 DNA_RNApol_7kD: DNA directed RNA polymerase, 7 kDa 85.92
PF09986 214 DUF2225: Uncharacterized protein conserved in bact 85.51
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 85.47
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 85.43
COG1592166 Rubrerythrin [Energy production and conversion] 85.06
PTZ0025590 60S ribosomal protein L37a; Provisional 85.01
TIGR0028091 L37a ribosomal protein L37a. This model finds euka 84.25
PF14353128 CpXC: CpXC protein 84.17
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 84.15
KOG1146|consensus1406 83.96
KOG2186|consensus 276 83.87
smart0083441 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_C 83.28
PRK0397690 rpl37ae 50S ribosomal protein L37Ae; Reviewed 82.02
PF0972342 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR0134 82.01
TIGR02300129 FYDLN_acid conserved hypothetical protein TIGR0230 81.6
>KOG2462|consensus Back     alignment and domain information
Probab=99.93  E-value=7.8e-27  Score=174.20  Aligned_cols=124  Identities=33%  Similarity=0.619  Sum_probs=105.4

Q ss_pred             CCccccCcccchhhcccCCC-------------ceecCccccccCChhHHhhcccCCCCCCCccCccchhcccCchhHHH
Q psy11761         23 DNAYKCHQCQRLIFLSANAG-------------VHKCEYCHKVFDQQSSLLSHNCPQMKPRPYKCDTCEKSFTNSQNLNT   89 (198)
Q Consensus        23 ~~~~~C~~C~~~f~~~~~~~-------------~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~   89 (198)
                      ..-|+|+.||+.+.+.++|.             .+.|..|++.+.....|..|+++|+  .+..|.+||+.|+....|+-
T Consensus       128 ~~r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~--l~c~C~iCGKaFSRPWLLQG  205 (279)
T KOG2462|consen  128 HPRYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHT--LPCECGICGKAFSRPWLLQG  205 (279)
T ss_pred             CCceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccC--CCcccccccccccchHHhhc
Confidence            34588888998888877654             5678889998888888888888888  68888999999988888888


Q ss_pred             hhhhcCCCCcccCCcCchhhhcccCCCcccCCCcCcccccccccccccCCCCeeCCcchhhhcChhHHHhhhh
Q psy11761         90 HQLIHSGIRPFKCTTCDKSFVNQINPTSTHTPTYTKSNLAQHSCMNSHFPKPYQCDRCSQFFGDRMNLISHHC  162 (198)
Q Consensus        90 H~~~h~~~k~~~C~~C~~~f~~~~~~~~~~~~~~~~~~l~~H~~~~~~~~~~~~C~~C~k~f~~~~~L~~H~~  162 (198)
                      |+|+|+|||||.|+.|+++|.+             +++|+.|+.+|. +.|.|+|..|+|.|...+-|.+|..
T Consensus       206 HiRTHTGEKPF~C~hC~kAFAD-------------RSNLRAHmQTHS-~~K~~qC~~C~KsFsl~SyLnKH~E  264 (279)
T KOG2462|consen  206 HIRTHTGEKPFSCPHCGKAFAD-------------RSNLRAHMQTHS-DVKKHQCPRCGKSFALKSYLNKHSE  264 (279)
T ss_pred             ccccccCCCCccCCcccchhcc-------------hHHHHHHHHhhc-CCccccCcchhhHHHHHHHHHHhhh
Confidence            9999999999999999999988             888888988888 6788999999999988888888864



>KOG2462|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF07754 DUF1610: Domain of unknown function (DUF1610); InterPro: IPR011668 This domain is found in archaeal species Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>PF14369 zf-RING_3: zinc-finger Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>smart00659 RPOLCX RNA polymerase subunit CX Back     alignment and domain information
>PF01780 Ribosomal_L37ae: Ribosomal L37ae protein family; InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>PF03604 DNA_RNApol_7kD: DNA directed RNA polymerase, 7 kDa subunit; InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>COG1592 Rubrerythrin [Energy production and conversion] Back     alignment and domain information
>PTZ00255 60S ribosomal protein L37a; Provisional Back     alignment and domain information
>TIGR00280 L37a ribosomal protein L37a Back     alignment and domain information
>PF14353 CpXC: CpXC protein Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>KOG2186|consensus Back     alignment and domain information
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein Back     alignment and domain information
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed Back     alignment and domain information
>PF09723 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR013429 This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria Back     alignment and domain information
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query198
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 5e-13
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 3e-10
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 4e-09
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 4e-10
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 6e-09
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 1e-08
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 3e-04
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 7e-08
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 9e-08
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 2e-07
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 3e-07
2csh_A110 Solution Structure Of Tandem Repeat Of The Zf-C2h2 1e-06
2csh_A110 Solution Structure Of Tandem Repeat Of The Zf-C2h2 5e-04
2wbu_A90 Crystal Structure Of The Zinc Finger Domain Of Klf4 1e-06
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 1e-06
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 1e-06
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 2e-06
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 2e-06
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 2e-06
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 3e-06
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 5e-06
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 7e-06
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 7e-06
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 7e-06
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 8e-06
1x6e_A72 Solution Structures Of The C2h2 Type Zinc Finger Do 1e-05
1f2i_G73 Cocrystal Structure Of Selected Zinc Finger Dimer B 3e-05
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 3e-05
2gli_A155 Five-Finger GliDNA COMPLEX Length = 155 1e-04
2ena_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 1e-04
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 2e-04
1tf6_A190 Co-crystal Structure Of Xenopus Tfiiia Zinc Finger 3e-04
2lt7_A133 Solution Nmr Structure Of Kaiso Zinc Finger Dna Bin 4e-04
2eq1_A46 Solution Structure Of The 9th C2h2 Type Zinc Finger 4e-04
1llm_C88 Crystal Structure Of A Zif23-Gcn4 Chimera Bound To 5e-04
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 6e-04
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 6e-04
2eml_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 7e-04
2ep3_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 8e-04
2ep0_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 8e-04
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure

Iteration: 1

Score = 70.5 bits (171), Expect = 5e-13, Method: Compositional matrix adjust. Identities = 47/152 (30%), Positives = 65/152 (42%), Gaps = 24/152 (15%) Query: 19 IHGNDNAYKCHQCQRLIFLSANAGVH----------KCEYCHKVFDQQSSLLSHNCPQMK 68 H + YKC +C + + H KC C K F Q+++L +H Sbjct: 43 THTGEKPYKCPECGKSFSDKKDLTRHQRTHTGEKPYKCPECGKSFSQRANLRAHQRTHTG 102 Query: 69 PRPYKCDTCEKSFTNSQNLNTHQLIHSGIRPFKCTTCDKSFVNQINPTSTHTPTYTKSNL 128 +PY C C KSF+ +L HQ H+G +P+KC C KSF + N TH T+T Sbjct: 103 EKPYACPECGKSFSQLAHLRAHQRTHTGEKPYKCPECGKSFSREDN-LHTHQRTHTGE-- 159 Query: 129 AQHSCMNSHFPKPYQCDRCSQFFGDRMNLISH 160 KPY+C C + F R L H Sbjct: 160 -----------KPYKCPECGKSFSRRDALNVH 180
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|2CSH|A Chain A, Solution Structure Of Tandem Repeat Of The Zf-C2h2 Domains Of Human Zinc Finger Protein 297b Length = 110 Back     alignment and structure
>pdb|2CSH|A Chain A, Solution Structure Of Tandem Repeat Of The Zf-C2h2 Domains Of Human Zinc Finger Protein 297b Length = 110 Back     alignment and structure
>pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1X6E|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Zinc Finger Protein 24 Length = 72 Back     alignment and structure
>pdb|1F2I|G Chain G, Cocrystal Structure Of Selected Zinc Finger Dimer Bound To Dna Length = 73 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 Back     alignment and structure
>pdb|2ENA|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 311- 343) Of Human Zinc Finger Protein 224 Length = 46 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|1TF6|A Chain A, Co-crystal Structure Of Xenopus Tfiiia Zinc Finger Domain Bound To The 5s Ribosomal Rna Gene Internal Control Region Length = 190 Back     alignment and structure
>pdb|2LT7|A Chain A, Solution Nmr Structure Of Kaiso Zinc Finger Dna Binding Domain In Complex With Kaiso Binding Site Dna Length = 133 Back     alignment and structure
>pdb|2EQ1|A Chain A, Solution Structure Of The 9th C2h2 Type Zinc Finger Domain Of Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|1LLM|C Chain C, Crystal Structure Of A Zif23-Gcn4 Chimera Bound To Dna Length = 88 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|2EML|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 752- 784) Of Human Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure
>pdb|2EP3|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 631- 663) Of Human Zinc Finger Protein 484 Length = 46 Back     alignment and structure
>pdb|2EP0|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 528- 560) Of Human Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query198
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-19
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-16
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-16
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-08
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 8e-05
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 4e-19
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-18
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-14
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-09
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-08
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-18
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 8e-14
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 4e-04
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 9e-18
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 5e-16
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 9e-10
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 4e-05
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 7e-17
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 6e-14
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 4e-06
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 1e-04
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 1e-16
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 1e-12
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 1e-08
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 4e-16
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 4e-13
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 5e-12
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 2e-15
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 9e-06
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 3e-15
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 3e-13
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 1e-08
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 5e-15
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 9e-14
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 4e-09
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 5e-15
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 1e-14
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 3e-14
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 7e-08
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 6e-15
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-14
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-05
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 2e-14
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 3e-14
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 2e-10
1tf6_A190 Protein (transcription factor IIIA); complex (tran 6e-14
1tf6_A190 Protein (transcription factor IIIA); complex (tran 4e-13
1tf6_A190 Protein (transcription factor IIIA); complex (tran 6e-10
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 9e-14
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 3e-10
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 5e-05
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 2e-13
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 2e-12
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-13
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 9e-13
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 3e-09
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 2e-13
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 3e-09
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 9e-05
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 7e-13
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 1e-09
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 4e-06
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 9e-13
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 4e-10
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 5e-10
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-12
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 7e-10
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 2e-06
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 2e-12
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 6e-10
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 7e-12
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 2e-10
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 2e-08
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 8e-12
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 8e-08
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 1e-11
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 3e-10
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 8e-09
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 3e-11
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 1e-10
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 5e-07
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 3e-11
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 8e-05
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 9e-04
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 4e-11
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 1e-09
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 8e-08
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 1e-09
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 6e-04
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-09
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-09
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-09
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 7e-09
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-09
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-08
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-08
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-08
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-08
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-08
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-08
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-08
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-08
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-08
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-08
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-08
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-08
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-08
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-08
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 3e-08
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-08
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-08
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-08
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-08
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-08
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-08
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-08
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-08
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-08
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-08
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-08
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 5e-08
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-08
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-08
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-08
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-08
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-08
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 6e-08
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-08
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-08
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 7e-08
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 7e-04
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-08
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-08
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 8e-08
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-08
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 9e-08
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-07
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-07
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 1e-07
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 1e-07
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-07
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-07
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-07
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-07
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-07
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 1e-07
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-07
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-07
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-07
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 1e-07
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-07
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 1e-07
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-07
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-07
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-07
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-07
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-07
2epa_A72 Krueppel-like factor 10; transforming growth facto 2e-07
2epa_A72 Krueppel-like factor 10; transforming growth facto 5e-04
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-07
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-07
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-07
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-07
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-07
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-07
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 3e-07
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-07
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-07
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-07
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-07
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 3e-07
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-07
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 7e-07
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 7e-07
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 8e-07
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-06
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 1e-06
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-06
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-06
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 2e-06
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 3e-06
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 3e-06
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 3e-06
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 3e-06
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 5e-06
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 1e-05
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 3e-04
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 5e-05
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 7e-05
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 9e-05
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 1e-04
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 3e-04
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
 Score = 79.1 bits (196), Expect = 2e-19
 Identities = 35/125 (28%), Positives = 53/125 (42%), Gaps = 19/125 (15%)

Query: 45  KCEYCHKVFDQQSSLLSHNCPQMKPRPYKCDTCEKSFTNSQNLNTHQ---LIHSGIRPFK 101
           +C  CHK F  +  L  HN      +P++C  C K +   +NL  H+    ++   + F 
Sbjct: 9   ECPTCHKKFLSKYYLKVHNRKHTGEKPFECPKCGKCYFRKENLLEHEARNCMNRSEQVFT 68

Query: 102 CTTCDKSFVNQINPTSTHTPTYTKSNLAQHSCMNSHF-PKPYQCDRCSQFFGDRMNLISH 160
           C+ C ++F               +  L  H  M SH    PY+C  CSQ F  + +L SH
Sbjct: 69  CSVCQETFRR-------------RMELRLH--MVSHTGEMPYKCSSCSQQFMQKKDLQSH 113

Query: 161 HCHKH 165
               H
Sbjct: 114 MIKLH 118


>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query198
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.97
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.97
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.93
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.93
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.92
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.89
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.89
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.89
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.88
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.88
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.87
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.86
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.83
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.82
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.81
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.8
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.8
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.8
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.8
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.78
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.77
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.75
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.75
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.74
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.72
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.71
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.7
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.69
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.67
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.66
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.66
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.65
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.65
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.63
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.62
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.61
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.6
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.6
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.59
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.59
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.58
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.58
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.56
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.56
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.55
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.55
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.53
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.53
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.51
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.51
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.51
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.51
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.5
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.49
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.49
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.48
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.47
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.47
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.45
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.45
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.44
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.43
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.43
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.42
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.4
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.39
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.38
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.36
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.36
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.36
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.33
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.3
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.28
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.27
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.27
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.24
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.24
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.19
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.19
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.18
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.18
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.17
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.17
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.17
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.17
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.17
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.17
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.17
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.17
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.17
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.16
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.16
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.16
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.16
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.15
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.15
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.15
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.15
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.15
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.15
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.15
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.15
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.15
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.15
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.15
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.15
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.15
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.15
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.14
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.14
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.14
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.14
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.14
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.14
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.14
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.14
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.14
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.14
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.14
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.13
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.13
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.13
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.13
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.13
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.12
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.12
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.12
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.12
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.12
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.11
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.11
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.11
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.11
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.11
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.11
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.11
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.11
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.11
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.11
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.11
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.11
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.11
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.11
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.11
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.1
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.1
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.1
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.1
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.1
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.1
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.1
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.1
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.1
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.09
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.09
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.09
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.09
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.09
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.09
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.09
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.09
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.09
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.09
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.09
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.08
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.08
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.08
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.08
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.08
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.08
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.07
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.07
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.07
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.07
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.07
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.07
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.07
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.07
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.06
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.06
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.06
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.06
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.06
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.06
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.06
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.06
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.06
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.05
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.05
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.05
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.05
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.05
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.05
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.05
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.05
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.05
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.05
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.05
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.04
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.04
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.04
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.04
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.04
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.04
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.04
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.04
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.04
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.04
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.04
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.03
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.03
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.03
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.03
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.03
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.03
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.03
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.03
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.02
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.02
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.02
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.02
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.02
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.02
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.02
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.01
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.01
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.01
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.01
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.01
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.01
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.01
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.01
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.01
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.01
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.01
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.01
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.01
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.01
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.01
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.0
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.0
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.0
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.0
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.0
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.0
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.0
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.0
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.0
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.99
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.99
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.99
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.98
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.98
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.98
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.98
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.98
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.98
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.97
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.97
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.97
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.97
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.97
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.97
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.96
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.96
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.96
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.95
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.95
2epa_A72 Krueppel-like factor 10; transforming growth facto 98.93
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.93
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.92
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.92
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.92
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.92
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.91
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.91
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.91
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.89
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.89
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.89
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.88
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.88
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.88
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.87
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.87
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.87
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.87
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.84
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.82
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.78
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.78
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.75
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.74
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.7
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.7
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.7
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.68
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.67
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.66
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.64
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.64
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.56
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.53
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.52
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.52
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.52
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.5
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.5
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.5
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.49
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.48
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.46
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.45
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.42
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.42
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.4
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.39
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.38
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.38
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.37
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.37
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.36
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.35
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.33
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.33
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.3
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.29
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.28
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.27
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.27
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.6
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.27
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.26
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.26
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.24
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.55
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.2
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.2
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.19
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.18
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.18
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.17
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.17
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.16
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.15
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.13
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.13
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.38
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.06
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.04
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.02
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 97.97
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.9
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 97.89
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 97.87
1ard_A29 Yeast transcription factor ADR1; transcription reg 97.86
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.84
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 97.83
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.82
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.79
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.76
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 96.93
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 97.74
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 97.73
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 97.71
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 96.86
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.68
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.67
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 97.65
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 97.62
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 96.74
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.18
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 96.39
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 96.32
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 96.31
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 96.17
2e72_A49 POGO transposable element with ZNF domain; zinc fi 95.61
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 95.12
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 94.24
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 94.2
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 93.08
2yuc_A76 TNF receptor-associated factor 4; ZF-TRAF, cystein 92.93
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 91.38
2gmg_A105 Hypothetical protein PF0610; winged-helix like pro 91.03
1vq8_Z83 50S ribosomal protein L37AE; ribosome 50S, protein 90.47
3jyw_972 60S ribosomal protein L43; eukaryotic ribosome, RA 90.01
2e72_A49 POGO transposable element with ZNF domain; zinc fi 88.77
2k5c_A95 Uncharacterized protein PF0385; structural genomic 87.22
3j21_i83 50S ribosomal protein L37AE; archaea, archaeal, KI 86.19
3iz5_m92 60S ribosomal protein L43 (L37AE); eukaryotic ribo 85.8
3cc2_Z116 50S ribosomal protein L37AE, 50S ribosomal protein 85.73
3izc_m92 60S ribosomal protein RPL43 (L37AE); eukaryotic ri 85.43
2jsp_A87 Transcriptional regulatory protein ROS; prokaryoti 85.23
2yuc_A76 TNF receptor-associated factor 4; ZF-TRAF, cystein 84.42
4a17_Y103 RPL37A, 60S ribosomal protein L32; eukaryotic ribo 83.84
1ffk_W73 Ribosomal protein L37AE; ribosome assembly, RNA-RN 83.52
4ayb_P48 DNA-directed RNA polymerase; transferase, multi-su 83.38
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 83.38
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 82.35
6rxn_A46 Rubredoxin; electron transfer(iron-sulfur protein) 81.34
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
Probab=99.97  E-value=7.4e-33  Score=203.70  Aligned_cols=165  Identities=28%  Similarity=0.543  Sum_probs=127.2

Q ss_pred             ccceeeeechhhhhhhCCCCccccCcccchhhcccCC----------CceecCccccccCChhHHhhcccCCCCCCCccC
Q psy11761          5 TPNLVLFSQQTLLCIHGNDNAYKCHQCQRLIFLSANA----------GVHKCEYCHKVFDQQSSLLSHNCPQMKPRPYKC   74 (198)
Q Consensus         5 ~~~l~~~~~~~h~~~h~~~~~~~C~~C~~~f~~~~~~----------~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C   74 (198)
                      .+.|.     .|++.|.++++|.|+.|++.|.....+          .+|.|..|++.|.....|..|+..|+++++|.|
T Consensus         6 ~~~l~-----~h~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C   80 (190)
T 2i13_A            6 SSSSV-----AQAALEPGEKPYACPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFSDKKDLTRHQRTHTGEKPYKC   80 (190)
T ss_dssp             ------------------------------CCSSHHHHHGGGCC---CCEECTTTCCEESSHHHHHHHHHHHHCCCCEEC
T ss_pred             hccch-----hhhhhcCCCCCCcCCCCccccCCHHHHHHHHHHcCCCCCccCCCcCchhCCHHHHHHHHHhcCCCCCccC
Confidence            45666     899999999999999999999766443          378999999999999999999999999999999


Q ss_pred             ccchhcccCchhHHHhhhhcCCCCcccCCcCchhhhcccCCCcccCCCcCcccccccccccccCCCCeeCCcchhhhcCh
Q psy11761         75 DTCEKSFTNSQNLNTHQLIHSGIRPFKCTTCDKSFVNQINPTSTHTPTYTKSNLAQHSCMNSHFPKPYQCDRCSQFFGDR  154 (198)
Q Consensus        75 ~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~~f~~~~~~~~~~~~~~~~~~l~~H~~~~~~~~~~~~C~~C~k~f~~~  154 (198)
                      +.|++.|.....|..|++.|.++++|.|+.|++.|.+             .+.|..|++.|+ ++++|.|++|++.|.+.
T Consensus        81 ~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~-------------~~~l~~H~~~h~-~~~~~~C~~C~~~f~~~  146 (190)
T 2i13_A           81 PECGKSFSQRANLRAHQRTHTGEKPYACPECGKSFSQ-------------LAHLRAHQRTHT-GEKPYKCPECGKSFSRE  146 (190)
T ss_dssp             TTTCCEESCHHHHHHHHHHHHTCCCEECTTTCCEESS-------------HHHHHHHHHHHH-CCCCEECTTTCCEESCH
T ss_pred             cccCCccCCHHHHHHHHHhcCCCCCCcCCCCCCccCC-------------HHHHHHHHHHhC-CCCCeECCCCCcccCCH
Confidence            9999999999999999999999999999999999998             899999999988 78999999999999999


Q ss_pred             hHHHhhhhhhCCCCCCCcccccccCCCcccchhccc
Q psy11761        155 MNLISHHCHKHKQSCLPFISRLFGFDDGDKVAKFSG  190 (198)
Q Consensus       155 ~~L~~H~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  190 (198)
                      +.|..|+++|++++  +|.|..|++.+.+...+..+
T Consensus       147 ~~L~~H~~~H~~~~--~~~C~~C~~~f~~~~~L~~H  180 (190)
T 2i13_A          147 DNLHTHQRTHTGEK--PYKCPECGKSFSRRDALNVH  180 (190)
T ss_dssp             HHHHHHHHHHHCCC--CEECTTTCCEESSHHHHHHH
T ss_pred             HHHHHHHHhcCCCC--CeECCCCCCccCCHHHHHHH
Confidence            99999999999988  57788899888877665544



>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>2yuc_A TNF receptor-associated factor 4; ZF-TRAF, cysteine-rich domain associated with ring and TRAF domains protein 1, malignant 62; NMR {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82 Back     alignment and structure
>1vq8_Z 50S ribosomal protein L37AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1vq4_Z* 1vq6_Z* 1vq5_Z* 1vq7_Z* 1vq9_Z* 1vqk_Z* 1vql_Z* 1vqm_Z* 1vqn_Z* 1vqo_Z* 1vqp_Z* 1yhq_Z* 1yi2_Z* 1yij_Z* 1yit_Z* 1yj9_Z* 1yjn_Z* 1yjw_Z* 2qa4_Z* 1s72_Z* ... Back     alignment and structure
>3jyw_9 60S ribosomal protein L43; eukaryotic ribosome, RACK1 protein, flexible fitting; 8.90A {Thermomyces lanuginosus} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2k5c_A Uncharacterized protein PF0385; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Pyrococcus furiosus} Back     alignment and structure
>3j21_i 50S ribosomal protein L37AE; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>3cc2_Z 50S ribosomal protein L37AE, 50S ribosomal protein L32E; genomic sequnece for R-proteins, ribonucleoprotein, ribosoma protein, RNA-binding; HET: 1MA OMU OMG UR3 PSU; 2.40A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 3cc4_Z* 3cc7_Z* 3cce_Z* 3ccj_Z* 3ccl_Z* 3ccm_Z* 3ccq_Z* 3ccr_Z* 3ccs_Z* 3ccu_Z* 3ccv_Z* 3cd6_Z* 3cma_Z* 3cme_Z* 3i55_Z* 3i56_Z* 3cpw_Y* 4adx_Z Back     alignment and structure
>2jsp_A Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens} Back     alignment and structure
>2yuc_A TNF receptor-associated factor 4; ZF-TRAF, cysteine-rich domain associated with ring and TRAF domains protein 1, malignant 62; NMR {Homo sapiens} Back     alignment and structure
>4a17_Y RPL37A, 60S ribosomal protein L32; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_Y 4a1c_Y 4a1e_Y Back     alignment and structure
>1ffk_W Ribosomal protein L37AE; ribosome assembly, RNA-RNA, protein-RNA, protein-protein; 2.40A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1jj2_Y 1k73_1* 1k8a_1* 1k9m_1* 1kc8_1* 1kd1_1* 1kqs_Y* 1m1k_1* 1m90_1* 1n8r_1* 1nji_1* 1q7y_1* 1q81_1* 1q82_1* 1q86_1* 1qvf_Y 1qvg_Y 1w2b_Y 3cxc_Y* Back     alignment and structure
>4ayb_P DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2pmz_P 2wb1_P 2y0s_P 3hkz_P 2waq_P 4b1o_P 4b1p_X Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>6rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.50A {Desulfovibrio desulfuricans} SCOP: g.41.5.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 198
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 7e-08
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 1e-06
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 1e-04
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 1e-06
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 4e-06
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 5e-06
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 2e-05
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 4e-05
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 6e-05
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 8e-05
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 1e-04
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 1e-04
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 1e-04
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 2e-04
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 2e-04
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-04
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 3e-04
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 3e-04
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 8e-04
d1ubdc428 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger 0.002
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: PATZ1
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 45.0 bits (107), Expect = 7e-08
 Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%)

Query: 70  RPYKCDTCEKSFTNSQNLNTH-QLIHSGIRPFKC 102
           +PY C +C K F+   +LN H + +H+  RP KC
Sbjct: 4   KPYICQSCGKGFSRPDHLNGHIKQVHTSERPHKC 37


>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query198
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.56
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.47
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.24
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.14
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.13
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.09
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.09
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.08
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.05
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.04
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.04
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.02
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.02
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.0
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.0
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.9
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.87
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.87
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.8
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.78
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.77
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.74
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.71
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.71
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.7
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.68
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.61
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.61
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.57
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.56
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.55
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.51
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.39
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.36
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.31
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.23
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.22
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.19
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.18
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.06
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.03
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.01
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 97.95
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.94
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.87
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.85
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.8
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.78
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.75
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.62
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.61
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.54
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.46
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.45
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.35
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.35
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.29
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.28
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.19
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.18
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.05
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.02
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 96.99
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.97
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 96.87
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.83
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.82
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.74
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 96.73
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 96.67
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 96.64
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.48
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 96.38
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.19
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.16
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.13
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 95.93
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 95.69
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.41
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 95.39
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.2
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 95.18
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 94.99
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 94.93
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 94.81
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 94.65
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 94.49
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 94.16
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 93.96
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 93.8
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 93.66
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 93.65
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 93.41
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 92.73
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 92.5
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 92.43
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 91.94
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 90.89
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 90.8
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 90.34
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 90.13
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 90.06
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 89.91
d1vqoz173 Ribosomal protein L37ae {Archaeon Haloarcula maris 89.84
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 89.49
d1jj2y_73 Ribosomal protein L37ae {Archaeon Haloarcula maris 89.21
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 88.98
d1y0jb136 U-shaped transcription factor, different fingers { 88.52
d2ak3a237 Microbial and mitochondrial ADK, insert "zinc fing 85.85
d1tf3a331 Transcription factor IIIA, TFIIIA {Xenopus laevis 83.68
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 83.65
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 82.87
d1akya238 Microbial and mitochondrial ADK, insert "zinc fing 80.99
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.56  E-value=2.1e-16  Score=90.20  Aligned_cols=53  Identities=30%  Similarity=0.589  Sum_probs=50.1

Q ss_pred             CCcccCCcCchhhhcccCCCcccCCCcCcccccccccccccCCCCeeCCcchhhhcChhHHHhhhhhh
Q psy11761         97 IRPFKCTTCDKSFVNQINPTSTHTPTYTKSNLAQHSCMNSHFPKPYQCDRCSQFFGDRMNLISHHCHK  164 (198)
Q Consensus        97 ~k~~~C~~C~~~f~~~~~~~~~~~~~~~~~~l~~H~~~~~~~~~~~~C~~C~k~f~~~~~L~~H~~~~  164 (198)
                      ||||.|. ||+.|..             ...|..|+++|+ +++||.|++||+.|.+.+.|..|+++|
T Consensus         1 EK~y~C~-Cgk~F~~-------------~~~l~~H~~~Ht-~ekpy~C~~C~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           1 DKLYPCQ-CGKSFTH-------------KSQRDRHMSMHL-GLRPYGCGVCGKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             CCCEECT-TSCEESS-------------HHHHHHHHHHHS-CCCSEECTTTSCEESSSHHHHHHHTTT
T ss_pred             CcCCCCC-CCCeECC-------------HHHhHHHhhccc-cccCCcCCCcCCEecCHHHHHHHHhcC
Confidence            6899995 9999999             999999999998 899999999999999999999999876



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vqoz1 g.41.8.1 (Z:10-82) Ribosomal protein L37ae {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jj2y_ g.41.8.1 (Y:) Ribosomal protein L37ae {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ak3a2 g.41.2.1 (A:125-161) Microbial and mitochondrial ADK, insert "zinc finger" domain {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1tf3a3 g.37.1.1 (A:71-101) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1akya2 g.41.2.1 (A:131-168) Microbial and mitochondrial ADK, insert "zinc finger" domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure