Psyllid ID: psy11785


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------31
MGQTAVYTLGIPYIDDNVANRESPLYFAITIGVRILGPSLGFILGSFCTRLYVDLSIPSDITPSDPRWIGAWWLGLVLVAVFLMLAAVAMFMFPKTLTKASPVNGTTTVATLPTKKESNQKNPSLKDFPKAVKRLLKNDILMYRTASSVLHILPIAGLYTFLPKYFETQFRLPSHTANMVSGVGGILVMGIGIILSGVFILKFKPNARFVAAWIAITAVLYALGMGILTFIGCPMDEWAGLTNANGISSFEPMCATTHGCECDHSKFNPICGGDGRTYFSACHAGCQNISSIDGKVQTLLFIEAISLD
ccccccccccccccccccccccccEEHHHHHHHHHHcccEEEEEccccccEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccccccHHHHHcccccccEEEEEEEcEEEEEEEccccccHHHHHHHHHHHHHHHHHHEEEEcccccccccccccccccccccccccccccccccccEEccccccccEEEccccccccccccccccccEEEEEccEEcc
cccccccccccEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHccHccccccccccccHccccccHHcccccccccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEcccccccccccHccccccccccccccccccccEEEEccccccccccEEccccccEEEEEEccccc
MGQTAVYTlgipyiddnvanresplYFAITIGVRILGPSLGFILGSFCTrlyvdlsipsditpsdprwiGAWWLGLVLVAVFLMLAAVAMFMfpktltkaspvngtttvatlptkkesnqknpslkdFPKAVKRLLKNDILMYRTassvlhilpiaglytflpkyfetqfrlpshtanmvsGVGGILVMGIGIILSGVFILKFKPNARFVAAWIAITAVLYALGMGILTfigcpmdewagltnangissfepmcatthgcecdhskfnpicggdgrtyfsachagcqnissidgKVQTLLFIEAISLD
MGQTAVYTLGIPYIDDNVANRESPLYFAITIGVRILGPSLGFILGSFCTRLYVDLSIPSDITPSDPRWIGAWWLGLVLVAVFLMLAAVAMFMFPKtltkaspvngtttvatlptkkesnqknpslkdfpKAVKRLLKNDILMYRTASSVLHILPIAGLYTFLPKYFETQFRLPSHTANMVSGVGGILVMGIGIILSGVFILKFKPNARFVAAWIAITAVLYALGMGILTFIGCPMDEWAGLTNANGISSFEPMCATTHGCECDHSKFNPICGGDGRTYFSACHAGCQNISSIDGKVQTLLFIEAISLD
MGQTAVYTLGIPYIDDNVANRESPLYFAITIGVRILGPSLGFILGSFCTRLYVDLSIPSDITPSDPRWIGAWWLGlvlvavflmlaavamfmfPKTLTKASPVNGTTTVATLPTKKESNQKNPSLKDFPKAVKRLLKNDILMYRTASSVLHILPIAGLYTFLPKYFETQFRLPSHTANmvsgvggilvmgigiilsgvFILKFKPNARFVAAWIAITAVLYALGMGILTFIGCPMDEWAGLTNANGISSFEPMCATTHGCECDHSKFNPICGGDGRTYFSACHAGCQNISSIDGKVQTLLFIEAISLD
****AVYTLGIPYIDDNVANRESPLYFAITIGVRILGPSLGFILGSFCTRLYVDLSIPSDITPSDPRWIGAWWLGLVLVAVFLMLAAVAMFMFPKTLTKA******************************AVKRLLKNDILMYRTASSVLHILPIAGLYTFLPKYFETQFRLPSHTANMVSGVGGILVMGIGIILSGVFILKFKPNARFVAAWIAITAVLYALGMGILTFIGCPMDEWAGLTNANGISSFEPMCATTHGCECDHSKFNPICGGDGRTYFSACHAGCQNISSIDGKVQTLLFIEAI***
MGQTAVYTLGIPYIDDNVANRESPLYFAITIGVRILGPSLGFILGSFCTRLYVDLSIPSDITPSDPRWIGAWWLGLVLVAVFLMLAAVAMFMFPK*************************KNPSLKDFPKAVKRLLKNDILMYRTASSVLHILPIAGLYTFLPKYFETQFRLPSHTANMVSGVGGILVMGIGIILSGVFILKFKPNARFVAAWIAITAVLYALGMGILTFIGCPMDEWAGLTNANGISSFEPMCATTHGCECDHSKFNPICGGDGRTYFSACHAGCQNISSIDGKVQTLLFIEAISLD
MGQTAVYTLGIPYIDDNVANRESPLYFAITIGVRILGPSLGFILGSFCTRLYVDLSIPSDITPSDPRWIGAWWLGLVLVAVFLMLAAVAMFMFPKTLTKASPVNGTTTVATLPTKKESNQKNPSLKDFPKAVKRLLKNDILMYRTASSVLHILPIAGLYTFLPKYFETQFRLPSHTANMVSGVGGILVMGIGIILSGVFILKFKPNARFVAAWIAITAVLYALGMGILTFIGCPMDEWAGLTNANGISSFEPMCATTHGCECDHSKFNPICGGDGRTYFSACHAGCQNISSIDGKVQTLLFIEAISLD
*GQTAVYTLGIPYIDDNVANRESPLYFAITIGVRILGPSLGFILGSFCTRLYVDLSIPSDITPSDPRWIGAWWLGLVLVAVFLMLAAVAMFMFPKTLT***********************NPSLKDFPKAVKRLLKNDILMYRTASSVLHILPIAGLYTFLPKYFETQFRLPSHTANMVSGVGGILVMGIGIILSGVFILKFKPNARFVAAWIAITAVLYALGMGILTFIGCPMDEWAGLTNANGISSFEPMCATTHGCECDHSKFNPICGGDGRTYFSACHAGCQNISSIDGKVQTLLFIEAISLD
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGQTAVYTLGIPYIDDNVANRESPLYFAITIGVRILGPSLGFILGSFCTRLYVDLSIPSDITPSDPRWIGAWWLGLVLVAVFLMLAAVAMFMFPKTLTKASPVNGTTTVATLPTKKESNQKNPSLKDFPKAVKRLLKNDILMYRTASSVLHILPIAGLYTFLPKYFETQFRLPSHTANMVSGVGGILVMGIGIILSGVFILKFKPNARFVAAWIAITAVLYALGMGILTFIGCPMDEWAGLTNANGISSFEPMCATTHGCECDHSKFNPICGGDGRTYFSACHAGCQNISSIDGKVQTLLFIEAISLD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query308 2.2.26 [Sep-21-2011]
Q8HYW2 710 Solute carrier organic an yes N/A 0.931 0.404 0.354 1e-46
Q8R3L5 710 Solute carrier organic an yes N/A 0.931 0.404 0.348 1e-46
Q99N02 710 Solute carrier organic an yes N/A 0.931 0.404 0.348 3e-46
Q9UIG8 710 Solute carrier organic an yes N/A 0.931 0.404 0.344 2e-45
Q8BGD4 722 Solute carrier organic an no N/A 0.918 0.391 0.342 5e-41
O88397 670 Solute carrier organic an no N/A 0.931 0.428 0.349 7e-41
Q71MB6 724 Solute carrier organic an no N/A 0.918 0.390 0.342 1e-40
Q9EPT5 643 Solute carrier organic an no N/A 0.935 0.447 0.325 4e-40
Q91YY5 670 Solute carrier organic an no N/A 0.931 0.428 0.339 2e-39
Q5RFF0 724 Solute carrier organic an yes N/A 0.922 0.392 0.341 3e-39
>sp|Q8HYW2|SO3A1_BOVIN Solute carrier organic anion transporter family member 3A1 OS=Bos taurus GN=SLCO3A1 PE=2 SV=1 Back     alignment and function desciption
 Score =  187 bits (474), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 112/316 (35%), Positives = 154/316 (48%), Gaps = 29/316 (9%)

Query: 1   MGQTAVYTLGIPYIDDNVANRESPLYFAITIGVRILGPSLGFILGSFCTRLYVDLSIPS- 59
           +G T V  LG+ YIDD+V  ++S LY  I   + + GP+ GFILGSFCT++YVD      
Sbjct: 189 IGATPVQPLGVSYIDDHVRRKDSSLYIGILFTMLVFGPACGFILGSFCTKIYVDAVFIDT 248

Query: 60  ---DITPSDPRWIGAWWLGLVLVAVFLMLAAVAMFMFPKTLTKASPVNGTTTVATLPTKK 116
              DITP DPRWIGAWW G +L    L  ++V MF FP++L   S     +  A LP ++
Sbjct: 249 SNLDITPDDPRWIGAWWGGFLLCGALLFFSSVLMFGFPQSLPPHSDPALESEQAMLP-ER 307

Query: 117 ESNQKNPS-------------------LKDFPKAVKRLLKNDILMYRTASSVLHILPIAG 157
           E  +  PS                   L+  PK  K LL N +      ++ + I  +AG
Sbjct: 308 EYERPKPSNGVLRHPLEPDSSASCFQQLRVIPKVTKHLLSNPVFTCIILAACMEIAVVAG 367

Query: 158 LYTFLPKYFETQFRLPSHTANMVSGVGGILVMGIGIILSGVFILKFKPNARFVAAWIAIT 217
              FL KY E QF L + +AN + G+  I    +GI L G+ + K   +A        + 
Sbjct: 368 FAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLLVKKLSLSALGAIRMAMLV 427

Query: 218 AVLYALGMGILTFIGCPMDEWAGLTNANGISS-----FEPMCATTHGCECDHSKFNPICG 272
            ++         F+GC     AG+T   G SS      +P  +    CEC    F P+CG
Sbjct: 428 NLVSTACYVSFLFLGCDTGPVAGVTVPYGNSSTPGSALDPYSSCNKNCECQTDSFTPVCG 487

Query: 273 GDGRTYFSACHAGCQN 288
            DG TY SAC AGC +
Sbjct: 488 ADGITYLSACFAGCNS 503




Mediates the Na(+)-independent transport of organic anions (By similarity). Mediates transport of prostaglandins (PG) E1 and E2, thyroxine (T4), deltorphin II, BQ-123 and vasopressin.
Bos taurus (taxid: 9913)
>sp|Q8R3L5|SO3A1_MOUSE Solute carrier organic anion transporter family member 3A1 OS=Mus musculus GN=Slco3a1 PE=2 SV=1 Back     alignment and function description
>sp|Q99N02|SO3A1_RAT Solute carrier organic anion transporter family member 3A1 OS=Rattus norvegicus GN=Slco3a1 PE=2 SV=1 Back     alignment and function description
>sp|Q9UIG8|SO3A1_HUMAN Solute carrier organic anion transporter family member 3A1 OS=Homo sapiens GN=SLCO3A1 PE=1 SV=3 Back     alignment and function description
>sp|Q8BGD4|SO4C1_MOUSE Solute carrier organic anion transporter family member 4C1 OS=Mus musculus GN=Slco4c1 PE=2 SV=1 Back     alignment and function description
>sp|O88397|SO1A5_RAT Solute carrier organic anion transporter family member 1A5 OS=Rattus norvegicus GN=Slco1a5 PE=2 SV=2 Back     alignment and function description
>sp|Q71MB6|SO4C1_RAT Solute carrier organic anion transporter family member 4C1 OS=Rattus norvegicus GN=Slco4c1 PE=1 SV=1 Back     alignment and function description
>sp|Q9EPT5|SO2A1_MOUSE Solute carrier organic anion transporter family member 2A1 OS=Mus musculus GN=Slco2a1 PE=1 SV=2 Back     alignment and function description
>sp|Q91YY5|SO1A5_MOUSE Solute carrier organic anion transporter family member 1A5 OS=Mus musculus GN=Slco1a5 PE=2 SV=1 Back     alignment and function description
>sp|Q5RFF0|SO4C1_PONAB Solute carrier organic anion transporter family member 4C1 OS=Pongo abelii GN=SLCO4C1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query308
380012470 739 PREDICTED: solute carrier organic anion 0.948 0.395 0.696 1e-121
340718289 741 PREDICTED: solute carrier organic anion 0.948 0.394 0.689 1e-121
328781181 741 PREDICTED: solute carrier organic anion 0.948 0.394 0.692 1e-121
350409868 741 PREDICTED: solute carrier organic anion 0.948 0.394 0.689 1e-121
307192330 739 Solute carrier organic anion transporter 0.948 0.395 0.696 1e-120
307187458 759 Solute carrier organic anion transporter 0.928 0.376 0.7 1e-120
383849071 745 PREDICTED: solute carrier organic anion 0.948 0.391 0.686 1e-119
242025588 864 conserved hypothetical protein [Pediculu 0.931 0.332 0.730 1e-117
332016585 741 Solute carrier organic anion transporter 0.928 0.385 0.680 1e-116
345483393 753 PREDICTED: solute carrier organic anion 0.944 0.386 0.651 1e-113
>gi|380012470|ref|XP_003690304.1| PREDICTED: solute carrier organic anion transporter family member 3A1-like [Apis florea] Back     alignment and taxonomy information
 Score =  441 bits (1133), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 213/306 (69%), Positives = 250/306 (81%), Gaps = 14/306 (4%)

Query: 1   MGQTAVYTLGIPYIDDNVANRESPLYFAITIGVRILGPSLGFILGSFCTRLYVDLSIPSD 60
           MGQTAVYTLGIPYIDDNVA+RESPLYFAITIGVRILGP+LGFILGS CT +Y DLS    
Sbjct: 275 MGQTAVYTLGIPYIDDNVASRESPLYFAITIGVRILGPALGFILGSLCTMIYADLSANPQ 334

Query: 61  ITPSDPRWIGAWWLGLVLVAVFLMLAAVAMFMFPKTLTKASPVNGTTTVATLPTKKESNQ 120
           ITP+DPRW+GAWWLGLVL+A  LML ++ MF FP  L            A+    K ++ 
Sbjct: 335 ITPTDPRWVGAWWLGLVLIAAMLMLVSIGMFAFPTRLP-----------ASRTPPKRADA 383

Query: 121 KNPSLKDFPKAVKRLLKNDILMYRTASSVLHILPIAGLYTFLPKYFETQFRLPSHTANMV 180
           K PSL+DFPKAVKRLLKNDILM+RTASSVLHILPIAGLYTFLPKY E+QFRLP+H ANM+
Sbjct: 384 KKPSLRDFPKAVKRLLKNDILMFRTASSVLHILPIAGLYTFLPKYLESQFRLPAHHANMI 443

Query: 181 SGVGGILVMGIGIILSGVFILKFKPNARFVAAWIAITAVLYALGMGILTFIGCPMDEWAG 240
           SGVGGILVMG+GII+SGVFIL+ KPNARFVAAWIA TAV+YA+GMG+L FIGCPMD++AG
Sbjct: 444 SGVGGILVMGLGIIISGVFILRAKPNARFVAAWIAFTAVIYAIGMGVLMFIGCPMDDFAG 503

Query: 241 L-TNANGISSFEPMCATTHGCECDHSKFNPICGGDGRTYFSACHAGCQNISSIDGKVQTL 299
           L ++++G+SSFEP C  T  C+C  +KF+PICG DG+TYFSACHAGC N + +DGKV + 
Sbjct: 504 LVSHSDGLSSFEPTCEAT--CDCVRNKFSPICGADGKTYFSACHAGCSNYTIVDGKVASF 561

Query: 300 LFIEAI 305
              + I
Sbjct: 562 YNCQCI 567




Source: Apis florea

Species: Apis florea

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|340718289|ref|XP_003397602.1| PREDICTED: solute carrier organic anion transporter family member 3A1-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|328781181|ref|XP_003249934.1| PREDICTED: solute carrier organic anion transporter family member 3A1-like [Apis mellifera] Back     alignment and taxonomy information
>gi|350409868|ref|XP_003488870.1| PREDICTED: solute carrier organic anion transporter family member 3A1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|307192330|gb|EFN75596.1| Solute carrier organic anion transporter family member 3A1 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|307187458|gb|EFN72542.1| Solute carrier organic anion transporter family member 3A1 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|383849071|ref|XP_003700170.1| PREDICTED: solute carrier organic anion transporter family member 3A1-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|242025588|ref|XP_002433206.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212518747|gb|EEB20468.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|332016585|gb|EGI57466.1| Solute carrier organic anion transporter family member 3A1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|345483393|ref|XP_003424809.1| PREDICTED: solute carrier organic anion transporter family member 4C1-like isoform 2 [Nasonia vitripennis] gi|345483395|ref|XP_001601987.2| PREDICTED: solute carrier organic anion transporter family member 4C1-like isoform 1 [Nasonia vitripennis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query308
FB|FBgn0036732 819 Oatp74D "Organic anion transpo 0.922 0.346 0.529 1.9e-74
FB|FBgn0034716 789 Oatp58Dc "Organic anion transp 0.587 0.229 0.302 1.4e-41
FB|FBgn0050277 684 Oatp58Da "Organic anion transp 0.902 0.406 0.324 1.7e-39
UNIPROTKB|F1N3T5 716 SLCO4C1 "Uncharacterized prote 0.957 0.412 0.316 1.3e-38
UNIPROTKB|F1RN62 718 SLCO4C1 "Uncharacterized prote 0.957 0.410 0.320 3.6e-38
UNIPROTKB|J9NWB2 591 SLCO4C1 "Uncharacterized prote 0.938 0.489 0.326 8.4e-38
MGI|MGI:1351867 710 Slco3a1 "solute carrier organi 0.399 0.173 0.406 9.7e-38
UNIPROTKB|F1Q4E0 617 SLCO4C1 "Uncharacterized prote 0.938 0.468 0.326 1.4e-37
UNIPROTKB|F1NSG0 709 SLCO3A1 "Uncharacterized prote 0.399 0.173 0.406 1.6e-37
UNIPROTKB|F1Q3M7 692 SLCO3A1 "Uncharacterized prote 0.399 0.177 0.406 2.3e-37
FB|FBgn0036732 Oatp74D "Organic anion transporting polypeptide 74D" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 751 (269.4 bits), Expect = 1.9e-74, P = 1.9e-74
 Identities = 155/293 (52%), Positives = 183/293 (62%)

Query:     1 MGQTAVYTLGIPYIDDNVANRESPLYFAITIGVRILGPSLGFILGSFCTRLYVDLSIPSD 60
             +GQTAV TLGIPYIDDNV +++SP+Y A+TIG+RILGP+ GFI GSFCTR YV+ S P  
Sbjct:   348 IGQTAVATLGIPYIDDNVGSKQSPMYMAVTIGMRILGPASGFIFGSFCTRWYVNFSNPG- 406

Query:    61 ITPSDPRWIGAWWLGXXXXXXXXXXXXXXXXXXPKTLT-KASPVNGTTTVATLPTKKESN 119
                +DPRWIGAWWLG                  PK L  K  P   T T A  P + E  
Sbjct:   407 FDATDPRWIGAWWLGPVAIGSLMLLASIAMFSFPKQLRGKQKPPGQTATPAA-PVEPE-- 463

Query:   120 QKNPSLKDFPKAVKRLLKNDILMYRTASSVLHILPIAGLYTFLPKYFETQFRLPSHTANX 179
              + P LKDFPK V+R L NDILM+RTAS V H+LPIAGLYTFLPKY ETQFRL ++ AN 
Sbjct:   464 -EKPKLKDFPKTVRRQLSNDILMFRTASCVFHLLPIAGLYTFLPKYLETQFRLATYDANM 522

Query:   180 XXXXXXXXXXXXXXXXXXXFILKFKPNARFVAAWIAITAVLYALGMGILTFIGCPMDEWA 239
                                FILK KP AR VAAWIA TA++Y+ GM IL FIGC M+++A
Sbjct:   523 IAAFCGILVMGIGIVISGLFILKRKPTARGVAAWIAFTALVYSAGMIILMFIGCSMNDFA 582

Query:   240 GLTNANGISS--FEPMCATTHGCECDHSKFNPICGGDGRTYFSACHAGCQNIS 290
             G   ++G S    EP C+    C CD   F PIC  DG+ Y SACHAGC + S
Sbjct:   583 GYKPSDGNSPALIEPTCSAALNCTCDKENFAPICA-DGKMYISACHAGCSSSS 634




GO:0015347 "sodium-independent organic anion transmembrane transporter activity" evidence=ISS
GO:0015711 "organic anion transport" evidence=ISS
GO:0008514 "organic anion transmembrane transporter activity" evidence=ISS
GO:0006810 "transport" evidence=IEA
GO:0016020 "membrane" evidence=IEA
FB|FBgn0034716 Oatp58Dc "Organic anion transporting polypeptide 58Dc" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0050277 Oatp58Da "Organic anion transporting polypeptide 58Da" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1N3T5 SLCO4C1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1RN62 SLCO4C1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|J9NWB2 SLCO4C1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1351867 Slco3a1 "solute carrier organic anion transporter family, member 3a1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1Q4E0 SLCO4C1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1NSG0 SLCO3A1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1Q3M7 SLCO3A1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query308
pfam03137 582 pfam03137, OATP, Organic Anion Transporter Polypep 1e-100
TIGR00805 633 TIGR00805, oat, sodium-independent organic anion t 2e-69
cd0133054 cd01330, KAZAL_SLC21, The kazal-type serine protea 3e-12
pfam0764842 pfam07648, Kazal_2, Kazal-type serine protease inh 8e-08
cd0010441 cd00104, KAZAL_FS, Kazal type serine protease inhi 2e-06
smart0028046 smart00280, KAZAL, Kazal type serine protease inhi 8e-04
>gnl|CDD|217384 pfam03137, OATP, Organic Anion Transporter Polypeptide (OATP) family Back     alignment and domain information
 Score =  304 bits (782), Expect = e-100
 Identities = 124/310 (40%), Positives = 165/310 (53%), Gaps = 21/310 (6%)

Query: 1   MGQTAVYTLGIPYIDDNVANRESPLYFAITIGVRILGPSLGFILGSFCTRLYVDLSIPSD 60
           +G T ++TLGI YIDDNV ++ SPLY  I   + + GP++GF+LGSFC RLYVD      
Sbjct: 151 IGATPIFTLGISYIDDNVKSKNSPLYLGILFTMAMFGPAIGFLLGSFCLRLYVDFGRVPT 210

Query: 61  ----ITPSDPRWIGAWWLGLVLVAVFLMLAAVAMFMFPKTLTKASPVNGTTTVATLPTKK 116
               ITP+DPRW+GAWWLG ++     +L+A+  F FPKTL KA     +    + P  K
Sbjct: 211 EDVIITPTDPRWVGAWWLGFLVCGGLALLSAIPFFFFPKTLPKAQGRLESLD-LSRPKAK 269

Query: 117 ESNQKNPS-----------LKDFPKAVKRLLKNDILMYRTASSVLHILPIAGLYTFLPKY 165
           +  +K              LKDFPK +KRLL N   M    + V     IAG  TFLPKY
Sbjct: 270 DETRKQAEEPKSGKSAPDFLKDFPKTLKRLLTNPTFMLVVLAQVFESSVIAGYSTFLPKY 329

Query: 166 FETQFRLPSHTANMVSGVGGILVMGIGIILSGVFILKFKPNARFVAAWIAITAVLYALGM 225
            ETQ+ L +  AN + GV  +    +GI+L G+ I KFK  AR +A +     ++     
Sbjct: 330 LETQYGLSASYANFLIGVVNLPAAAVGILLGGLIIKKFKLTARGMAKFAIFVILVSLAFY 389

Query: 226 GILTFIGCPMDEWAGLTNANGISS-----FEPMCATTHGCECDHSKFNPICGGDGRTYFS 280
               FIGC     AG+T +   S       EP+ +    C CD S F P+CG +G TY S
Sbjct: 390 LPYFFIGCENSPVAGVTPSYENSPSDSHHLEPLSSCNEDCSCDTSFFPPVCGDNGLTYLS 449

Query: 281 ACHAGCQNIS 290
            CHAG  +  
Sbjct: 450 PCHAGSSSSG 459


This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs). Several have been identified mostly in human and rat. Different OATPs vary in tissue distribution and substrate specificity. Since the numbering of different OATPs in particular species was based originally on the order of discovery, similarly numbered OATPs in humans and rats did not necessarily correspond in function, tissue distribution and substrate specificity (in spite of the name, some OATPs also transport organic cations and neutral molecules). Thus, Tamai et al. initiated the current scheme of using digits for rat OATPs and letters for human ones. Prostaglandin transporter (PGT) proteins are also considered to be OATP family members. In addition, the methotrexate transporter OATK is closely related to OATPs. This family also includes several predicted proteins from Caenorhabditis elegans and Drosophila melanogaster. This similarity was not previously noted. Note: Members of this family are described (in the Swiss-Prot database) as belonging to the SLC21 family of transporters. Length = 582

>gnl|CDD|233136 TIGR00805, oat, sodium-independent organic anion transporter Back     alignment and domain information
>gnl|CDD|238650 cd01330, KAZAL_SLC21, The kazal-type serine protease inhibitor domain has been detected in an extracellular loop region of solute carrier 21 (SLC21) family members (organic anion transporters) , which may regulate the specificity of anion uptake Back     alignment and domain information
>gnl|CDD|191798 pfam07648, Kazal_2, Kazal-type serine protease inhibitor domain Back     alignment and domain information
>gnl|CDD|238052 cd00104, KAZAL_FS, Kazal type serine protease inhibitors and follistatin-like domains Back     alignment and domain information
>gnl|CDD|197624 smart00280, KAZAL, Kazal type serine protease inhibitors Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 308
KOG3626|consensus 735 100.0
TIGR00805 633 oat sodium-independent organic anion transporter. 100.0
PF03137539 OATP: Organic Anion Transporter Polypeptide (OATP) 100.0
cd0133054 KAZAL_SLC21 The kazal-type serine protease inhibit 99.85
KOG2532|consensus466 99.68
KOG1330|consensus493 99.67
TIGR00894465 2A0114euk Na(+)-dependent inorganic phosphate cotr 99.67
PRK09556467 uhpT sugar phosphate antiporter; Reviewed 99.64
TIGR00893399 2A0114 d-galactonate transporter. 99.61
COG2271448 UhpC Sugar phosphate permease [Carbohydrate transp 99.6
PRK11663434 regulatory protein UhpC; Provisional 99.59
TIGR00881379 2A0104 phosphoglycerate transporter family protein 99.58
TIGR00712438 glpT glycerol-3-phosphate transporter. This model 99.56
TIGR00710385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 99.53
COG2814394 AraJ Arabinose efflux permease [Carbohydrate trans 99.52
TIGR00903368 2A0129 major facilitator 4 family protein. This fa 99.51
PRK10406432 alpha-ketoglutarate transporter; Provisional 99.51
TIGR00901356 2A0125 AmpG-related permease. 99.5
TIGR02332412 HpaX 4-hydroxyphenylacetate permease. This protein 99.5
PRK03545390 putative arabinose transporter; Provisional 99.49
PRK11102377 bicyclomycin/multidrug efflux system; Provisional 99.48
PRK14995495 methyl viologen resistance protein SmvA; Provision 99.47
COG2223417 NarK Nitrate/nitrite transporter [Inorganic ion tr 99.47
PRK11195393 lysophospholipid transporter LplT; Provisional 99.47
TIGR00900365 2A0121 H+ Antiporter protein. 99.46
PRK11273452 glpT sn-glycerol-3-phosphate transporter; Provisio 99.46
PRK11902402 ampG muropeptide transporter; Reviewed 99.46
TIGR00711485 efflux_EmrB drug resistance transporter, EmrB/QacA 99.46
TIGR00886366 2A0108 nitrite extrusion protein (nitrite facilita 99.46
PRK11010491 ampG muropeptide transporter; Validated 99.45
PRK15402406 multidrug efflux system translocase MdfA; Provisio 99.45
PLN00028476 nitrate transmembrane transporter; Provisional 99.44
PF07690352 MFS_1: Major Facilitator Superfamily; InterPro: IP 99.43
KOG2533|consensus495 99.43
PRK15403413 multidrug efflux system protein MdtM; Provisional 99.43
TIGR00897402 2A0118 polyol permease family. This family of prot 99.42
PRK09705393 cynX putative cyanate transporter; Provisional 99.41
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 99.41
PRK10473392 multidrug efflux system protein MdtL; Provisional 99.41
TIGR00883394 2A0106 metabolite-proton symporter. This model rep 99.4
PRK10642490 proline/glycine betaine transporter; Provisional 99.39
PRK10213394 nepI ribonucleoside transporter; Reviewed 99.38
PRK10133438 L-fucose transporter; Provisional 99.38
TIGR01272310 gluP glucose/galactose transporter. Disruption of 99.38
PRK10091382 MFS transport protein AraJ; Provisional 99.38
PRK03699394 putative transporter; Provisional 99.37
PRK10489417 enterobactin exporter EntS; Provisional 99.37
TIGR00902382 2A0127 phenyl proprionate permease family protein. 99.37
PRK09952438 shikimate transporter; Provisional 99.36
PRK11128382 putative 3-phenylpropionic acid transporter; Provi 99.35
TIGR00892455 2A0113 monocarboxylate transporter 1. 99.35
PRK11043401 putative transporter; Provisional 99.35
TIGR00895398 2A0115 benzoate transport. 99.34
TIGR00891405 2A0112 putative sialic acid transporter. 99.34
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 99.33
TIGR00896355 CynX cyanate transporter. This family of proteins 99.32
PRK15075434 citrate-proton symporter; Provisional 99.32
PRK12307426 putative sialic acid transporter; Provisional 99.31
PRK11551406 putative 3-hydroxyphenylpropionic transporter MhpT 99.3
TIGR00890377 2A0111 Oxalate/Formate Antiporter. 99.29
TIGR00899375 2A0120 sugar efflux transporter. This family of pr 99.28
PRK10504471 putative transporter; Provisional 99.26
TIGR02718390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 99.23
PRK15011393 sugar efflux transporter B; Provisional 99.23
PRK11652394 emrD multidrug resistance protein D; Provisional 99.22
PRK11646400 multidrug resistance protein MdtH; Provisional 99.2
TIGR00879481 SP MFS transporter, sugar porter (SP) family. This 99.2
TIGR00887502 2A0109 phosphate:H+ symporter. This model represen 99.19
TIGR00885410 fucP L-fucose:H+ symporter permease. This family d 99.19
PRK03633381 putative MFS family transporter protein; Provision 99.19
PRK15034462 nitrate/nitrite transport protein NarU; Provisiona 99.18
PRK10077479 xylE D-xylose transporter XylE; Provisional 99.17
cd06174352 MFS The Major Facilitator Superfamily (MFS) is a l 99.07
PRK09874408 drug efflux system protein MdtG; Provisional 99.05
PRK03893496 putative sialic acid transporter; Provisional 99.01
PRK09528420 lacY galactoside permease; Reviewed 99.01
TIGR00882396 2A0105 oligosaccharide:H+ symporter. 99.0
TIGR00792437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 98.99
TIGR01299 742 synapt_SV2 synaptic vesicle protein SV2. This mode 98.97
COG0738422 FucP Fucose permease [Carbohydrate transport and m 98.95
PRK10054395 putative transporter; Provisional 98.95
PRK05122399 major facilitator superfamily transporter; Provisi 98.93
TIGR00898505 2A0119 cation transport protein. 98.92
PRK12382392 putative transporter; Provisional 98.89
cd0010441 KAZAL_FS Kazal type serine protease inhibitors and 98.89
PF05977 524 MFS_3: Transmembrane secretion effector; InterPro: 98.87
COG2807395 CynX Cyanate permease [Inorganic ion transport and 98.78
PRK10207489 dipeptide/tripeptide permease B; Provisional 98.76
KOG3764|consensus464 98.71
PF13347428 MFS_2: MFS/sugar transport protein 98.67
KOG2504|consensus509 98.66
PF11700477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 98.66
KOG2563|consensus480 98.66
KOG2615|consensus451 98.64
PF03209403 PUCC: PUCC protein; InterPro: IPR004896 This prote 98.59
TIGR00889418 2A0110 nucleoside transporter. This family of prot 98.5
PRK09848448 glucuronide transporter; Provisional 98.43
cd0132745 KAZAL_PSTI Kazal-type pancreatic secretory trypsin 98.42
PRK09669444 putative symporter YagG; Provisional 98.38
PRK11462460 putative transporter; Provisional 98.37
TIGR00924475 yjdL_sub1_fam amino acid/peptide transporter (Pept 98.37
PRK10429473 melibiose:sodium symporter; Provisional 98.28
KOG0569|consensus485 98.26
TIGR00806511 rfc RFC reduced folate carrier. Proteins of the RF 98.23
KOG0254|consensus513 98.18
PF0764842 Kazal_2: Kazal-type serine protease inhibitor doma 98.18
TIGR01301477 GPH_sucrose GPH family sucrose/H+ symporter. This 98.09
COG2211467 MelB Na+/melibiose symporter and related transport 98.05
PF00083451 Sugar_tr: Sugar (and other) transporter; InterPro: 98.04
PRK09584500 tppB putative tripeptide transporter permease; Rev 98.04
COG2270438 Permeases of the major facilitator superfamily [Ge 97.96
KOG2816|consensus463 97.93
PF06609 599 TRI12: Fungal trichothecene efflux pump (TRI12); I 97.9
PF0005048 Kazal_1: Kazal-type serine protease inhibitor doma 97.89
smart0028046 KAZAL Kazal type serine protease inhibitors. Kazal 97.87
TIGR00788468 fbt folate/biopterin transporter. The only functio 97.87
KOG0252|consensus538 97.8
PF03825400 Nuc_H_symport: Nucleoside H+ symporter 97.76
PRK09528 420 lacY galactoside permease; Reviewed 97.71
KOG4686|consensus459 97.66
TIGR00882 396 2A0105 oligosaccharide:H+ symporter. 97.56
KOG0255|consensus521 97.48
TIGR00880141 2_A_01_02 Multidrug resistance protein. 97.44
TIGR00924 475 yjdL_sub1_fam amino acid/peptide transporter (Pept 97.42
PRK15462493 dipeptide/tripeptide permease D; Provisional 97.41
PF01306412 LacY_symp: LacY proton/sugar symporter; InterPro: 97.39
TIGR00769472 AAA ADP/ATP carrier protein family. These proteins 97.32
PRK15462 493 dipeptide/tripeptide permease D; Provisional 97.3
PRK10054 395 putative transporter; Provisional 97.29
PRK09584 500 tppB putative tripeptide transporter permease; Rev 97.24
TIGR00886 366 2A0108 nitrite extrusion protein (nitrite facilita 97.23
TIGR01299742 synapt_SV2 synaptic vesicle protein SV2. This mode 97.21
PRK05122 399 major facilitator superfamily transporter; Provisi 97.17
PF01306 412 LacY_symp: LacY proton/sugar symporter; InterPro: 97.14
PRK12382 392 putative transporter; Provisional 97.13
TIGR00889418 2A0110 nucleoside transporter. This family of prot 97.02
PF06963432 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 Thi 97.02
KOG2325|consensus488 96.81
PF1283277 MFS_1_like: MFS_1 like family 96.8
PRK10489 417 enterobactin exporter EntS; Provisional 96.66
PF03825400 Nuc_H_symport: Nucleoside H+ symporter 96.63
KOG0253|consensus528 96.61
PRK10207 489 dipeptide/tripeptide permease B; Provisional 96.55
PF03219491 TLC: TLC ATP/ADP transporter; InterPro: IPR004667 96.52
cd0132886 FSL_SPARC Follistatin-like SPARC (secreted protein 96.51
PRK11043 401 putative transporter; Provisional 96.51
PRK09874408 drug efflux system protein MdtG; Provisional 96.5
PRK03633381 putative MFS family transporter protein; Provision 96.45
TIGR00712 438 glpT glycerol-3-phosphate transporter. This model 96.44
TIGR00892455 2A0113 monocarboxylate transporter 1. 96.42
PRK11646 400 multidrug resistance protein MdtH; Provisional 96.41
PRK15011 393 sugar efflux transporter B; Provisional 96.39
PRK11663 434 regulatory protein UhpC; Provisional 96.3
PRK03699 394 putative transporter; Provisional 96.3
cd06174352 MFS The Major Facilitator Superfamily (MFS) is a l 96.26
TIGR00879481 SP MFS transporter, sugar porter (SP) family. This 96.18
PRK10504 471 putative transporter; Provisional 96.16
TIGR00890377 2A0111 Oxalate/Formate Antiporter. 96.09
PRK15034 462 nitrate/nitrite transport protein NarU; Provisiona 96.08
PTZ00207 591 hypothetical protein; Provisional 96.04
PRK11551406 putative 3-hydroxyphenylpropionic transporter MhpT 96.03
PLN00028 476 nitrate transmembrane transporter; Provisional 96.01
PRK11652 394 emrD multidrug resistance protein D; Provisional 95.98
PRK09848 448 glucuronide transporter; Provisional 95.95
TIGR00893399 2A0114 d-galactonate transporter. 95.95
TIGR00891 405 2A0112 putative sialic acid transporter. 95.91
TIGR00898505 2A0119 cation transport protein. 95.88
PRK11273 452 glpT sn-glycerol-3-phosphate transporter; Provisio 95.84
PF05631354 DUF791: Protein of unknown function (DUF791); Inte 95.79
TIGR00897 402 2A0118 polyol permease family. This family of prot 95.7
TIGR00926 654 2A1704 Peptide:H+ symporter (also transports b-lac 95.69
COG3104498 PTR2 Dipeptide/tripeptide permease [Amino acid tra 95.64
TIGR00885 410 fucP L-fucose:H+ symporter permease. This family d 95.62
PRK09705393 cynX putative cyanate transporter; Provisional 95.62
PF07690 352 MFS_1: Major Facilitator Superfamily; InterPro: IP 95.58
TIGR02332 412 HpaX 4-hydroxyphenylacetate permease. This protein 95.55
PRK11195 393 lysophospholipid transporter LplT; Provisional 95.53
PRK03893496 putative sialic acid transporter; Provisional 95.53
TIGR00881 379 2A0104 phosphoglycerate transporter family protein 95.49
PRK10133 438 L-fucose transporter; Provisional 95.45
TIGR00899 375 2A0120 sugar efflux transporter. This family of pr 95.39
PRK10091 382 MFS transport protein AraJ; Provisional 95.37
PRK10473 392 multidrug efflux system protein MdtL; Provisional 95.22
TIGR00710 385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 95.11
PRK09669 444 putative symporter YagG; Provisional 95.09
PRK12307 426 putative sialic acid transporter; Provisional 95.09
TIGR00792 437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 95.05
PF03092433 BT1: BT1 family; InterPro: IPR004324 Members of th 95.03
TIGR00805 633 oat sodium-independent organic anion transporter. 94.99
PRK15402 406 multidrug efflux system translocase MdfA; Provisio 94.94
KOG3098|consensus461 94.93
PRK03545390 putative arabinose transporter; Provisional 94.82
PRK10642490 proline/glycine betaine transporter; Provisional 94.75
PRK10429 473 melibiose:sodium symporter; Provisional 94.75
PF05977 524 MFS_3: Transmembrane secretion effector; InterPro: 94.73
PF01770412 Folate_carrier: Reduced folate carrier; InterPro: 94.7
TIGR00895 398 2A0115 benzoate transport. 94.7
TIGR00887502 2A0109 phosphate:H+ symporter. This model represen 94.7
TIGR00900 365 2A0121 H+ Antiporter protein. 94.69
PRK09556 467 uhpT sugar phosphate antiporter; Reviewed 94.61
COG3202509 ATP/ADP translocase [Energy production and convers 94.55
TIGR00788468 fbt folate/biopterin transporter. The only functio 94.55
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 94.48
PF11700477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 94.16
PRK10077479 xylE D-xylose transporter XylE; Provisional 94.1
TIGR00711 485 efflux_EmrB drug resistance transporter, EmrB/QacA 94.06
PRK11128 382 putative 3-phenylpropionic acid transporter; Provi 94.03
PRK09952438 shikimate transporter; Provisional 93.96
TIGR00883394 2A0106 metabolite-proton symporter. This model rep 93.93
PRK10213 394 nepI ribonucleoside transporter; Reviewed 93.76
KOG3762|consensus618 93.7
TIGR00894465 2A0114euk Na(+)-dependent inorganic phosphate cotr 93.58
COG2270438 Permeases of the major facilitator superfamily [Ge 93.35
PRK11102 377 bicyclomycin/multidrug efflux system; Provisional 93.15
TIGR00902 382 2A0127 phenyl proprionate permease family protein. 92.7
COG2271 448 UhpC Sugar phosphate permease [Carbohydrate transp 92.46
PRK15403 413 multidrug efflux system protein MdtM; Provisional 92.18
PRK11902 402 ampG muropeptide transporter; Reviewed 92.03
PRK14995 495 methyl viologen resistance protein SmvA; Provision 91.94
COG3104 498 PTR2 Dipeptide/tripeptide permease [Amino acid tra 91.43
KOG4578|consensus 421 91.42
PF00854372 PTR2: POT family; InterPro: IPR000109 This entry r 91.02
PRK11010491 ampG muropeptide transporter; Validated 90.91
TIGR00903368 2A0129 major facilitator 4 family protein. This fa 90.78
PRK11462 460 putative transporter; Provisional 90.69
PTZ00207 591 hypothetical protein; Provisional 90.68
KOG2615|consensus451 90.46
PRK15075 434 citrate-proton symporter; Provisional 90.3
TIGR00806 511 rfc RFC reduced folate carrier. Proteins of the RF 90.16
PF13347 428 MFS_2: MFS/sugar transport protein 89.94
PRK10406 432 alpha-ketoglutarate transporter; Provisional 89.63
TIGR02718390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 89.49
TIGR00896 355 CynX cyanate transporter. This family of proteins 89.46
KOG0637|consensus498 89.24
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 88.75
TIGR01301 477 GPH_sucrose GPH family sucrose/H+ symporter. This 88.74
COG2211 467 MelB Na+/melibiose symporter and related transport 88.58
PF0677985 DUF1228: Protein of unknown function (DUF1228); In 87.95
COG2223 417 NarK Nitrate/nitrite transporter [Inorganic ion tr 87.12
KOG3762|consensus 618 84.44
COG0738 422 FucP Fucose permease [Carbohydrate transport and m 82.17
KOG3810|consensus433 81.94
PF03092433 BT1: BT1 family; InterPro: IPR004324 Members of th 81.6
PF02554376 CstA: Carbon starvation protein CstA; InterPro: IP 81.41
KOG4686|consensus459 81.04
>KOG3626|consensus Back     alignment and domain information
Probab=100.00  E-value=1.8e-74  Score=563.04  Aligned_cols=304  Identities=44%  Similarity=0.827  Sum_probs=272.8

Q ss_pred             CccccccccchhhhcCccCCCCchhHHHHHHHHHHHHHHHHHHHHHhhhcccccCC-CCCCCCCCCCchhHHHHHHHHHH
Q psy11785          1 MGQTAVYTLGIPYIDDNVANRESPLYFAITIGVRILGPSLGFILGSFCTRLYVDLS-IPSDITPSDPRWIGAWWLGLVLV   79 (308)
Q Consensus         1 iG~a~~~~lg~a~i~d~~~~~~~~~~~gi~~~~~~~Gp~lG~~lGg~ll~~~v~~~-~~~~~~~~~~~W~gaWw~~fii~   79 (308)
                      ||++|++|+|++|||||++++++++|+|+++++.++||++|+++|++++++|+|++ ....++|.||||+||||+||+++
T Consensus       249 IG~Tpi~tlGisYiDDnvk~~~SplYlgi~~~~~~lGPaiGfllgS~~l~lYvD~~~~~~~it~~DPrWIGAWWlGFLi~  328 (735)
T KOG3626|consen  249 IGATPIFTLGISYIDDNVKKKNSPLYLGILYSMAILGPAIGFLLGSFCLKLYVDFGLSPIGITPTDPRWIGAWWLGFLIC  328 (735)
T ss_pred             cCCCCCccCCCccccccccccCCcHHHHHHHHHHHhhhHHHHHHHHHHHHeeeccccCCCCCCCCCcchhhHHHHHHHHH
Confidence            79999999999999999999999999999999999999999999999999999994 55789999999999999999999


Q ss_pred             HHHHHHHHHHHHhccCCCCCCCCccCCcccccCCCc----cccccCCCCCCcchHHHHHhhcChHHHHHHHHHHHHHHHH
Q psy11785         80 AVFLMLAAVAMFMFPKTLTKASPVNGTTTVATLPTK----KESNQKNPSLKDFPKAVKRLLKNDILMYRTASSVLHILPI  155 (308)
Q Consensus        80 g~~~ll~~i~~~~~p~~~p~~~~~~~~~~~~~~~~~----~~~~~~~~~~~~~~~~~~~Ll~n~~f~~~~l~~~~~~~~~  155 (308)
                      |.+.++.++++++|||++|+..+++..++.+....+    ++++...+.++|+|+..++|++||+|++.+++.+++..++
T Consensus       329 g~~~~~~a~p~f~fPk~lp~~~~~~~~~~~~~~k~~~~~~~~~~~~~~~ikdfp~s~~~ll~N~if~~~~l~~~~~~~~~  408 (735)
T KOG3626|consen  329 GALLLFSAVPLFFFPKELPKSQKRKRARDLHVLKTESGGAKSDKTFGKKIKDFPKSIKRLLSNPIFMLVVLASVIESLAI  408 (735)
T ss_pred             HHHHHHHHHHHHhCcccCccccccchhhhhcccccccccccCCcchhhhHHHHHHHHHHHhcCchHHHHHHHHHHHHHHH
Confidence            999999999999999999987653222111111110    1122223356799999999999999999999999999999


Q ss_pred             HHHHhHHHHHHHHHhCCCcccccccchhhhhhhhHHHhhhhheehhhccCCccchhHHHHHHHHHHHHHHhHHHhcCCCC
Q psy11785        156 AGLYTFLPKYFETQFRLPSHTANMVSGVGGILVMGIGIILSGVFILKFKPNARFVAAWIAITAVLYALGMGILTFIGCPM  235 (308)
Q Consensus       156 ~~~~~~~P~yl~~~~gls~~~agl~~g~~~i~~~~iG~~lgG~l~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~  235 (308)
                      .|+.+|+|||||+|||++++.|++++|.+.+|++++|.++||++++|++++.|++++++++++++++++.++++++||++
T Consensus       409 ~G~~tFlPKyLE~Qfg~sas~An~l~G~i~vp~~~~Gi~lGG~iikkfkl~~r~~a~~~~~~~~l~l~~~~~~~~igC~~  488 (735)
T KOG3626|consen  409 TGYITFLPKYLETQFGISASLANILTGSIGVPAAAVGIFLGGLIIKKFKLSARGAAKFVIVCSVLSLLFYSLLFFIGCES  488 (735)
T ss_pred             hhHHHhhHHHHHHHcCCCHHHHHHHhhhhhhhhhhhhhhccceeeeeecccHHHHHHHHHHHHHHHHHHHHHHHEecCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999989999999999


Q ss_pred             CCccccccCCCCC-------CcccCCCCCCCccCCCCCcceeeCCCCceecCccccccccccccCCCceEEEeeEeee
Q psy11785        236 DEWAGLTNANGIS-------SFEPMCATTHGCECDHSKFNPICGGDGRTYFSACHAGCQNISSIDGKVQTLLFIEAIS  306 (308)
Q Consensus       236 ~~~ag~~~~~~~~-------~~~~~Cn~~~~C~C~~~~~~PvC~~~g~ty~SpC~AGC~~~~~~~~~~~~~~~~~~~~  306 (308)
                      .+++|++.++.+.       ++.++||++  |+|++++|+||||+||+||||||||||++....+.+++.|++|+|+.
T Consensus       489 ~~~aG~~~~y~~~~~~~~~~~~~s~Cn~~--C~C~~~~~~PVCg~~G~tY~SpChAGC~~~~~~~~~~~~ytnCsCv~  564 (735)
T KOG3626|consen  489 SPVAGVTNSYEGSPAFTSHENPFSSCNSD--CSCDTSEYEPVCGENGITYFSPCHAGCTESSGTSDGNTIYTNCSCVP  564 (735)
T ss_pred             CcccceecCCCCCCccccCCCchhhhhcC--CCCCCcCcCcccCCCCCEEeChhhhCCcccccCCCCceeeccccccc
Confidence            9999999765322       145679999  99999999999999999999999999999988888899999999985



>TIGR00805 oat sodium-independent organic anion transporter Back     alignment and domain information
>PF03137 OATP: Organic Anion Transporter Polypeptide (OATP) family; InterPro: IPR004156 This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs) Back     alignment and domain information
>cd01330 KAZAL_SLC21 The kazal-type serine protease inhibitor domain has been detected in an extracellular loop region of solute carrier 21 (SLC21) family members (organic anion transporters) , which may regulate the specificity of anion uptake Back     alignment and domain information
>KOG2532|consensus Back     alignment and domain information
>KOG1330|consensus Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>KOG2533|consensus Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>cd00104 KAZAL_FS Kazal type serine protease inhibitors and follistatin-like domains Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>KOG3764|consensus Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>KOG2504|consensus Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>KOG2563|consensus Back     alignment and domain information
>KOG2615|consensus Back     alignment and domain information
>PF03209 PUCC: PUCC protein; InterPro: IPR004896 This protein is required for high-level transcription of the PUC operon Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>PRK09848 glucuronide transporter; Provisional Back     alignment and domain information
>cd01327 KAZAL_PSTI Kazal-type pancreatic secretory trypsin inhibitors (PSTI) and related proteins, including the second domain of the ovomucoid turkey inhibitor and the C-terminal domain of the esophagus cancer-related gene-2 protein (ECRG-2), are members of the superfamily of kazal-type proteinase inhibitors and follistatin-like proteins Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>KOG0569|consensus Back     alignment and domain information
>TIGR00806 rfc RFC reduced folate carrier Back     alignment and domain information
>KOG0254|consensus Back     alignment and domain information
>PF07648 Kazal_2: Kazal-type serine protease inhibitor domain; InterPro: IPR011497 This domain is usually indicative of serine protease inhibitors that belong to Merops inhibitor families: I1, I2, I17 and I31 Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>COG2270 Permeases of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>KOG2816|consensus Back     alignment and domain information
>PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins Back     alignment and domain information
>PF00050 Kazal_1: Kazal-type serine protease inhibitor domain; InterPro: IPR002350 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively Back     alignment and domain information
>smart00280 KAZAL Kazal type serine protease inhibitors Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>KOG0252|consensus Back     alignment and domain information
>PF03825 Nuc_H_symport: Nucleoside H+ symporter Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>KOG4686|consensus Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>KOG0255|consensus Back     alignment and domain information
>TIGR00880 2_A_01_02 Multidrug resistance protein Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>PF01306 LacY_symp: LacY proton/sugar symporter; InterPro: IPR022814 In bacteria there are a number of families of transport proteins, including symporters and antiporters, that mediate the intake of a variety of sugars with the concomitant uptake of hydrogen ions (proton symporters) [] Back     alignment and domain information
>TIGR00769 AAA ADP/ATP carrier protein family Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>PF01306 LacY_symp: LacY proton/sugar symporter; InterPro: IPR022814 In bacteria there are a number of families of transport proteins, including symporters and antiporters, that mediate the intake of a variety of sugars with the concomitant uptake of hydrogen ions (proton symporters) [] Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>PF06963 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 This entry represents the solute carrier family 40 member 1 family of proteins, also known as Ferroportin 1 Back     alignment and domain information
>KOG2325|consensus Back     alignment and domain information
>PF12832 MFS_1_like: MFS_1 like family Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>PF03825 Nuc_H_symport: Nucleoside H+ symporter Back     alignment and domain information
>KOG0253|consensus Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>PF03219 TLC: TLC ATP/ADP transporter; InterPro: IPR004667 These proteins are members of the ATP:ADP Antiporter (AAA) family, which consists of nucleotide transporters that have 12 GES predicted transmembrane regions Back     alignment and domain information
>cd01328 FSL_SPARC Follistatin-like SPARC (secreted protein, acidic, and rich in cysteines) domain; SPARC/BM-40/osteonectin is a multifunctional glycoprotein which modulates cellular interaction with the extracellular matrix by its binding to structural matrix proteins such as collagen and vitronectin Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>PTZ00207 hypothetical protein; Provisional Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>PRK09848 glucuronide transporter; Provisional Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>PF05631 DUF791: Protein of unknown function (DUF791); InterPro: IPR008509 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>TIGR00926 2A1704 Peptide:H+ symporter (also transports b-lactam antibiotics, the antitumor agent, bestatin, and various protease inhibitors) Back     alignment and domain information
>COG3104 PTR2 Dipeptide/tripeptide permease [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>PF03092 BT1: BT1 family; InterPro: IPR004324 Members of this family are transmembrane proteins Back     alignment and domain information
>TIGR00805 oat sodium-independent organic anion transporter Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>KOG3098|consensus Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>PF01770 Folate_carrier: Reduced folate carrier; InterPro: IPR002666 The reduced folate carrier (a transmembrane glycoprotein) transports reduced folate into mammalian cells via the carrier mediated mechanism (as opposed to the receptor mediated mechanism) it also transports cytotoxic folate analogues used in chemotherapy [], such as methotrexate (MTX) Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>COG3202 ATP/ADP translocase [Energy production and conversion] Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>KOG3762|consensus Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>COG2270 Permeases of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>COG3104 PTR2 Dipeptide/tripeptide permease [Amino acid transport and metabolism] Back     alignment and domain information
>KOG4578|consensus Back     alignment and domain information
>PF00854 PTR2: POT family; InterPro: IPR000109 This entry represents the POT (proton-dependent oligopeptide transport) family, which all appear to be proton dependent transporters Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>PTZ00207 hypothetical protein; Provisional Back     alignment and domain information
>KOG2615|consensus Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>TIGR00806 rfc RFC reduced folate carrier Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>KOG0637|consensus Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF06779 DUF1228: Protein of unknown function (DUF1228); InterPro: IPR010645 This entry represents the N terminus of several putative bacterial membrane proteins, which may be sugar transporters Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG3762|consensus Back     alignment and domain information
>COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG3810|consensus Back     alignment and domain information
>PF03092 BT1: BT1 family; InterPro: IPR004324 Members of this family are transmembrane proteins Back     alignment and domain information
>PF02554 CstA: Carbon starvation protein CstA; InterPro: IPR003706 Escherichia coli induces the synthesis of at least 30 proteins at the onset of carbon starvation, two-thirds of which are positively regulated by the cyclic AMP (cAMP) and cAMP receptor protein (CRP) complex Back     alignment and domain information
>KOG4686|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query308
2erw_A56 Serine protease inhibitor infestin; kazal type dom 4e-07
1ldt_L46 LDTI, tryptase inhibitor; complex (hydrolase/inhib 9e-07
2arp_F152 Follistatin; cystine knot, disulfide rich, EGF dom 1e-05
2arp_F152 Follistatin; cystine knot, disulfide rich, EGF dom 3e-04
3sek_C209 Follistatin-related protein 3; protein-protein com 2e-05
3sek_C209 Follistatin-related protein 3; protein-protein com 8e-05
1nub_A 229 Basement membrane protein BM-40; extracellular mod 2e-05
3b4v_C237 Follistatin-like 3; ligand-inhibitor signalling co 5e-05
3b4v_C237 Follistatin-like 3; ligand-inhibitor signalling co 7e-05
2f3c_I55 Thrombin inhibitor infestin; serine protease - inh 6e-05
3hh2_C 288 Follistatin; protein-protein complex, TB domain, c 1e-04
3hh2_C288 Follistatin; protein-protein complex, TB domain, c 1e-04
3hh2_C288 Follistatin; protein-protein complex, TB domain, c 7e-04
1y1b_A48 Elastase inhibitor; non-classical, kazal-type, pro 1e-04
1tbr_R103 RHODNIIN; complex (serine protease-inhibitor), kaz 1e-04
1lr7_A74 Follistatin, FS1; heparin-binding, cystine-rich, s 3e-04
3qtl_D75 Kazal-type serine protease inhibitor SPI-1; serine 5e-04
>2erw_A Serine protease inhibitor infestin; kazal type domain, blood clotting, hydrolase inhibitor; 1.40A {Triatoma infestans} SCOP: g.68.1.1 Length = 56 Back     alignment and structure
 Score = 45.7 bits (108), Expect = 4e-07
 Identities = 12/35 (34%), Positives = 19/35 (54%), Gaps = 1/35 (2%)

Query: 260 CECDHSKFNPICGGDGRTYFSACHAGCQNISSIDG 294
           C C  + + P+CG DG+TY + C   C   + + G
Sbjct: 6   CACFRN-YVPVCGSDGKTYGNPCMLNCAAQTKVPG 39


>1ldt_L LDTI, tryptase inhibitor; complex (hydrolase/inhibitor), hydrolase, inflammation; 1.90A {Hirudo medicinalis} SCOP: g.68.1.1 PDB: 1an1_I 2kmo_A 2kmp_A 2kmq_A 2kmr_A Length = 46 Back     alignment and structure
>2arp_F Follistatin; cystine knot, disulfide rich, EGF domain, kazal domain, PROT complex, hormone-growth factor complex; HET: 1PG; 2.00A {Rattus norvegicus} Length = 152 Back     alignment and structure
>2arp_F Follistatin; cystine knot, disulfide rich, EGF domain, kazal domain, PROT complex, hormone-growth factor complex; HET: 1PG; 2.00A {Rattus norvegicus} Length = 152 Back     alignment and structure
>3sek_C Follistatin-related protein 3; protein-protein complex, TB domain, cystine knot motif, TGF- fold, disulfide linked dimer, follistatin domain (FSD); HET: NAG; 2.40A {Homo sapiens} PDB: 2kcx_A Length = 209 Back     alignment and structure
>3sek_C Follistatin-related protein 3; protein-protein complex, TB domain, cystine knot motif, TGF- fold, disulfide linked dimer, follistatin domain (FSD); HET: NAG; 2.40A {Homo sapiens} PDB: 2kcx_A Length = 209 Back     alignment and structure
>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* Length = 229 Back     alignment and structure
>3b4v_C Follistatin-like 3; ligand-inhibitor signalling complex, cleavage on PAIR of BAS residues, glycoprotein, growth factor, hormone, secreted; HET: NAG; 2.48A {Homo sapiens} Length = 237 Back     alignment and structure
>3b4v_C Follistatin-like 3; ligand-inhibitor signalling complex, cleavage on PAIR of BAS residues, glycoprotein, growth factor, hormone, secreted; HET: NAG; 2.48A {Homo sapiens} Length = 237 Back     alignment and structure
>2f3c_I Thrombin inhibitor infestin; serine protease - inhibitor complex, kazal-type domain, hydrolase/hydrolase inhibitor complex; 2.50A {Triatoma infestans} SCOP: g.68.1.1 PDB: 1kma_A Length = 55 Back     alignment and structure
>3hh2_C Follistatin; protein-protein complex, TB domain, cystine knot motif, TGF- fold, disulfide linked dimer, CLE PAIR of basic residues, cytokine; HET: CIT; 2.15A {Homo sapiens} PDB: 2b0u_C* 2p6a_D Length = 288 Back     alignment and structure
>3hh2_C Follistatin; protein-protein complex, TB domain, cystine knot motif, TGF- fold, disulfide linked dimer, CLE PAIR of basic residues, cytokine; HET: CIT; 2.15A {Homo sapiens} PDB: 2b0u_C* 2p6a_D Length = 288 Back     alignment and structure
>3hh2_C Follistatin; protein-protein complex, TB domain, cystine knot motif, TGF- fold, disulfide linked dimer, CLE PAIR of basic residues, cytokine; HET: CIT; 2.15A {Homo sapiens} PDB: 2b0u_C* 2p6a_D Length = 288 Back     alignment and structure
>1y1b_A Elastase inhibitor; non-classical, kazal-type, protease inhibitor, CSH motif, hydrolase inhibitor; NMR {Synthetic} PDB: 1y1c_A Length = 48 Back     alignment and structure
>1tbr_R RHODNIIN; complex (serine protease-inhibitor), kazal-type inhibitor, T complex (serine protease-inhibitor) complex; 2.60A {Rhodnius prolixus} SCOP: g.68.1.1 g.68.1.1 PDB: 1tbq_R Length = 103 Back     alignment and structure
>1lr7_A Follistatin, FS1; heparin-binding, cystine-rich, sucrose octasulphate, hormone/growth factor complex; HET: SO4; 1.50A {Rattus norvegicus} SCOP: g.3.11.3 g.68.1.1 PDB: 1lr8_A* 1lr9_A Length = 74 Back     alignment and structure
>3qtl_D Kazal-type serine protease inhibitor SPI-1; serine protease -kazal type serine protease inhibitor comple hydrolase inhibitor; 2.60A {Carcinoscorpius rotundicauda} Length = 75 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query308
1pw4_A451 Glycerol-3-phosphate transporter; transmembrane, i 99.62
3o7q_A438 L-fucose-proton symporter; transporter, multi-PASS 99.61
2gfp_A375 EMRD, multidrug resistance protein D; membrane pro 99.36
4aps_A491 DI-OR tripeptide H+ symporter; transport protein, 99.19
2erw_A56 Serine protease inhibitor infestin; kazal type dom 99.16
1ldt_L46 LDTI, tryptase inhibitor; complex (hydrolase/inhib 99.13
1pce_A60 PEC-60; proteinase inhibitor(kazal type); NMR {Sus 99.01
1y1b_A48 Elastase inhibitor; non-classical, kazal-type, pro 98.92
2cfq_A417 Lactose permease; transport, transport mechanism, 98.89
2f3c_I55 Thrombin inhibitor infestin; serine protease - inh 98.81
4gc0_A491 D-xylose-proton symporter; MFS, transport protein; 98.8
1tgs_I56 Pancreatic secretory trypsin inhibitor (kazal type 98.8
1cgj_I56 Pancreatic secretory trypsin inhibitor (kazal type 98.76
1bus_A57 Proteinase inhibitor IIA; HET: PCA; NMR {Bos tauru 98.69
1uvf_A61 Serine proteinase inhibitor kazal type 5; trypsin 98.6
1r0r_I51 Ovomucoid, omtky3; high resolution, serine proteas 98.56
1uvg_A78 Serine proteinase inhibitor kazal type 5; trypsin 98.31
2jxd_A62 Serine protease inhibitor kazal-type 2; anti-paral 98.28
2xut_A 524 Proton/peptide symporter family protein; transport 98.16
3pis_D42 Kazal-type serine protease inhibitor SPI-1; typica 97.89
1tbr_R103 RHODNIIN; complex (serine protease-inhibitor), kaz 97.85
2cfq_A 417 Lactose permease; transport, transport mechanism, 97.82
1h0z_A68 Serine protease inhibitor kazal-type 5, contains h 97.8
2leo_A66 Serine protease inhibitor kazal-type 7; esophageal 96.9
1lr7_A74 Follistatin, FS1; heparin-binding, cystine-rich, s 97.46
4aps_A 491 DI-OR tripeptide H+ symporter; transport protein, 97.15
1tbr_R103 RHODNIIN; complex (serine protease-inhibitor), kaz 97.14
2xut_A 524 Proton/peptide symporter family protein; transport 97.05
3qtl_D75 Kazal-type serine protease inhibitor SPI-1; serine 97.05
3qtl_D75 Kazal-type serine protease inhibitor SPI-1; serine 96.54
2arp_F152 Follistatin; cystine knot, disulfide rich, EGF dom 96.51
1hdl_A55 HF6478, serine proteinase inhibitor lekti; putativ 96.38
1nub_A 229 Basement membrane protein BM-40; extracellular mod 96.23
3o7q_A 438 L-fucose-proton symporter; transporter, multi-PASS 96.04
1pw4_A 451 Glycerol-3-phosphate transporter; transmembrane, i 96.03
2arp_F152 Follistatin; cystine knot, disulfide rich, EGF dom 95.96
3sek_C209 Follistatin-related protein 3; protein-protein com 95.7
1yu6_C 185 Ovomucoid; protein proteinase inhibitor, protease, 95.67
1yu6_C185 Ovomucoid; protein proteinase inhibitor, protease, 95.63
2gfp_A 375 EMRD, multidrug resistance protein D; membrane pro 95.56
3sek_C209 Follistatin-related protein 3; protein-protein com 95.37
3b4v_C237 Follistatin-like 3; ligand-inhibitor signalling co 95.37
3b4v_C237 Follistatin-like 3; ligand-inhibitor signalling co 95.28
3hh2_C288 Follistatin; protein-protein complex, TB domain, c 95.13
3hh2_C288 Follistatin; protein-protein complex, TB domain, c 95.12
4gc0_A491 D-xylose-proton symporter; MFS, transport protein; 94.32
3tjq_A140 Serine protease HTRA1; hydrolase; 2.00A {Homo sapi 94.21
4gi3_C83 Greglin; kazal type inhibitor, hydrolase-hydrolase 93.63
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
Probab=99.62  E-value=1e-15  Score=143.71  Aligned_cols=181  Identities=14%  Similarity=0.117  Sum_probs=125.2

Q ss_pred             ccccccccchhhhcCccCCCCchhHHHHHHHHHHHHHHHHHHHHHhhhcccccCCCCCCCCCCCCchhHHHHHHHHHHHH
Q psy11785          2 GQTAVYTLGIPYIDDNVANRESPLYFAITIGVRILGPSLGFILGSFCTRLYVDLSIPSDITPSDPRWIGAWWLGLVLVAV   81 (308)
Q Consensus         2 G~a~~~~lg~a~i~d~~~~~~~~~~~gi~~~~~~~Gp~lG~~lGg~ll~~~v~~~~~~~~~~~~~~W~gaWw~~fii~g~   81 (308)
                      |.+..++...+++.|++|+++|++++|+...+..+|.++||++++++.+.+            +     .|+..|++.++
T Consensus       132 ~~~~~~~~~~~~i~~~~~~~~r~~~~~~~~~~~~~g~~~g~~~~~~l~~~~------------g-----~w~~~f~~~~~  194 (451)
T 1pw4_A          132 FQGMGWPPCGRTMVHWWSQKERGGIVSVWNCAHNVGGGIPPLLFLLGMAWF------------N-----DWHAALYMPAF  194 (451)
T ss_dssp             HHHHTHHHHHHHHHTTCTTTHHHHHHHHHHHHHHHHHTSHHHHHHHHHHHT------------C-----CSTTCTHHHHH
T ss_pred             HhhhccchHHHHHHHHCCchhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHh------------c-----cHHHHHHHHHH
Confidence            445677888999999999999999999999999999999999999987643            1     14455666666


Q ss_pred             HHHHHHHHH-HhccCCCCCCCCccCCcccccC-CCccc-cccCCCCCCcchHHHHHhhcChHHHHHHHHHHHHHHHHHHH
Q psy11785         82 FLMLAAVAM-FMFPKTLTKASPVNGTTTVATL-PTKKE-SNQKNPSLKDFPKAVKRLLKNDILMYRTASSVLHILPIAGL  158 (308)
Q Consensus        82 ~~ll~~i~~-~~~p~~~p~~~~~~~~~~~~~~-~~~~~-~~~~~~~~~~~~~~~~~Ll~n~~f~~~~l~~~~~~~~~~~~  158 (308)
                      +.++..+.. +..|++ |+..+.+..++.... ++..+ +++.+.+.++  ...++++|||.++...+..++.....+++
T Consensus       195 ~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  271 (451)
T 1pw4_A          195 CAILVALFAFAMMRDT-PQSCGLPPIEEYKNDYPDDYNEKAEQELTAKQ--IFMQYVLPNKLLWYIAIANVFVYLLRYGI  271 (451)
T ss_dssp             HHHHHHHHHHHHCCCS-STTTCCCSCTTTCCC-------------CCTH--HHHHHTSSCHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHhhccCC-HhhcCCCChhhhcccccccchhhhhccccccc--chHHHHHcCHHHHHHHHHHHHHHHHHHHH
Confidence            555554443 444543 322211111110000 00000 0001111121  22578899999999999988888999999


Q ss_pred             HhHHHHHHHHHhCCCcccccccchhhhhhhhHHHhhhhheehhhc
Q psy11785        159 YTFLPKYFETQFRLPSHTANMVSGVGGILVMGIGIILSGVFILKF  203 (308)
Q Consensus       159 ~~~~P~yl~~~~gls~~~agl~~g~~~i~~~~iG~~lgG~l~~r~  203 (308)
                      ..++|.|+++++|+++.+++++.....+ +.++|.++.|++.||+
T Consensus       272 ~~~~~~~~~~~~g~~~~~~~~~~~~~~~-~~~~~~~~~g~l~~~~  315 (451)
T 1pw4_A          272 LDWSPTYLKEVKHFALDKSSWAYFLYEY-AGIPGTLLCGWMSDKV  315 (451)
T ss_dssp             HHHHHHHBTTBSCCCHHHHHHHHHHHHH-HHHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHhcCCCHHHHHHHHHHHHH-HHHHHHHHHHHHHHHH
Confidence            9999999999999999999987765543 5678899999999998



>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>2erw_A Serine protease inhibitor infestin; kazal type domain, blood clotting, hydrolase inhibitor; 1.40A {Triatoma infestans} SCOP: g.68.1.1 Back     alignment and structure
>1ldt_L LDTI, tryptase inhibitor; complex (hydrolase/inhibitor), hydrolase, inflammation; 1.90A {Hirudo medicinalis} SCOP: g.68.1.1 PDB: 1an1_I 2kmo_A 2kmp_A 2kmq_A 2kmr_A Back     alignment and structure
>1pce_A PEC-60; proteinase inhibitor(kazal type); NMR {Sus scrofa} SCOP: g.68.1.1 Back     alignment and structure
>1y1b_A Elastase inhibitor; non-classical, kazal-type, protease inhibitor, CSH motif, hydrolase inhibitor; NMR {Synthetic} PDB: 1y1c_A Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure
>2f3c_I Thrombin inhibitor infestin; serine protease - inhibitor complex, kazal-type domain, hydrolase/hydrolase inhibitor complex; 2.50A {Triatoma infestans} SCOP: g.68.1.1 PDB: 1kma_A Back     alignment and structure
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
>1tgs_I Pancreatic secretory trypsin inhibitor (kazal type); complex (proteinase/inhibitor); 1.80A {Sus scrofa} SCOP: g.68.1.1 PDB: 1cgi_I 1hpt_A Back     alignment and structure
>1cgj_I Pancreatic secretory trypsin inhibitor (kazal type) variant 4; serine protease/inhibitor complex; 2.30A {Homo sapiens} SCOP: g.68.1.1 Back     alignment and structure
>1bus_A Proteinase inhibitor IIA; HET: PCA; NMR {Bos taurus} SCOP: g.68.1.1 PDB: 2bus_A* Back     alignment and structure
>1r0r_I Ovomucoid, omtky3; high resolution, serine protease, protein inhibitor, hydrolase; 1.10A {Meleagris gallopavo} SCOP: g.68.1.1 PDB: 1sgr_I 2gkr_I 1cho_I 1omt_A 1omu_A 1ppf_I* 1tur_A 1tus_A 3sgb_I 2ovo_A 4ovo_A 1iy5_A 1cso_I 1ct4_I 2sgf_I 2gkt_I 2gkv_A 2nu0_I 1m8b_A 1m8c_A ... Back     alignment and structure
>2jxd_A Serine protease inhibitor kazal-type 2; anti-parallel beta sheet, beta-bulge, disulfide bond, alpha helix, pyrrolidone carboxylic acid, secreted; NMR {Homo sapiens} Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure
>3pis_D Kazal-type serine protease inhibitor SPI-1; typical non-classical kazal type inhibitor fold; 2.00A {Carcinoscorpius rotundicauda} Back     alignment and structure
>1tbr_R RHODNIIN; complex (serine protease-inhibitor), kazal-type inhibitor, T complex (serine protease-inhibitor) complex; 2.60A {Rhodnius prolixus} SCOP: g.68.1.1 g.68.1.1 PDB: 1tbq_R Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure
>1h0z_A Serine protease inhibitor kazal-type 5, contains hemofiltrate peptide HF6478, hemofiltrate...; serine proteinase inhibitor; NMR {Homo sapiens} SCOP: g.68.1.2 Back     alignment and structure
>2leo_A Serine protease inhibitor kazal-type 7; esophageal cancer-related gene 2, hydrol inhibitor; NMR {Homo sapiens} Back     alignment and structure
>1lr7_A Follistatin, FS1; heparin-binding, cystine-rich, sucrose octasulphate, hormone/growth factor complex; HET: SO4; 1.50A {Rattus norvegicus} SCOP: g.3.11.3 g.68.1.1 PDB: 1lr8_A* 1lr9_A Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>1tbr_R RHODNIIN; complex (serine protease-inhibitor), kazal-type inhibitor, T complex (serine protease-inhibitor) complex; 2.60A {Rhodnius prolixus} SCOP: g.68.1.1 g.68.1.1 PDB: 1tbq_R Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure
>3qtl_D Kazal-type serine protease inhibitor SPI-1; serine protease -kazal type serine protease inhibitor comple hydrolase inhibitor; 2.60A {Carcinoscorpius rotundicauda} Back     alignment and structure
>3qtl_D Kazal-type serine protease inhibitor SPI-1; serine protease -kazal type serine protease inhibitor comple hydrolase inhibitor; 2.60A {Carcinoscorpius rotundicauda} Back     alignment and structure
>2arp_F Follistatin; cystine knot, disulfide rich, EGF domain, kazal domain, PROT complex, hormone-growth factor complex; HET: 1PG; 2.00A {Rattus norvegicus} Back     alignment and structure
>1hdl_A HF6478, serine proteinase inhibitor lekti; putative serine proteinase inhibitor; NMR {Homo sapiens} SCOP: g.68.1.2 PDB: 1uuc_A Back     alignment and structure
>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* Back     alignment and structure
>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>2arp_F Follistatin; cystine knot, disulfide rich, EGF domain, kazal domain, PROT complex, hormone-growth factor complex; HET: 1PG; 2.00A {Rattus norvegicus} Back     alignment and structure
>3sek_C Follistatin-related protein 3; protein-protein complex, TB domain, cystine knot motif, TGF- fold, disulfide linked dimer, follistatin domain (FSD); HET: NAG; 2.40A {Homo sapiens} PDB: 2kcx_A Back     alignment and structure
>1yu6_C Ovomucoid; protein proteinase inhibitor, protease, hydrolase; 1.55A {Meleagris gallopavo} SCOP: g.68.1.1 PDB: 1z7k_B* Back     alignment and structure
>1yu6_C Ovomucoid; protein proteinase inhibitor, protease, hydrolase; 1.55A {Meleagris gallopavo} SCOP: g.68.1.1 PDB: 1z7k_B* Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>3sek_C Follistatin-related protein 3; protein-protein complex, TB domain, cystine knot motif, TGF- fold, disulfide linked dimer, follistatin domain (FSD); HET: NAG; 2.40A {Homo sapiens} PDB: 2kcx_A Back     alignment and structure
>3b4v_C Follistatin-like 3; ligand-inhibitor signalling complex, cleavage on PAIR of BAS residues, glycoprotein, growth factor, hormone, secreted; HET: NAG; 2.48A {Homo sapiens} Back     alignment and structure
>3b4v_C Follistatin-like 3; ligand-inhibitor signalling complex, cleavage on PAIR of BAS residues, glycoprotein, growth factor, hormone, secreted; HET: NAG; 2.48A {Homo sapiens} Back     alignment and structure
>3hh2_C Follistatin; protein-protein complex, TB domain, cystine knot motif, TGF- fold, disulfide linked dimer, CLE PAIR of basic residues, cytokine; HET: CIT; 2.15A {Homo sapiens} PDB: 2b0u_C* 2p6a_D Back     alignment and structure
>3hh2_C Follistatin; protein-protein complex, TB domain, cystine knot motif, TGF- fold, disulfide linked dimer, CLE PAIR of basic residues, cytokine; HET: CIT; 2.15A {Homo sapiens} PDB: 2b0u_C* 2p6a_D Back     alignment and structure
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
>3tjq_A Serine protease HTRA1; hydrolase; 2.00A {Homo sapiens} Back     alignment and structure
>4gi3_C Greglin; kazal type inhibitor, hydrolase-hydrolase inhibitor complex; 1.75A {Schistocerca gregaria} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 308
d1ldtl_46 g.68.1.1 (L:) Leech derived tryptase inhibitor (LD 4e-10
d2erwa153 g.68.1.1 (A:4-56) Blood-sucking insect-derived try 1e-08
d2f3ci146 g.68.1.1 (I:5-50) Blood-sucking insect-derived try 6e-08
d1tbrr252 g.68.1.1 (R:52-103) Blood-sucking insect-derived t 8e-07
d1nuba358 g.68.1.1 (A:78-135) Domain of BM-40/SPARC/osteonec 4e-06
d1pcea_60 g.68.1.1 (A:) PEC-60 peptide {Pig (Sus scrofa) [Ta 2e-05
d1lr7a248 g.68.1.1 (A:89-136) Domain of follistatin {Rat (Ra 7e-05
d1hpta_56 g.68.1.1 (A:) Secretory trypsin inhibitor {Human ( 1e-04
d1tgsi_56 g.68.1.1 (I:) Secretory trypsin inhibitor {Pig (Su 1e-04
d2busa_57 g.68.1.1 (A:) Seminal plasma inhibitor IIa {Cow (B 7e-04
d1z7kb162 g.68.1.1 (B:2-63) Ovomucoid domains {Turkey (Melea 8e-04
d1r0ri_51 g.68.1.1 (I:) Ovomucoid domains {Turkey (Meleagris 0.001
d1h0za_68 g.68.1.2 (A:) Serine proteinase inhibitor lekti {H 0.003
>d1ldtl_ g.68.1.1 (L:) Leech derived tryptase inhibitor (LDTI-C) {Medicinal leech (Hirudo medicinalis) [TaxId: 6421]} Length = 46 Back     information, alignment and structure

class: Small proteins
fold: Kazal-type serine protease inhibitors
superfamily: Kazal-type serine protease inhibitors
family: Ovomucoid domain III-like
domain: Leech derived tryptase inhibitor (LDTI-C)
species: Medicinal leech (Hirudo medicinalis) [TaxId: 6421]
 Score = 52.1 bits (125), Expect = 4e-10
 Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 1/33 (3%)

Query: 259 GCECDHSKFNPICGGDGRTYFSACHAGCQNISS 291
            C C      P+CG DGRTY ++C A C  +S 
Sbjct: 3   VCACPKI-LKPVCGSDGRTYANSCIARCNGVSI 34


>d2erwa1 g.68.1.1 (A:4-56) Blood-sucking insect-derived tryptase inhibitor {Triatoma infestans [TaxId: 30076]} Length = 53 Back     information, alignment and structure
>d2f3ci1 g.68.1.1 (I:5-50) Blood-sucking insect-derived tryptase inhibitor {Triatoma infestans [TaxId: 30076]} Length = 46 Back     information, alignment and structure
>d1tbrr2 g.68.1.1 (R:52-103) Blood-sucking insect-derived tryptase inhibitor {Bug (Rhodnius prolixus), rhodniin [TaxId: 13249]} Length = 52 Back     information, alignment and structure
>d1nuba3 g.68.1.1 (A:78-135) Domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1pcea_ g.68.1.1 (A:) PEC-60 peptide {Pig (Sus scrofa) [TaxId: 9823]} Length = 60 Back     information, alignment and structure
>d1lr7a2 g.68.1.1 (A:89-136) Domain of follistatin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 48 Back     information, alignment and structure
>d1hpta_ g.68.1.1 (A:) Secretory trypsin inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1tgsi_ g.68.1.1 (I:) Secretory trypsin inhibitor {Pig (Sus scrofa) [TaxId: 9823]} Length = 56 Back     information, alignment and structure
>d2busa_ g.68.1.1 (A:) Seminal plasma inhibitor IIa {Cow (Bos taurus) [TaxId: 9913]} Length = 57 Back     information, alignment and structure
>d1z7kb1 g.68.1.1 (B:2-63) Ovomucoid domains {Turkey (Meleagris gallopavo) [TaxId: 9103]} Length = 62 Back     information, alignment and structure
>d1r0ri_ g.68.1.1 (I:) Ovomucoid domains {Turkey (Meleagris gallopavo) [TaxId: 9103]} Length = 51 Back     information, alignment and structure
>d1h0za_ g.68.1.2 (A:) Serine proteinase inhibitor lekti {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query308
d1pw4a_447 Glycerol-3-phosphate transporter {Escherichia coli 99.63
d1ldtl_46 Leech derived tryptase inhibitor (LDTI-C) {Medicin 99.33
d2erwa153 Blood-sucking insect-derived tryptase inhibitor {T 99.01
d2f3ci146 Blood-sucking insect-derived tryptase inhibitor {T 98.86
d1lr7a248 Domain of follistatin {Rat (Rattus norvegicus) [Ta 98.43
d1tbrr252 Blood-sucking insect-derived tryptase inhibitor {B 98.39
d1pv7a_ 417 Lactose permease {Escherichia coli [TaxId: 562]} 98.28
d1nuba358 Domain of BM-40/SPARC/osteonectin {Human (Homo sap 98.1
d1z7kb162 Ovomucoid domains {Turkey (Meleagris gallopavo) [T 97.85
d1r0ri_51 Ovomucoid domains {Turkey (Meleagris gallopavo) [T 97.85
d1pv7a_417 Lactose permease {Escherichia coli [TaxId: 562]} 97.83
d2busa_57 Seminal plasma inhibitor IIa {Cow (Bos taurus) [Ta 97.82
d1pcea_60 PEC-60 peptide {Pig (Sus scrofa) [TaxId: 9823]} 97.8
d1tgsi_56 Secretory trypsin inhibitor {Pig (Sus scrofa) [Tax 97.79
d1hpta_56 Secretory trypsin inhibitor {Human (Homo sapiens) 97.76
d1h0za_68 Serine proteinase inhibitor lekti {Human (Homo sap 97.38
d1pw4a_ 447 Glycerol-3-phosphate transporter {Escherichia coli 96.44
d1hdla_55 Serine proteinase inhibitor lekti {Human (Homo sap 95.88
d1n1ua_29 Kalata B1 {African plant (Oldenlandia affinis) [Ta 81.35
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: MFS general substrate transporter
superfamily: MFS general substrate transporter
family: Glycerol-3-phosphate transporter
domain: Glycerol-3-phosphate transporter
species: Escherichia coli [TaxId: 562]
Probab=99.63  E-value=3e-16  Score=144.21  Aligned_cols=190  Identities=13%  Similarity=0.074  Sum_probs=134.2

Q ss_pred             ccccccccchhhhcCccCCCCchhHHHHHHHHHHHHHHHHHHHHHhhhcccccCCCCCCCCCCCCchhHHHHHHHHHHHH
Q psy11785          2 GQTAVYTLGIPYIDDNVANRESPLYFAITIGVRILGPSLGFILGSFCTRLYVDLSIPSDITPSDPRWIGAWWLGLVLVAV   81 (308)
Q Consensus         2 G~a~~~~lg~a~i~d~~~~~~~~~~~gi~~~~~~~Gp~lG~~lGg~ll~~~v~~~~~~~~~~~~~~W~gaWw~~fii~g~   81 (308)
                      |.+..++...+++.|++|+++|++++|++..+..+|.++||++++.+...+.                 .|+..|++.++
T Consensus       129 ~~~~~~~~~~~~i~~~~~~~~r~~~~~~~~~~~~~g~~i~~~~~~~~~~~~~-----------------~w~~~~~~~~~  191 (447)
T d1pw4a_         129 FQGMGWPPCGRTMVHWWSQKERGGIVSVWNCAHNVGGGIPPLLFLLGMAWFN-----------------DWHAALYMPAF  191 (447)
T ss_dssp             HHHHTHHHHHHHHHTTCTTTHHHHHHHHHHHHHHHHHTSHHHHHHHHHHHTC-----------------CSTTCTHHHHH
T ss_pred             hhhhhhhHHHHHHHHHHHhhcccccccccccccchhhhhhhhhhhhHhhhhh-----------------cccccchhhhh
Confidence            3456778889999999999999999999999999999999999998876432                 24555666666


Q ss_pred             HHHHHHHHHHhccCCCCCCCCccCCcccccCCCccccccCCCCCCcchHHHHHhhcChHHHHHHHHHHHHHHHHHHHHhH
Q psy11785         82 FLMLAAVAMFMFPKTLTKASPVNGTTTVATLPTKKESNQKNPSLKDFPKAVKRLLKNDILMYRTASSVLHILPIAGLYTF  161 (308)
Q Consensus        82 ~~ll~~i~~~~~p~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Ll~n~~f~~~~l~~~~~~~~~~~~~~~  161 (308)
                      +.++.++..+.++++.|+.......++.+.......+++.+++........+++++|+.++...+..++.....+++.++
T Consensus       192 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  271 (447)
T d1pw4a_         192 CAILVALFAFAMMRDTPQSCGLPPIEEYKNDYPDDYNEKAEQELTAKQIFMQYVLPNKLLWYIAIANVFVYLLRYGILDW  271 (447)
T ss_dssp             HHHHHHHHHHHHCCCSSTTTCCCSCTTTCCC-------------CCTHHHHHHTSSCHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             hHHHHHHHHHHhcccchhhcccchhhhhhhhcccchhhccccccchhhHHHHHHHcCchHHHHHHHhhhhhhhhhcchhh
Confidence            66666666666666666544322111100000000001111112223345678999999999988889999999999999


Q ss_pred             HHHHHHHHhCCCcccccccchhhhhhhhHHHhhhhheehhhccCCccc
Q psy11785        162 LPKYFETQFRLPSHTANMVSGVGGILVMGIGIILSGVFILKFKPNARF  209 (308)
Q Consensus       162 ~P~yl~~~~gls~~~agl~~g~~~i~~~~iG~~lgG~l~~r~~~~~~~  209 (308)
                      +|.|+++.++++..++++......+ ..++|.+++|++.||++++.+.
T Consensus       272 ~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~g~~~~~~~~~~~~  318 (447)
T d1pw4a_         272 SPTYLKEVKHFALDKSSWAYFLYEY-AGIPGTLLCGWMSDKVFRGNRG  318 (447)
T ss_dssp             HHHHBTTBSCCCHHHHHHHHHHHHH-HHHHHHHHHHHHHHHTSTTCHH
T ss_pred             hhhhcccccccccchhhhhhhcchh-hhhhhhhhhhhhhhhccccccc
Confidence            9999999999999999887765543 5678999999999999866443



>d1ldtl_ g.68.1.1 (L:) Leech derived tryptase inhibitor (LDTI-C) {Medicinal leech (Hirudo medicinalis) [TaxId: 6421]} Back     information, alignment and structure
>d2erwa1 g.68.1.1 (A:4-56) Blood-sucking insect-derived tryptase inhibitor {Triatoma infestans [TaxId: 30076]} Back     information, alignment and structure
>d2f3ci1 g.68.1.1 (I:5-50) Blood-sucking insect-derived tryptase inhibitor {Triatoma infestans [TaxId: 30076]} Back     information, alignment and structure
>d1lr7a2 g.68.1.1 (A:89-136) Domain of follistatin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tbrr2 g.68.1.1 (R:52-103) Blood-sucking insect-derived tryptase inhibitor {Bug (Rhodnius prolixus), rhodniin [TaxId: 13249]} Back     information, alignment and structure
>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nuba3 g.68.1.1 (A:78-135) Domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7kb1 g.68.1.1 (B:2-63) Ovomucoid domains {Turkey (Meleagris gallopavo) [TaxId: 9103]} Back     information, alignment and structure
>d1r0ri_ g.68.1.1 (I:) Ovomucoid domains {Turkey (Meleagris gallopavo) [TaxId: 9103]} Back     information, alignment and structure
>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2busa_ g.68.1.1 (A:) Seminal plasma inhibitor IIa {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pcea_ g.68.1.1 (A:) PEC-60 peptide {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1tgsi_ g.68.1.1 (I:) Secretory trypsin inhibitor {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1hpta_ g.68.1.1 (A:) Secretory trypsin inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h0za_ g.68.1.2 (A:) Serine proteinase inhibitor lekti {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hdla_ g.68.1.2 (A:) Serine proteinase inhibitor lekti {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n1ua_ g.3.3.1 (A:) Kalata B1 {African plant (Oldenlandia affinis) [TaxId: 60225]} Back     information, alignment and structure