Psyllid ID: psy11785
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 308 | ||||||
| 380012470 | 739 | PREDICTED: solute carrier organic anion | 0.948 | 0.395 | 0.696 | 1e-121 | |
| 340718289 | 741 | PREDICTED: solute carrier organic anion | 0.948 | 0.394 | 0.689 | 1e-121 | |
| 328781181 | 741 | PREDICTED: solute carrier organic anion | 0.948 | 0.394 | 0.692 | 1e-121 | |
| 350409868 | 741 | PREDICTED: solute carrier organic anion | 0.948 | 0.394 | 0.689 | 1e-121 | |
| 307192330 | 739 | Solute carrier organic anion transporter | 0.948 | 0.395 | 0.696 | 1e-120 | |
| 307187458 | 759 | Solute carrier organic anion transporter | 0.928 | 0.376 | 0.7 | 1e-120 | |
| 383849071 | 745 | PREDICTED: solute carrier organic anion | 0.948 | 0.391 | 0.686 | 1e-119 | |
| 242025588 | 864 | conserved hypothetical protein [Pediculu | 0.931 | 0.332 | 0.730 | 1e-117 | |
| 332016585 | 741 | Solute carrier organic anion transporter | 0.928 | 0.385 | 0.680 | 1e-116 | |
| 345483393 | 753 | PREDICTED: solute carrier organic anion | 0.944 | 0.386 | 0.651 | 1e-113 |
| >gi|380012470|ref|XP_003690304.1| PREDICTED: solute carrier organic anion transporter family member 3A1-like [Apis florea] | Back alignment and taxonomy information |
|---|
Score = 441 bits (1133), Expect = e-121, Method: Compositional matrix adjust.
Identities = 213/306 (69%), Positives = 250/306 (81%), Gaps = 14/306 (4%)
Query: 1 MGQTAVYTLGIPYIDDNVANRESPLYFAITIGVRILGPSLGFILGSFCTRLYVDLSIPSD 60
MGQTAVYTLGIPYIDDNVA+RESPLYFAITIGVRILGP+LGFILGS CT +Y DLS
Sbjct: 275 MGQTAVYTLGIPYIDDNVASRESPLYFAITIGVRILGPALGFILGSLCTMIYADLSANPQ 334
Query: 61 ITPSDPRWIGAWWLGLVLVAVFLMLAAVAMFMFPKTLTKASPVNGTTTVATLPTKKESNQ 120
ITP+DPRW+GAWWLGLVL+A LML ++ MF FP L A+ K ++
Sbjct: 335 ITPTDPRWVGAWWLGLVLIAAMLMLVSIGMFAFPTRLP-----------ASRTPPKRADA 383
Query: 121 KNPSLKDFPKAVKRLLKNDILMYRTASSVLHILPIAGLYTFLPKYFETQFRLPSHTANMV 180
K PSL+DFPKAVKRLLKNDILM+RTASSVLHILPIAGLYTFLPKY E+QFRLP+H ANM+
Sbjct: 384 KKPSLRDFPKAVKRLLKNDILMFRTASSVLHILPIAGLYTFLPKYLESQFRLPAHHANMI 443
Query: 181 SGVGGILVMGIGIILSGVFILKFKPNARFVAAWIAITAVLYALGMGILTFIGCPMDEWAG 240
SGVGGILVMG+GII+SGVFIL+ KPNARFVAAWIA TAV+YA+GMG+L FIGCPMD++AG
Sbjct: 444 SGVGGILVMGLGIIISGVFILRAKPNARFVAAWIAFTAVIYAIGMGVLMFIGCPMDDFAG 503
Query: 241 L-TNANGISSFEPMCATTHGCECDHSKFNPICGGDGRTYFSACHAGCQNISSIDGKVQTL 299
L ++++G+SSFEP C T C+C +KF+PICG DG+TYFSACHAGC N + +DGKV +
Sbjct: 504 LVSHSDGLSSFEPTCEAT--CDCVRNKFSPICGADGKTYFSACHAGCSNYTIVDGKVASF 561
Query: 300 LFIEAI 305
+ I
Sbjct: 562 YNCQCI 567
|
Source: Apis florea Species: Apis florea Genus: Apis Family: Apidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|340718289|ref|XP_003397602.1| PREDICTED: solute carrier organic anion transporter family member 3A1-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|328781181|ref|XP_003249934.1| PREDICTED: solute carrier organic anion transporter family member 3A1-like [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|350409868|ref|XP_003488870.1| PREDICTED: solute carrier organic anion transporter family member 3A1-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|307192330|gb|EFN75596.1| Solute carrier organic anion transporter family member 3A1 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|307187458|gb|EFN72542.1| Solute carrier organic anion transporter family member 3A1 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|383849071|ref|XP_003700170.1| PREDICTED: solute carrier organic anion transporter family member 3A1-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|242025588|ref|XP_002433206.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212518747|gb|EEB20468.1| conserved hypothetical protein [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|332016585|gb|EGI57466.1| Solute carrier organic anion transporter family member 3A1 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|345483393|ref|XP_003424809.1| PREDICTED: solute carrier organic anion transporter family member 4C1-like isoform 2 [Nasonia vitripennis] gi|345483395|ref|XP_001601987.2| PREDICTED: solute carrier organic anion transporter family member 4C1-like isoform 1 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 308 | ||||||
| FB|FBgn0036732 | 819 | Oatp74D "Organic anion transpo | 0.922 | 0.346 | 0.529 | 1.9e-74 | |
| FB|FBgn0034716 | 789 | Oatp58Dc "Organic anion transp | 0.587 | 0.229 | 0.302 | 1.4e-41 | |
| FB|FBgn0050277 | 684 | Oatp58Da "Organic anion transp | 0.902 | 0.406 | 0.324 | 1.7e-39 | |
| UNIPROTKB|F1N3T5 | 716 | SLCO4C1 "Uncharacterized prote | 0.957 | 0.412 | 0.316 | 1.3e-38 | |
| UNIPROTKB|F1RN62 | 718 | SLCO4C1 "Uncharacterized prote | 0.957 | 0.410 | 0.320 | 3.6e-38 | |
| UNIPROTKB|J9NWB2 | 591 | SLCO4C1 "Uncharacterized prote | 0.938 | 0.489 | 0.326 | 8.4e-38 | |
| MGI|MGI:1351867 | 710 | Slco3a1 "solute carrier organi | 0.399 | 0.173 | 0.406 | 9.7e-38 | |
| UNIPROTKB|F1Q4E0 | 617 | SLCO4C1 "Uncharacterized prote | 0.938 | 0.468 | 0.326 | 1.4e-37 | |
| UNIPROTKB|F1NSG0 | 709 | SLCO3A1 "Uncharacterized prote | 0.399 | 0.173 | 0.406 | 1.6e-37 | |
| UNIPROTKB|F1Q3M7 | 692 | SLCO3A1 "Uncharacterized prote | 0.399 | 0.177 | 0.406 | 2.3e-37 |
| FB|FBgn0036732 Oatp74D "Organic anion transporting polypeptide 74D" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 751 (269.4 bits), Expect = 1.9e-74, P = 1.9e-74
Identities = 155/293 (52%), Positives = 183/293 (62%)
Query: 1 MGQTAVYTLGIPYIDDNVANRESPLYFAITIGVRILGPSLGFILGSFCTRLYVDLSIPSD 60
+GQTAV TLGIPYIDDNV +++SP+Y A+TIG+RILGP+ GFI GSFCTR YV+ S P
Sbjct: 348 IGQTAVATLGIPYIDDNVGSKQSPMYMAVTIGMRILGPASGFIFGSFCTRWYVNFSNPG- 406
Query: 61 ITPSDPRWIGAWWLGXXXXXXXXXXXXXXXXXXPKTLT-KASPVNGTTTVATLPTKKESN 119
+DPRWIGAWWLG PK L K P T T A P + E
Sbjct: 407 FDATDPRWIGAWWLGPVAIGSLMLLASIAMFSFPKQLRGKQKPPGQTATPAA-PVEPE-- 463
Query: 120 QKNPSLKDFPKAVKRLLKNDILMYRTASSVLHILPIAGLYTFLPKYFETQFRLPSHTANX 179
+ P LKDFPK V+R L NDILM+RTAS V H+LPIAGLYTFLPKY ETQFRL ++ AN
Sbjct: 464 -EKPKLKDFPKTVRRQLSNDILMFRTASCVFHLLPIAGLYTFLPKYLETQFRLATYDANM 522
Query: 180 XXXXXXXXXXXXXXXXXXXFILKFKPNARFVAAWIAITAVLYALGMGILTFIGCPMDEWA 239
FILK KP AR VAAWIA TA++Y+ GM IL FIGC M+++A
Sbjct: 523 IAAFCGILVMGIGIVISGLFILKRKPTARGVAAWIAFTALVYSAGMIILMFIGCSMNDFA 582
Query: 240 GLTNANGISS--FEPMCATTHGCECDHSKFNPICGGDGRTYFSACHAGCQNIS 290
G ++G S EP C+ C CD F PIC DG+ Y SACHAGC + S
Sbjct: 583 GYKPSDGNSPALIEPTCSAALNCTCDKENFAPICA-DGKMYISACHAGCSSSS 634
|
|
| FB|FBgn0034716 Oatp58Dc "Organic anion transporting polypeptide 58Dc" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0050277 Oatp58Da "Organic anion transporting polypeptide 58Da" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N3T5 SLCO4C1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RN62 SLCO4C1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9NWB2 SLCO4C1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1351867 Slco3a1 "solute carrier organic anion transporter family, member 3a1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1Q4E0 SLCO4C1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NSG0 SLCO3A1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1Q3M7 SLCO3A1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 308 | |||
| pfam03137 | 582 | pfam03137, OATP, Organic Anion Transporter Polypep | 1e-100 | |
| TIGR00805 | 633 | TIGR00805, oat, sodium-independent organic anion t | 2e-69 | |
| cd01330 | 54 | cd01330, KAZAL_SLC21, The kazal-type serine protea | 3e-12 | |
| pfam07648 | 42 | pfam07648, Kazal_2, Kazal-type serine protease inh | 8e-08 | |
| cd00104 | 41 | cd00104, KAZAL_FS, Kazal type serine protease inhi | 2e-06 | |
| smart00280 | 46 | smart00280, KAZAL, Kazal type serine protease inhi | 8e-04 |
| >gnl|CDD|217384 pfam03137, OATP, Organic Anion Transporter Polypeptide (OATP) family | Back alignment and domain information |
|---|
Score = 304 bits (782), Expect = e-100
Identities = 124/310 (40%), Positives = 165/310 (53%), Gaps = 21/310 (6%)
Query: 1 MGQTAVYTLGIPYIDDNVANRESPLYFAITIGVRILGPSLGFILGSFCTRLYVDLSIPSD 60
+G T ++TLGI YIDDNV ++ SPLY I + + GP++GF+LGSFC RLYVD
Sbjct: 151 IGATPIFTLGISYIDDNVKSKNSPLYLGILFTMAMFGPAIGFLLGSFCLRLYVDFGRVPT 210
Query: 61 ----ITPSDPRWIGAWWLGLVLVAVFLMLAAVAMFMFPKTLTKASPVNGTTTVATLPTKK 116
ITP+DPRW+GAWWLG ++ +L+A+ F FPKTL KA + + P K
Sbjct: 211 EDVIITPTDPRWVGAWWLGFLVCGGLALLSAIPFFFFPKTLPKAQGRLESLD-LSRPKAK 269
Query: 117 ESNQKNPS-----------LKDFPKAVKRLLKNDILMYRTASSVLHILPIAGLYTFLPKY 165
+ +K LKDFPK +KRLL N M + V IAG TFLPKY
Sbjct: 270 DETRKQAEEPKSGKSAPDFLKDFPKTLKRLLTNPTFMLVVLAQVFESSVIAGYSTFLPKY 329
Query: 166 FETQFRLPSHTANMVSGVGGILVMGIGIILSGVFILKFKPNARFVAAWIAITAVLYALGM 225
ETQ+ L + AN + GV + +GI+L G+ I KFK AR +A + ++
Sbjct: 330 LETQYGLSASYANFLIGVVNLPAAAVGILLGGLIIKKFKLTARGMAKFAIFVILVSLAFY 389
Query: 226 GILTFIGCPMDEWAGLTNANGISS-----FEPMCATTHGCECDHSKFNPICGGDGRTYFS 280
FIGC AG+T + S EP+ + C CD S F P+CG +G TY S
Sbjct: 390 LPYFFIGCENSPVAGVTPSYENSPSDSHHLEPLSSCNEDCSCDTSFFPPVCGDNGLTYLS 449
Query: 281 ACHAGCQNIS 290
CHAG +
Sbjct: 450 PCHAGSSSSG 459
|
This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs). Several have been identified mostly in human and rat. Different OATPs vary in tissue distribution and substrate specificity. Since the numbering of different OATPs in particular species was based originally on the order of discovery, similarly numbered OATPs in humans and rats did not necessarily correspond in function, tissue distribution and substrate specificity (in spite of the name, some OATPs also transport organic cations and neutral molecules). Thus, Tamai et al. initiated the current scheme of using digits for rat OATPs and letters for human ones. Prostaglandin transporter (PGT) proteins are also considered to be OATP family members. In addition, the methotrexate transporter OATK is closely related to OATPs. This family also includes several predicted proteins from Caenorhabditis elegans and Drosophila melanogaster. This similarity was not previously noted. Note: Members of this family are described (in the Swiss-Prot database) as belonging to the SLC21 family of transporters. Length = 582 |
| >gnl|CDD|233136 TIGR00805, oat, sodium-independent organic anion transporter | Back alignment and domain information |
|---|
| >gnl|CDD|238650 cd01330, KAZAL_SLC21, The kazal-type serine protease inhibitor domain has been detected in an extracellular loop region of solute carrier 21 (SLC21) family members (organic anion transporters) , which may regulate the specificity of anion uptake | Back alignment and domain information |
|---|
| >gnl|CDD|191798 pfam07648, Kazal_2, Kazal-type serine protease inhibitor domain | Back alignment and domain information |
|---|
| >gnl|CDD|238052 cd00104, KAZAL_FS, Kazal type serine protease inhibitors and follistatin-like domains | Back alignment and domain information |
|---|
| >gnl|CDD|197624 smart00280, KAZAL, Kazal type serine protease inhibitors | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 308 | |||
| KOG3626|consensus | 735 | 100.0 | ||
| TIGR00805 | 633 | oat sodium-independent organic anion transporter. | 100.0 | |
| PF03137 | 539 | OATP: Organic Anion Transporter Polypeptide (OATP) | 100.0 | |
| cd01330 | 54 | KAZAL_SLC21 The kazal-type serine protease inhibit | 99.85 | |
| KOG2532|consensus | 466 | 99.68 | ||
| KOG1330|consensus | 493 | 99.67 | ||
| TIGR00894 | 465 | 2A0114euk Na(+)-dependent inorganic phosphate cotr | 99.67 | |
| PRK09556 | 467 | uhpT sugar phosphate antiporter; Reviewed | 99.64 | |
| TIGR00893 | 399 | 2A0114 d-galactonate transporter. | 99.61 | |
| COG2271 | 448 | UhpC Sugar phosphate permease [Carbohydrate transp | 99.6 | |
| PRK11663 | 434 | regulatory protein UhpC; Provisional | 99.59 | |
| TIGR00881 | 379 | 2A0104 phosphoglycerate transporter family protein | 99.58 | |
| TIGR00712 | 438 | glpT glycerol-3-phosphate transporter. This model | 99.56 | |
| TIGR00710 | 385 | efflux_Bcr_CflA drug resistance transporter, Bcr/C | 99.53 | |
| COG2814 | 394 | AraJ Arabinose efflux permease [Carbohydrate trans | 99.52 | |
| TIGR00903 | 368 | 2A0129 major facilitator 4 family protein. This fa | 99.51 | |
| PRK10406 | 432 | alpha-ketoglutarate transporter; Provisional | 99.51 | |
| TIGR00901 | 356 | 2A0125 AmpG-related permease. | 99.5 | |
| TIGR02332 | 412 | HpaX 4-hydroxyphenylacetate permease. This protein | 99.5 | |
| PRK03545 | 390 | putative arabinose transporter; Provisional | 99.49 | |
| PRK11102 | 377 | bicyclomycin/multidrug efflux system; Provisional | 99.48 | |
| PRK14995 | 495 | methyl viologen resistance protein SmvA; Provision | 99.47 | |
| COG2223 | 417 | NarK Nitrate/nitrite transporter [Inorganic ion tr | 99.47 | |
| PRK11195 | 393 | lysophospholipid transporter LplT; Provisional | 99.47 | |
| TIGR00900 | 365 | 2A0121 H+ Antiporter protein. | 99.46 | |
| PRK11273 | 452 | glpT sn-glycerol-3-phosphate transporter; Provisio | 99.46 | |
| PRK11902 | 402 | ampG muropeptide transporter; Reviewed | 99.46 | |
| TIGR00711 | 485 | efflux_EmrB drug resistance transporter, EmrB/QacA | 99.46 | |
| TIGR00886 | 366 | 2A0108 nitrite extrusion protein (nitrite facilita | 99.46 | |
| PRK11010 | 491 | ampG muropeptide transporter; Validated | 99.45 | |
| PRK15402 | 406 | multidrug efflux system translocase MdfA; Provisio | 99.45 | |
| PLN00028 | 476 | nitrate transmembrane transporter; Provisional | 99.44 | |
| PF07690 | 352 | MFS_1: Major Facilitator Superfamily; InterPro: IP | 99.43 | |
| KOG2533|consensus | 495 | 99.43 | ||
| PRK15403 | 413 | multidrug efflux system protein MdtM; Provisional | 99.43 | |
| TIGR00897 | 402 | 2A0118 polyol permease family. This family of prot | 99.42 | |
| PRK09705 | 393 | cynX putative cyanate transporter; Provisional | 99.41 | |
| PRK06814 | 1140 | acylglycerophosphoethanolamine acyltransferase; Pr | 99.41 | |
| PRK10473 | 392 | multidrug efflux system protein MdtL; Provisional | 99.41 | |
| TIGR00883 | 394 | 2A0106 metabolite-proton symporter. This model rep | 99.4 | |
| PRK10642 | 490 | proline/glycine betaine transporter; Provisional | 99.39 | |
| PRK10213 | 394 | nepI ribonucleoside transporter; Reviewed | 99.38 | |
| PRK10133 | 438 | L-fucose transporter; Provisional | 99.38 | |
| TIGR01272 | 310 | gluP glucose/galactose transporter. Disruption of | 99.38 | |
| PRK10091 | 382 | MFS transport protein AraJ; Provisional | 99.38 | |
| PRK03699 | 394 | putative transporter; Provisional | 99.37 | |
| PRK10489 | 417 | enterobactin exporter EntS; Provisional | 99.37 | |
| TIGR00902 | 382 | 2A0127 phenyl proprionate permease family protein. | 99.37 | |
| PRK09952 | 438 | shikimate transporter; Provisional | 99.36 | |
| PRK11128 | 382 | putative 3-phenylpropionic acid transporter; Provi | 99.35 | |
| TIGR00892 | 455 | 2A0113 monocarboxylate transporter 1. | 99.35 | |
| PRK11043 | 401 | putative transporter; Provisional | 99.35 | |
| TIGR00895 | 398 | 2A0115 benzoate transport. | 99.34 | |
| TIGR00891 | 405 | 2A0112 putative sialic acid transporter. | 99.34 | |
| PRK08633 | 1146 | 2-acyl-glycerophospho-ethanolamine acyltransferase | 99.33 | |
| TIGR00896 | 355 | CynX cyanate transporter. This family of proteins | 99.32 | |
| PRK15075 | 434 | citrate-proton symporter; Provisional | 99.32 | |
| PRK12307 | 426 | putative sialic acid transporter; Provisional | 99.31 | |
| PRK11551 | 406 | putative 3-hydroxyphenylpropionic transporter MhpT | 99.3 | |
| TIGR00890 | 377 | 2A0111 Oxalate/Formate Antiporter. | 99.29 | |
| TIGR00899 | 375 | 2A0120 sugar efflux transporter. This family of pr | 99.28 | |
| PRK10504 | 471 | putative transporter; Provisional | 99.26 | |
| TIGR02718 | 390 | sider_RhtX_FptX siderophore transporter, RhtX/FptX | 99.23 | |
| PRK15011 | 393 | sugar efflux transporter B; Provisional | 99.23 | |
| PRK11652 | 394 | emrD multidrug resistance protein D; Provisional | 99.22 | |
| PRK11646 | 400 | multidrug resistance protein MdtH; Provisional | 99.2 | |
| TIGR00879 | 481 | SP MFS transporter, sugar porter (SP) family. This | 99.2 | |
| TIGR00887 | 502 | 2A0109 phosphate:H+ symporter. This model represen | 99.19 | |
| TIGR00885 | 410 | fucP L-fucose:H+ symporter permease. This family d | 99.19 | |
| PRK03633 | 381 | putative MFS family transporter protein; Provision | 99.19 | |
| PRK15034 | 462 | nitrate/nitrite transport protein NarU; Provisiona | 99.18 | |
| PRK10077 | 479 | xylE D-xylose transporter XylE; Provisional | 99.17 | |
| cd06174 | 352 | MFS The Major Facilitator Superfamily (MFS) is a l | 99.07 | |
| PRK09874 | 408 | drug efflux system protein MdtG; Provisional | 99.05 | |
| PRK03893 | 496 | putative sialic acid transporter; Provisional | 99.01 | |
| PRK09528 | 420 | lacY galactoside permease; Reviewed | 99.01 | |
| TIGR00882 | 396 | 2A0105 oligosaccharide:H+ symporter. | 99.0 | |
| TIGR00792 | 437 | gph sugar (Glycoside-Pentoside-Hexuronide) transpo | 98.99 | |
| TIGR01299 | 742 | synapt_SV2 synaptic vesicle protein SV2. This mode | 98.97 | |
| COG0738 | 422 | FucP Fucose permease [Carbohydrate transport and m | 98.95 | |
| PRK10054 | 395 | putative transporter; Provisional | 98.95 | |
| PRK05122 | 399 | major facilitator superfamily transporter; Provisi | 98.93 | |
| TIGR00898 | 505 | 2A0119 cation transport protein. | 98.92 | |
| PRK12382 | 392 | putative transporter; Provisional | 98.89 | |
| cd00104 | 41 | KAZAL_FS Kazal type serine protease inhibitors and | 98.89 | |
| PF05977 | 524 | MFS_3: Transmembrane secretion effector; InterPro: | 98.87 | |
| COG2807 | 395 | CynX Cyanate permease [Inorganic ion transport and | 98.78 | |
| PRK10207 | 489 | dipeptide/tripeptide permease B; Provisional | 98.76 | |
| KOG3764|consensus | 464 | 98.71 | ||
| PF13347 | 428 | MFS_2: MFS/sugar transport protein | 98.67 | |
| KOG2504|consensus | 509 | 98.66 | ||
| PF11700 | 477 | ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 | 98.66 | |
| KOG2563|consensus | 480 | 98.66 | ||
| KOG2615|consensus | 451 | 98.64 | ||
| PF03209 | 403 | PUCC: PUCC protein; InterPro: IPR004896 This prote | 98.59 | |
| TIGR00889 | 418 | 2A0110 nucleoside transporter. This family of prot | 98.5 | |
| PRK09848 | 448 | glucuronide transporter; Provisional | 98.43 | |
| cd01327 | 45 | KAZAL_PSTI Kazal-type pancreatic secretory trypsin | 98.42 | |
| PRK09669 | 444 | putative symporter YagG; Provisional | 98.38 | |
| PRK11462 | 460 | putative transporter; Provisional | 98.37 | |
| TIGR00924 | 475 | yjdL_sub1_fam amino acid/peptide transporter (Pept | 98.37 | |
| PRK10429 | 473 | melibiose:sodium symporter; Provisional | 98.28 | |
| KOG0569|consensus | 485 | 98.26 | ||
| TIGR00806 | 511 | rfc RFC reduced folate carrier. Proteins of the RF | 98.23 | |
| KOG0254|consensus | 513 | 98.18 | ||
| PF07648 | 42 | Kazal_2: Kazal-type serine protease inhibitor doma | 98.18 | |
| TIGR01301 | 477 | GPH_sucrose GPH family sucrose/H+ symporter. This | 98.09 | |
| COG2211 | 467 | MelB Na+/melibiose symporter and related transport | 98.05 | |
| PF00083 | 451 | Sugar_tr: Sugar (and other) transporter; InterPro: | 98.04 | |
| PRK09584 | 500 | tppB putative tripeptide transporter permease; Rev | 98.04 | |
| COG2270 | 438 | Permeases of the major facilitator superfamily [Ge | 97.96 | |
| KOG2816|consensus | 463 | 97.93 | ||
| PF06609 | 599 | TRI12: Fungal trichothecene efflux pump (TRI12); I | 97.9 | |
| PF00050 | 48 | Kazal_1: Kazal-type serine protease inhibitor doma | 97.89 | |
| smart00280 | 46 | KAZAL Kazal type serine protease inhibitors. Kazal | 97.87 | |
| TIGR00788 | 468 | fbt folate/biopterin transporter. The only functio | 97.87 | |
| KOG0252|consensus | 538 | 97.8 | ||
| PF03825 | 400 | Nuc_H_symport: Nucleoside H+ symporter | 97.76 | |
| PRK09528 | 420 | lacY galactoside permease; Reviewed | 97.71 | |
| KOG4686|consensus | 459 | 97.66 | ||
| TIGR00882 | 396 | 2A0105 oligosaccharide:H+ symporter. | 97.56 | |
| KOG0255|consensus | 521 | 97.48 | ||
| TIGR00880 | 141 | 2_A_01_02 Multidrug resistance protein. | 97.44 | |
| TIGR00924 | 475 | yjdL_sub1_fam amino acid/peptide transporter (Pept | 97.42 | |
| PRK15462 | 493 | dipeptide/tripeptide permease D; Provisional | 97.41 | |
| PF01306 | 412 | LacY_symp: LacY proton/sugar symporter; InterPro: | 97.39 | |
| TIGR00769 | 472 | AAA ADP/ATP carrier protein family. These proteins | 97.32 | |
| PRK15462 | 493 | dipeptide/tripeptide permease D; Provisional | 97.3 | |
| PRK10054 | 395 | putative transporter; Provisional | 97.29 | |
| PRK09584 | 500 | tppB putative tripeptide transporter permease; Rev | 97.24 | |
| TIGR00886 | 366 | 2A0108 nitrite extrusion protein (nitrite facilita | 97.23 | |
| TIGR01299 | 742 | synapt_SV2 synaptic vesicle protein SV2. This mode | 97.21 | |
| PRK05122 | 399 | major facilitator superfamily transporter; Provisi | 97.17 | |
| PF01306 | 412 | LacY_symp: LacY proton/sugar symporter; InterPro: | 97.14 | |
| PRK12382 | 392 | putative transporter; Provisional | 97.13 | |
| TIGR00889 | 418 | 2A0110 nucleoside transporter. This family of prot | 97.02 | |
| PF06963 | 432 | FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 Thi | 97.02 | |
| KOG2325|consensus | 488 | 96.81 | ||
| PF12832 | 77 | MFS_1_like: MFS_1 like family | 96.8 | |
| PRK10489 | 417 | enterobactin exporter EntS; Provisional | 96.66 | |
| PF03825 | 400 | Nuc_H_symport: Nucleoside H+ symporter | 96.63 | |
| KOG0253|consensus | 528 | 96.61 | ||
| PRK10207 | 489 | dipeptide/tripeptide permease B; Provisional | 96.55 | |
| PF03219 | 491 | TLC: TLC ATP/ADP transporter; InterPro: IPR004667 | 96.52 | |
| cd01328 | 86 | FSL_SPARC Follistatin-like SPARC (secreted protein | 96.51 | |
| PRK11043 | 401 | putative transporter; Provisional | 96.51 | |
| PRK09874 | 408 | drug efflux system protein MdtG; Provisional | 96.5 | |
| PRK03633 | 381 | putative MFS family transporter protein; Provision | 96.45 | |
| TIGR00712 | 438 | glpT glycerol-3-phosphate transporter. This model | 96.44 | |
| TIGR00892 | 455 | 2A0113 monocarboxylate transporter 1. | 96.42 | |
| PRK11646 | 400 | multidrug resistance protein MdtH; Provisional | 96.41 | |
| PRK15011 | 393 | sugar efflux transporter B; Provisional | 96.39 | |
| PRK11663 | 434 | regulatory protein UhpC; Provisional | 96.3 | |
| PRK03699 | 394 | putative transporter; Provisional | 96.3 | |
| cd06174 | 352 | MFS The Major Facilitator Superfamily (MFS) is a l | 96.26 | |
| TIGR00879 | 481 | SP MFS transporter, sugar porter (SP) family. This | 96.18 | |
| PRK10504 | 471 | putative transporter; Provisional | 96.16 | |
| TIGR00890 | 377 | 2A0111 Oxalate/Formate Antiporter. | 96.09 | |
| PRK15034 | 462 | nitrate/nitrite transport protein NarU; Provisiona | 96.08 | |
| PTZ00207 | 591 | hypothetical protein; Provisional | 96.04 | |
| PRK11551 | 406 | putative 3-hydroxyphenylpropionic transporter MhpT | 96.03 | |
| PLN00028 | 476 | nitrate transmembrane transporter; Provisional | 96.01 | |
| PRK11652 | 394 | emrD multidrug resistance protein D; Provisional | 95.98 | |
| PRK09848 | 448 | glucuronide transporter; Provisional | 95.95 | |
| TIGR00893 | 399 | 2A0114 d-galactonate transporter. | 95.95 | |
| TIGR00891 | 405 | 2A0112 putative sialic acid transporter. | 95.91 | |
| TIGR00898 | 505 | 2A0119 cation transport protein. | 95.88 | |
| PRK11273 | 452 | glpT sn-glycerol-3-phosphate transporter; Provisio | 95.84 | |
| PF05631 | 354 | DUF791: Protein of unknown function (DUF791); Inte | 95.79 | |
| TIGR00897 | 402 | 2A0118 polyol permease family. This family of prot | 95.7 | |
| TIGR00926 | 654 | 2A1704 Peptide:H+ symporter (also transports b-lac | 95.69 | |
| COG3104 | 498 | PTR2 Dipeptide/tripeptide permease [Amino acid tra | 95.64 | |
| TIGR00885 | 410 | fucP L-fucose:H+ symporter permease. This family d | 95.62 | |
| PRK09705 | 393 | cynX putative cyanate transporter; Provisional | 95.62 | |
| PF07690 | 352 | MFS_1: Major Facilitator Superfamily; InterPro: IP | 95.58 | |
| TIGR02332 | 412 | HpaX 4-hydroxyphenylacetate permease. This protein | 95.55 | |
| PRK11195 | 393 | lysophospholipid transporter LplT; Provisional | 95.53 | |
| PRK03893 | 496 | putative sialic acid transporter; Provisional | 95.53 | |
| TIGR00881 | 379 | 2A0104 phosphoglycerate transporter family protein | 95.49 | |
| PRK10133 | 438 | L-fucose transporter; Provisional | 95.45 | |
| TIGR00899 | 375 | 2A0120 sugar efflux transporter. This family of pr | 95.39 | |
| PRK10091 | 382 | MFS transport protein AraJ; Provisional | 95.37 | |
| PRK10473 | 392 | multidrug efflux system protein MdtL; Provisional | 95.22 | |
| TIGR00710 | 385 | efflux_Bcr_CflA drug resistance transporter, Bcr/C | 95.11 | |
| PRK09669 | 444 | putative symporter YagG; Provisional | 95.09 | |
| PRK12307 | 426 | putative sialic acid transporter; Provisional | 95.09 | |
| TIGR00792 | 437 | gph sugar (Glycoside-Pentoside-Hexuronide) transpo | 95.05 | |
| PF03092 | 433 | BT1: BT1 family; InterPro: IPR004324 Members of th | 95.03 | |
| TIGR00805 | 633 | oat sodium-independent organic anion transporter. | 94.99 | |
| PRK15402 | 406 | multidrug efflux system translocase MdfA; Provisio | 94.94 | |
| KOG3098|consensus | 461 | 94.93 | ||
| PRK03545 | 390 | putative arabinose transporter; Provisional | 94.82 | |
| PRK10642 | 490 | proline/glycine betaine transporter; Provisional | 94.75 | |
| PRK10429 | 473 | melibiose:sodium symporter; Provisional | 94.75 | |
| PF05977 | 524 | MFS_3: Transmembrane secretion effector; InterPro: | 94.73 | |
| PF01770 | 412 | Folate_carrier: Reduced folate carrier; InterPro: | 94.7 | |
| TIGR00895 | 398 | 2A0115 benzoate transport. | 94.7 | |
| TIGR00887 | 502 | 2A0109 phosphate:H+ symporter. This model represen | 94.7 | |
| TIGR00900 | 365 | 2A0121 H+ Antiporter protein. | 94.69 | |
| PRK09556 | 467 | uhpT sugar phosphate antiporter; Reviewed | 94.61 | |
| COG3202 | 509 | ATP/ADP translocase [Energy production and convers | 94.55 | |
| TIGR00788 | 468 | fbt folate/biopterin transporter. The only functio | 94.55 | |
| PRK08633 | 1146 | 2-acyl-glycerophospho-ethanolamine acyltransferase | 94.48 | |
| PF11700 | 477 | ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 | 94.16 | |
| PRK10077 | 479 | xylE D-xylose transporter XylE; Provisional | 94.1 | |
| TIGR00711 | 485 | efflux_EmrB drug resistance transporter, EmrB/QacA | 94.06 | |
| PRK11128 | 382 | putative 3-phenylpropionic acid transporter; Provi | 94.03 | |
| PRK09952 | 438 | shikimate transporter; Provisional | 93.96 | |
| TIGR00883 | 394 | 2A0106 metabolite-proton symporter. This model rep | 93.93 | |
| PRK10213 | 394 | nepI ribonucleoside transporter; Reviewed | 93.76 | |
| KOG3762|consensus | 618 | 93.7 | ||
| TIGR00894 | 465 | 2A0114euk Na(+)-dependent inorganic phosphate cotr | 93.58 | |
| COG2270 | 438 | Permeases of the major facilitator superfamily [Ge | 93.35 | |
| PRK11102 | 377 | bicyclomycin/multidrug efflux system; Provisional | 93.15 | |
| TIGR00902 | 382 | 2A0127 phenyl proprionate permease family protein. | 92.7 | |
| COG2271 | 448 | UhpC Sugar phosphate permease [Carbohydrate transp | 92.46 | |
| PRK15403 | 413 | multidrug efflux system protein MdtM; Provisional | 92.18 | |
| PRK11902 | 402 | ampG muropeptide transporter; Reviewed | 92.03 | |
| PRK14995 | 495 | methyl viologen resistance protein SmvA; Provision | 91.94 | |
| COG3104 | 498 | PTR2 Dipeptide/tripeptide permease [Amino acid tra | 91.43 | |
| KOG4578|consensus | 421 | 91.42 | ||
| PF00854 | 372 | PTR2: POT family; InterPro: IPR000109 This entry r | 91.02 | |
| PRK11010 | 491 | ampG muropeptide transporter; Validated | 90.91 | |
| TIGR00903 | 368 | 2A0129 major facilitator 4 family protein. This fa | 90.78 | |
| PRK11462 | 460 | putative transporter; Provisional | 90.69 | |
| PTZ00207 | 591 | hypothetical protein; Provisional | 90.68 | |
| KOG2615|consensus | 451 | 90.46 | ||
| PRK15075 | 434 | citrate-proton symporter; Provisional | 90.3 | |
| TIGR00806 | 511 | rfc RFC reduced folate carrier. Proteins of the RF | 90.16 | |
| PF13347 | 428 | MFS_2: MFS/sugar transport protein | 89.94 | |
| PRK10406 | 432 | alpha-ketoglutarate transporter; Provisional | 89.63 | |
| TIGR02718 | 390 | sider_RhtX_FptX siderophore transporter, RhtX/FptX | 89.49 | |
| TIGR00896 | 355 | CynX cyanate transporter. This family of proteins | 89.46 | |
| KOG0637|consensus | 498 | 89.24 | ||
| PRK06814 | 1140 | acylglycerophosphoethanolamine acyltransferase; Pr | 88.75 | |
| TIGR01301 | 477 | GPH_sucrose GPH family sucrose/H+ symporter. This | 88.74 | |
| COG2211 | 467 | MelB Na+/melibiose symporter and related transport | 88.58 | |
| PF06779 | 85 | DUF1228: Protein of unknown function (DUF1228); In | 87.95 | |
| COG2223 | 417 | NarK Nitrate/nitrite transporter [Inorganic ion tr | 87.12 | |
| KOG3762|consensus | 618 | 84.44 | ||
| COG0738 | 422 | FucP Fucose permease [Carbohydrate transport and m | 82.17 | |
| KOG3810|consensus | 433 | 81.94 | ||
| PF03092 | 433 | BT1: BT1 family; InterPro: IPR004324 Members of th | 81.6 | |
| PF02554 | 376 | CstA: Carbon starvation protein CstA; InterPro: IP | 81.41 | |
| KOG4686|consensus | 459 | 81.04 |
| >KOG3626|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.8e-74 Score=563.04 Aligned_cols=304 Identities=44% Similarity=0.827 Sum_probs=272.8
Q ss_pred CccccccccchhhhcCccCCCCchhHHHHHHHHHHHHHHHHHHHHHhhhcccccCC-CCCCCCCCCCchhHHHHHHHHHH
Q psy11785 1 MGQTAVYTLGIPYIDDNVANRESPLYFAITIGVRILGPSLGFILGSFCTRLYVDLS-IPSDITPSDPRWIGAWWLGLVLV 79 (308)
Q Consensus 1 iG~a~~~~lg~a~i~d~~~~~~~~~~~gi~~~~~~~Gp~lG~~lGg~ll~~~v~~~-~~~~~~~~~~~W~gaWw~~fii~ 79 (308)
||++|++|+|++|||||++++++++|+|+++++.++||++|+++|++++++|+|++ ....++|.||||+||||+||+++
T Consensus 249 IG~Tpi~tlGisYiDDnvk~~~SplYlgi~~~~~~lGPaiGfllgS~~l~lYvD~~~~~~~it~~DPrWIGAWWlGFLi~ 328 (735)
T KOG3626|consen 249 IGATPIFTLGISYIDDNVKKKNSPLYLGILYSMAILGPAIGFLLGSFCLKLYVDFGLSPIGITPTDPRWIGAWWLGFLIC 328 (735)
T ss_pred cCCCCCccCCCccccccccccCCcHHHHHHHHHHHhhhHHHHHHHHHHHHeeeccccCCCCCCCCCcchhhHHHHHHHHH
Confidence 79999999999999999999999999999999999999999999999999999994 55789999999999999999999
Q ss_pred HHHHHHHHHHHHhccCCCCCCCCccCCcccccCCCc----cccccCCCCCCcchHHHHHhhcChHHHHHHHHHHHHHHHH
Q psy11785 80 AVFLMLAAVAMFMFPKTLTKASPVNGTTTVATLPTK----KESNQKNPSLKDFPKAVKRLLKNDILMYRTASSVLHILPI 155 (308)
Q Consensus 80 g~~~ll~~i~~~~~p~~~p~~~~~~~~~~~~~~~~~----~~~~~~~~~~~~~~~~~~~Ll~n~~f~~~~l~~~~~~~~~ 155 (308)
|.+.++.++++++|||++|+..+++..++.+....+ ++++...+.++|+|+..++|++||+|++.+++.+++..++
T Consensus 329 g~~~~~~a~p~f~fPk~lp~~~~~~~~~~~~~~k~~~~~~~~~~~~~~~ikdfp~s~~~ll~N~if~~~~l~~~~~~~~~ 408 (735)
T KOG3626|consen 329 GALLLFSAVPLFFFPKELPKSQKRKRARDLHVLKTESGGAKSDKTFGKKIKDFPKSIKRLLSNPIFMLVVLASVIESLAI 408 (735)
T ss_pred HHHHHHHHHHHHhCcccCccccccchhhhhcccccccccccCCcchhhhHHHHHHHHHHHhcCchHHHHHHHHHHHHHHH
Confidence 999999999999999999987653222111111110 1122223356799999999999999999999999999999
Q ss_pred HHHHhHHHHHHHHHhCCCcccccccchhhhhhhhHHHhhhhheehhhccCCccchhHHHHHHHHHHHHHHhHHHhcCCCC
Q psy11785 156 AGLYTFLPKYFETQFRLPSHTANMVSGVGGILVMGIGIILSGVFILKFKPNARFVAAWIAITAVLYALGMGILTFIGCPM 235 (308)
Q Consensus 156 ~~~~~~~P~yl~~~~gls~~~agl~~g~~~i~~~~iG~~lgG~l~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~ 235 (308)
.|+.+|+|||||+|||++++.|++++|.+.+|++++|.++||++++|++++.|++++++++++++++++.++++++||++
T Consensus 409 ~G~~tFlPKyLE~Qfg~sas~An~l~G~i~vp~~~~Gi~lGG~iikkfkl~~r~~a~~~~~~~~l~l~~~~~~~~igC~~ 488 (735)
T KOG3626|consen 409 TGYITFLPKYLETQFGISASLANILTGSIGVPAAAVGIFLGGLIIKKFKLSARGAAKFVIVCSVLSLLFYSLLFFIGCES 488 (735)
T ss_pred hhHHHhhHHHHHHHcCCCHHHHHHHhhhhhhhhhhhhhhccceeeeeecccHHHHHHHHHHHHHHHHHHHHHHHEecCCC
Confidence 99999999999999999999999999999999999999999999999999999999999999999999989999999999
Q ss_pred CCccccccCCCCC-------CcccCCCCCCCccCCCCCcceeeCCCCceecCccccccccccccCCCceEEEeeEeee
Q psy11785 236 DEWAGLTNANGIS-------SFEPMCATTHGCECDHSKFNPICGGDGRTYFSACHAGCQNISSIDGKVQTLLFIEAIS 306 (308)
Q Consensus 236 ~~~ag~~~~~~~~-------~~~~~Cn~~~~C~C~~~~~~PvC~~~g~ty~SpC~AGC~~~~~~~~~~~~~~~~~~~~ 306 (308)
.+++|++.++.+. ++.++||++ |+|++++|+||||+||+||||||||||++....+.+++.|++|+|+.
T Consensus 489 ~~~aG~~~~y~~~~~~~~~~~~~s~Cn~~--C~C~~~~~~PVCg~~G~tY~SpChAGC~~~~~~~~~~~~ytnCsCv~ 564 (735)
T KOG3626|consen 489 SPVAGVTNSYEGSPAFTSHENPFSSCNSD--CSCDTSEYEPVCGENGITYFSPCHAGCTESSGTSDGNTIYTNCSCVP 564 (735)
T ss_pred CcccceecCCCCCCccccCCCchhhhhcC--CCCCCcCcCcccCCCCCEEeChhhhCCcccccCCCCceeeccccccc
Confidence 9999999765322 145679999 99999999999999999999999999999988888899999999985
|
|
| >TIGR00805 oat sodium-independent organic anion transporter | Back alignment and domain information |
|---|
| >PF03137 OATP: Organic Anion Transporter Polypeptide (OATP) family; InterPro: IPR004156 This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs) | Back alignment and domain information |
|---|
| >cd01330 KAZAL_SLC21 The kazal-type serine protease inhibitor domain has been detected in an extracellular loop region of solute carrier 21 (SLC21) family members (organic anion transporters) , which may regulate the specificity of anion uptake | Back alignment and domain information |
|---|
| >KOG2532|consensus | Back alignment and domain information |
|---|
| >KOG1330|consensus | Back alignment and domain information |
|---|
| >TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter | Back alignment and domain information |
|---|
| >PRK09556 uhpT sugar phosphate antiporter; Reviewed | Back alignment and domain information |
|---|
| >TIGR00893 2A0114 d-galactonate transporter | Back alignment and domain information |
|---|
| >COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11663 regulatory protein UhpC; Provisional | Back alignment and domain information |
|---|
| >TIGR00881 2A0104 phosphoglycerate transporter family protein | Back alignment and domain information |
|---|
| >TIGR00712 glpT glycerol-3-phosphate transporter | Back alignment and domain information |
|---|
| >TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily | Back alignment and domain information |
|---|
| >COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00903 2A0129 major facilitator 4 family protein | Back alignment and domain information |
|---|
| >PRK10406 alpha-ketoglutarate transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR00901 2A0125 AmpG-related permease | Back alignment and domain information |
|---|
| >TIGR02332 HpaX 4-hydroxyphenylacetate permease | Back alignment and domain information |
|---|
| >PRK03545 putative arabinose transporter; Provisional | Back alignment and domain information |
|---|
| >PRK11102 bicyclomycin/multidrug efflux system; Provisional | Back alignment and domain information |
|---|
| >PRK14995 methyl viologen resistance protein SmvA; Provisional | Back alignment and domain information |
|---|
| >COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11195 lysophospholipid transporter LplT; Provisional | Back alignment and domain information |
|---|
| >TIGR00900 2A0121 H+ Antiporter protein | Back alignment and domain information |
|---|
| >PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional | Back alignment and domain information |
|---|
| >PRK11902 ampG muropeptide transporter; Reviewed | Back alignment and domain information |
|---|
| >TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily | Back alignment and domain information |
|---|
| >TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) | Back alignment and domain information |
|---|
| >PRK11010 ampG muropeptide transporter; Validated | Back alignment and domain information |
|---|
| >PRK15402 multidrug efflux system translocase MdfA; Provisional | Back alignment and domain information |
|---|
| >PLN00028 nitrate transmembrane transporter; Provisional | Back alignment and domain information |
|---|
| >PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms | Back alignment and domain information |
|---|
| >KOG2533|consensus | Back alignment and domain information |
|---|
| >PRK15403 multidrug efflux system protein MdtM; Provisional | Back alignment and domain information |
|---|
| >TIGR00897 2A0118 polyol permease family | Back alignment and domain information |
|---|
| >PRK09705 cynX putative cyanate transporter; Provisional | Back alignment and domain information |
|---|
| >PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK10473 multidrug efflux system protein MdtL; Provisional | Back alignment and domain information |
|---|
| >TIGR00883 2A0106 metabolite-proton symporter | Back alignment and domain information |
|---|
| >PRK10642 proline/glycine betaine transporter; Provisional | Back alignment and domain information |
|---|
| >PRK10213 nepI ribonucleoside transporter; Reviewed | Back alignment and domain information |
|---|
| >PRK10133 L-fucose transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR01272 gluP glucose/galactose transporter | Back alignment and domain information |
|---|
| >PRK10091 MFS transport protein AraJ; Provisional | Back alignment and domain information |
|---|
| >PRK03699 putative transporter; Provisional | Back alignment and domain information |
|---|
| >PRK10489 enterobactin exporter EntS; Provisional | Back alignment and domain information |
|---|
| >TIGR00902 2A0127 phenyl proprionate permease family protein | Back alignment and domain information |
|---|
| >PRK09952 shikimate transporter; Provisional | Back alignment and domain information |
|---|
| >PRK11128 putative 3-phenylpropionic acid transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR00892 2A0113 monocarboxylate transporter 1 | Back alignment and domain information |
|---|
| >PRK11043 putative transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR00895 2A0115 benzoate transport | Back alignment and domain information |
|---|
| >TIGR00891 2A0112 putative sialic acid transporter | Back alignment and domain information |
|---|
| >PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated | Back alignment and domain information |
|---|
| >TIGR00896 CynX cyanate transporter | Back alignment and domain information |
|---|
| >PRK15075 citrate-proton symporter; Provisional | Back alignment and domain information |
|---|
| >PRK12307 putative sialic acid transporter; Provisional | Back alignment and domain information |
|---|
| >PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional | Back alignment and domain information |
|---|
| >TIGR00890 2A0111 Oxalate/Formate Antiporter | Back alignment and domain information |
|---|
| >TIGR00899 2A0120 sugar efflux transporter | Back alignment and domain information |
|---|
| >PRK10504 putative transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family | Back alignment and domain information |
|---|
| >PRK15011 sugar efflux transporter B; Provisional | Back alignment and domain information |
|---|
| >PRK11652 emrD multidrug resistance protein D; Provisional | Back alignment and domain information |
|---|
| >PRK11646 multidrug resistance protein MdtH; Provisional | Back alignment and domain information |
|---|
| >TIGR00879 SP MFS transporter, sugar porter (SP) family | Back alignment and domain information |
|---|
| >TIGR00887 2A0109 phosphate:H+ symporter | Back alignment and domain information |
|---|
| >TIGR00885 fucP L-fucose:H+ symporter permease | Back alignment and domain information |
|---|
| >PRK03633 putative MFS family transporter protein; Provisional | Back alignment and domain information |
|---|
| >PRK15034 nitrate/nitrite transport protein NarU; Provisional | Back alignment and domain information |
|---|
| >PRK10077 xylE D-xylose transporter XylE; Provisional | Back alignment and domain information |
|---|
| >cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters | Back alignment and domain information |
|---|
| >PRK09874 drug efflux system protein MdtG; Provisional | Back alignment and domain information |
|---|
| >PRK03893 putative sialic acid transporter; Provisional | Back alignment and domain information |
|---|
| >PRK09528 lacY galactoside permease; Reviewed | Back alignment and domain information |
|---|
| >TIGR00882 2A0105 oligosaccharide:H+ symporter | Back alignment and domain information |
|---|
| >TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter | Back alignment and domain information |
|---|
| >TIGR01299 synapt_SV2 synaptic vesicle protein SV2 | Back alignment and domain information |
|---|
| >COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10054 putative transporter; Provisional | Back alignment and domain information |
|---|
| >PRK05122 major facilitator superfamily transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR00898 2A0119 cation transport protein | Back alignment and domain information |
|---|
| >PRK12382 putative transporter; Provisional | Back alignment and domain information |
|---|
| >cd00104 KAZAL_FS Kazal type serine protease inhibitors and follistatin-like domains | Back alignment and domain information |
|---|
| >PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily | Back alignment and domain information |
|---|
| >COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10207 dipeptide/tripeptide permease B; Provisional | Back alignment and domain information |
|---|
| >KOG3764|consensus | Back alignment and domain information |
|---|
| >PF13347 MFS_2: MFS/sugar transport protein | Back alignment and domain information |
|---|
| >KOG2504|consensus | Back alignment and domain information |
|---|
| >PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions | Back alignment and domain information |
|---|
| >KOG2563|consensus | Back alignment and domain information |
|---|
| >KOG2615|consensus | Back alignment and domain information |
|---|
| >PF03209 PUCC: PUCC protein; InterPro: IPR004896 This protein is required for high-level transcription of the PUC operon | Back alignment and domain information |
|---|
| >TIGR00889 2A0110 nucleoside transporter | Back alignment and domain information |
|---|
| >PRK09848 glucuronide transporter; Provisional | Back alignment and domain information |
|---|
| >cd01327 KAZAL_PSTI Kazal-type pancreatic secretory trypsin inhibitors (PSTI) and related proteins, including the second domain of the ovomucoid turkey inhibitor and the C-terminal domain of the esophagus cancer-related gene-2 protein (ECRG-2), are members of the superfamily of kazal-type proteinase inhibitors and follistatin-like proteins | Back alignment and domain information |
|---|
| >PRK09669 putative symporter YagG; Provisional | Back alignment and domain information |
|---|
| >PRK11462 putative transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial | Back alignment and domain information |
|---|
| >PRK10429 melibiose:sodium symporter; Provisional | Back alignment and domain information |
|---|
| >KOG0569|consensus | Back alignment and domain information |
|---|
| >TIGR00806 rfc RFC reduced folate carrier | Back alignment and domain information |
|---|
| >KOG0254|consensus | Back alignment and domain information |
|---|
| >PF07648 Kazal_2: Kazal-type serine protease inhibitor domain; InterPro: IPR011497 This domain is usually indicative of serine protease inhibitors that belong to Merops inhibitor families: I1, I2, I17 and I31 | Back alignment and domain information |
|---|
| >TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter | Back alignment and domain information |
|---|
| >COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters | Back alignment and domain information |
|---|
| >PRK09584 tppB putative tripeptide transporter permease; Reviewed | Back alignment and domain information |
|---|
| >COG2270 Permeases of the major facilitator superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2816|consensus | Back alignment and domain information |
|---|
| >PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins | Back alignment and domain information |
|---|
| >PF00050 Kazal_1: Kazal-type serine protease inhibitor domain; InterPro: IPR002350 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively | Back alignment and domain information |
|---|
| >smart00280 KAZAL Kazal type serine protease inhibitors | Back alignment and domain information |
|---|
| >TIGR00788 fbt folate/biopterin transporter | Back alignment and domain information |
|---|
| >KOG0252|consensus | Back alignment and domain information |
|---|
| >PF03825 Nuc_H_symport: Nucleoside H+ symporter | Back alignment and domain information |
|---|
| >PRK09528 lacY galactoside permease; Reviewed | Back alignment and domain information |
|---|
| >KOG4686|consensus | Back alignment and domain information |
|---|
| >TIGR00882 2A0105 oligosaccharide:H+ symporter | Back alignment and domain information |
|---|
| >KOG0255|consensus | Back alignment and domain information |
|---|
| >TIGR00880 2_A_01_02 Multidrug resistance protein | Back alignment and domain information |
|---|
| >TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial | Back alignment and domain information |
|---|
| >PRK15462 dipeptide/tripeptide permease D; Provisional | Back alignment and domain information |
|---|
| >PF01306 LacY_symp: LacY proton/sugar symporter; InterPro: IPR022814 In bacteria there are a number of families of transport proteins, including symporters and antiporters, that mediate the intake of a variety of sugars with the concomitant uptake of hydrogen ions (proton symporters) [] | Back alignment and domain information |
|---|
| >TIGR00769 AAA ADP/ATP carrier protein family | Back alignment and domain information |
|---|
| >PRK15462 dipeptide/tripeptide permease D; Provisional | Back alignment and domain information |
|---|
| >PRK10054 putative transporter; Provisional | Back alignment and domain information |
|---|
| >PRK09584 tppB putative tripeptide transporter permease; Reviewed | Back alignment and domain information |
|---|
| >TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) | Back alignment and domain information |
|---|
| >TIGR01299 synapt_SV2 synaptic vesicle protein SV2 | Back alignment and domain information |
|---|
| >PRK05122 major facilitator superfamily transporter; Provisional | Back alignment and domain information |
|---|
| >PF01306 LacY_symp: LacY proton/sugar symporter; InterPro: IPR022814 In bacteria there are a number of families of transport proteins, including symporters and antiporters, that mediate the intake of a variety of sugars with the concomitant uptake of hydrogen ions (proton symporters) [] | Back alignment and domain information |
|---|
| >PRK12382 putative transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR00889 2A0110 nucleoside transporter | Back alignment and domain information |
|---|
| >PF06963 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 This entry represents the solute carrier family 40 member 1 family of proteins, also known as Ferroportin 1 | Back alignment and domain information |
|---|
| >KOG2325|consensus | Back alignment and domain information |
|---|
| >PF12832 MFS_1_like: MFS_1 like family | Back alignment and domain information |
|---|
| >PRK10489 enterobactin exporter EntS; Provisional | Back alignment and domain information |
|---|
| >PF03825 Nuc_H_symport: Nucleoside H+ symporter | Back alignment and domain information |
|---|
| >KOG0253|consensus | Back alignment and domain information |
|---|
| >PRK10207 dipeptide/tripeptide permease B; Provisional | Back alignment and domain information |
|---|
| >PF03219 TLC: TLC ATP/ADP transporter; InterPro: IPR004667 These proteins are members of the ATP:ADP Antiporter (AAA) family, which consists of nucleotide transporters that have 12 GES predicted transmembrane regions | Back alignment and domain information |
|---|
| >cd01328 FSL_SPARC Follistatin-like SPARC (secreted protein, acidic, and rich in cysteines) domain; SPARC/BM-40/osteonectin is a multifunctional glycoprotein which modulates cellular interaction with the extracellular matrix by its binding to structural matrix proteins such as collagen and vitronectin | Back alignment and domain information |
|---|
| >PRK11043 putative transporter; Provisional | Back alignment and domain information |
|---|
| >PRK09874 drug efflux system protein MdtG; Provisional | Back alignment and domain information |
|---|
| >PRK03633 putative MFS family transporter protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00712 glpT glycerol-3-phosphate transporter | Back alignment and domain information |
|---|
| >TIGR00892 2A0113 monocarboxylate transporter 1 | Back alignment and domain information |
|---|
| >PRK11646 multidrug resistance protein MdtH; Provisional | Back alignment and domain information |
|---|
| >PRK15011 sugar efflux transporter B; Provisional | Back alignment and domain information |
|---|
| >PRK11663 regulatory protein UhpC; Provisional | Back alignment and domain information |
|---|
| >PRK03699 putative transporter; Provisional | Back alignment and domain information |
|---|
| >cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters | Back alignment and domain information |
|---|
| >TIGR00879 SP MFS transporter, sugar porter (SP) family | Back alignment and domain information |
|---|
| >PRK10504 putative transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR00890 2A0111 Oxalate/Formate Antiporter | Back alignment and domain information |
|---|
| >PRK15034 nitrate/nitrite transport protein NarU; Provisional | Back alignment and domain information |
|---|
| >PTZ00207 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional | Back alignment and domain information |
|---|
| >PLN00028 nitrate transmembrane transporter; Provisional | Back alignment and domain information |
|---|
| >PRK11652 emrD multidrug resistance protein D; Provisional | Back alignment and domain information |
|---|
| >PRK09848 glucuronide transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR00893 2A0114 d-galactonate transporter | Back alignment and domain information |
|---|
| >TIGR00891 2A0112 putative sialic acid transporter | Back alignment and domain information |
|---|
| >TIGR00898 2A0119 cation transport protein | Back alignment and domain information |
|---|
| >PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional | Back alignment and domain information |
|---|
| >PF05631 DUF791: Protein of unknown function (DUF791); InterPro: IPR008509 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >TIGR00897 2A0118 polyol permease family | Back alignment and domain information |
|---|
| >TIGR00926 2A1704 Peptide:H+ symporter (also transports b-lactam antibiotics, the antitumor agent, bestatin, and various protease inhibitors) | Back alignment and domain information |
|---|
| >COG3104 PTR2 Dipeptide/tripeptide permease [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00885 fucP L-fucose:H+ symporter permease | Back alignment and domain information |
|---|
| >PRK09705 cynX putative cyanate transporter; Provisional | Back alignment and domain information |
|---|
| >PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms | Back alignment and domain information |
|---|
| >TIGR02332 HpaX 4-hydroxyphenylacetate permease | Back alignment and domain information |
|---|
| >PRK11195 lysophospholipid transporter LplT; Provisional | Back alignment and domain information |
|---|
| >PRK03893 putative sialic acid transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR00881 2A0104 phosphoglycerate transporter family protein | Back alignment and domain information |
|---|
| >PRK10133 L-fucose transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR00899 2A0120 sugar efflux transporter | Back alignment and domain information |
|---|
| >PRK10091 MFS transport protein AraJ; Provisional | Back alignment and domain information |
|---|
| >PRK10473 multidrug efflux system protein MdtL; Provisional | Back alignment and domain information |
|---|
| >TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily | Back alignment and domain information |
|---|
| >PRK09669 putative symporter YagG; Provisional | Back alignment and domain information |
|---|
| >PRK12307 putative sialic acid transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter | Back alignment and domain information |
|---|
| >PF03092 BT1: BT1 family; InterPro: IPR004324 Members of this family are transmembrane proteins | Back alignment and domain information |
|---|
| >TIGR00805 oat sodium-independent organic anion transporter | Back alignment and domain information |
|---|
| >PRK15402 multidrug efflux system translocase MdfA; Provisional | Back alignment and domain information |
|---|
| >KOG3098|consensus | Back alignment and domain information |
|---|
| >PRK03545 putative arabinose transporter; Provisional | Back alignment and domain information |
|---|
| >PRK10642 proline/glycine betaine transporter; Provisional | Back alignment and domain information |
|---|
| >PRK10429 melibiose:sodium symporter; Provisional | Back alignment and domain information |
|---|
| >PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily | Back alignment and domain information |
|---|
| >PF01770 Folate_carrier: Reduced folate carrier; InterPro: IPR002666 The reduced folate carrier (a transmembrane glycoprotein) transports reduced folate into mammalian cells via the carrier mediated mechanism (as opposed to the receptor mediated mechanism) it also transports cytotoxic folate analogues used in chemotherapy [], such as methotrexate (MTX) | Back alignment and domain information |
|---|
| >TIGR00895 2A0115 benzoate transport | Back alignment and domain information |
|---|
| >TIGR00887 2A0109 phosphate:H+ symporter | Back alignment and domain information |
|---|
| >TIGR00900 2A0121 H+ Antiporter protein | Back alignment and domain information |
|---|
| >PRK09556 uhpT sugar phosphate antiporter; Reviewed | Back alignment and domain information |
|---|
| >COG3202 ATP/ADP translocase [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR00788 fbt folate/biopterin transporter | Back alignment and domain information |
|---|
| >PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated | Back alignment and domain information |
|---|
| >PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions | Back alignment and domain information |
|---|
| >PRK10077 xylE D-xylose transporter XylE; Provisional | Back alignment and domain information |
|---|
| >TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily | Back alignment and domain information |
|---|
| >PRK11128 putative 3-phenylpropionic acid transporter; Provisional | Back alignment and domain information |
|---|
| >PRK09952 shikimate transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR00883 2A0106 metabolite-proton symporter | Back alignment and domain information |
|---|
| >PRK10213 nepI ribonucleoside transporter; Reviewed | Back alignment and domain information |
|---|
| >KOG3762|consensus | Back alignment and domain information |
|---|
| >TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter | Back alignment and domain information |
|---|
| >COG2270 Permeases of the major facilitator superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11102 bicyclomycin/multidrug efflux system; Provisional | Back alignment and domain information |
|---|
| >TIGR00902 2A0127 phenyl proprionate permease family protein | Back alignment and domain information |
|---|
| >COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK15403 multidrug efflux system protein MdtM; Provisional | Back alignment and domain information |
|---|
| >PRK11902 ampG muropeptide transporter; Reviewed | Back alignment and domain information |
|---|
| >PRK14995 methyl viologen resistance protein SmvA; Provisional | Back alignment and domain information |
|---|
| >COG3104 PTR2 Dipeptide/tripeptide permease [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG4578|consensus | Back alignment and domain information |
|---|
| >PF00854 PTR2: POT family; InterPro: IPR000109 This entry represents the POT (proton-dependent oligopeptide transport) family, which all appear to be proton dependent transporters | Back alignment and domain information |
|---|
| >PRK11010 ampG muropeptide transporter; Validated | Back alignment and domain information |
|---|
| >TIGR00903 2A0129 major facilitator 4 family protein | Back alignment and domain information |
|---|
| >PRK11462 putative transporter; Provisional | Back alignment and domain information |
|---|
| >PTZ00207 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG2615|consensus | Back alignment and domain information |
|---|
| >PRK15075 citrate-proton symporter; Provisional | Back alignment and domain information |
|---|
| >TIGR00806 rfc RFC reduced folate carrier | Back alignment and domain information |
|---|
| >PF13347 MFS_2: MFS/sugar transport protein | Back alignment and domain information |
|---|
| >PRK10406 alpha-ketoglutarate transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family | Back alignment and domain information |
|---|
| >TIGR00896 CynX cyanate transporter | Back alignment and domain information |
|---|
| >KOG0637|consensus | Back alignment and domain information |
|---|
| >PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter | Back alignment and domain information |
|---|
| >COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF06779 DUF1228: Protein of unknown function (DUF1228); InterPro: IPR010645 This entry represents the N terminus of several putative bacterial membrane proteins, which may be sugar transporters | Back alignment and domain information |
|---|
| >COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3762|consensus | Back alignment and domain information |
|---|
| >COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3810|consensus | Back alignment and domain information |
|---|
| >PF03092 BT1: BT1 family; InterPro: IPR004324 Members of this family are transmembrane proteins | Back alignment and domain information |
|---|
| >PF02554 CstA: Carbon starvation protein CstA; InterPro: IPR003706 Escherichia coli induces the synthesis of at least 30 proteins at the onset of carbon starvation, two-thirds of which are positively regulated by the cyclic AMP (cAMP) and cAMP receptor protein (CRP) complex | Back alignment and domain information |
|---|
| >KOG4686|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 308 | |||
| 2erw_A | 56 | Serine protease inhibitor infestin; kazal type dom | 4e-07 | |
| 1ldt_L | 46 | LDTI, tryptase inhibitor; complex (hydrolase/inhib | 9e-07 | |
| 2arp_F | 152 | Follistatin; cystine knot, disulfide rich, EGF dom | 1e-05 | |
| 2arp_F | 152 | Follistatin; cystine knot, disulfide rich, EGF dom | 3e-04 | |
| 3sek_C | 209 | Follistatin-related protein 3; protein-protein com | 2e-05 | |
| 3sek_C | 209 | Follistatin-related protein 3; protein-protein com | 8e-05 | |
| 1nub_A | 229 | Basement membrane protein BM-40; extracellular mod | 2e-05 | |
| 3b4v_C | 237 | Follistatin-like 3; ligand-inhibitor signalling co | 5e-05 | |
| 3b4v_C | 237 | Follistatin-like 3; ligand-inhibitor signalling co | 7e-05 | |
| 2f3c_I | 55 | Thrombin inhibitor infestin; serine protease - inh | 6e-05 | |
| 3hh2_C | 288 | Follistatin; protein-protein complex, TB domain, c | 1e-04 | |
| 3hh2_C | 288 | Follistatin; protein-protein complex, TB domain, c | 1e-04 | |
| 3hh2_C | 288 | Follistatin; protein-protein complex, TB domain, c | 7e-04 | |
| 1y1b_A | 48 | Elastase inhibitor; non-classical, kazal-type, pro | 1e-04 | |
| 1tbr_R | 103 | RHODNIIN; complex (serine protease-inhibitor), kaz | 1e-04 | |
| 1lr7_A | 74 | Follistatin, FS1; heparin-binding, cystine-rich, s | 3e-04 | |
| 3qtl_D | 75 | Kazal-type serine protease inhibitor SPI-1; serine | 5e-04 |
| >2erw_A Serine protease inhibitor infestin; kazal type domain, blood clotting, hydrolase inhibitor; 1.40A {Triatoma infestans} SCOP: g.68.1.1 Length = 56 | Back alignment and structure |
|---|
Score = 45.7 bits (108), Expect = 4e-07
Identities = 12/35 (34%), Positives = 19/35 (54%), Gaps = 1/35 (2%)
Query: 260 CECDHSKFNPICGGDGRTYFSACHAGCQNISSIDG 294
C C + + P+CG DG+TY + C C + + G
Sbjct: 6 CACFRN-YVPVCGSDGKTYGNPCMLNCAAQTKVPG 39
|
| >1ldt_L LDTI, tryptase inhibitor; complex (hydrolase/inhibitor), hydrolase, inflammation; 1.90A {Hirudo medicinalis} SCOP: g.68.1.1 PDB: 1an1_I 2kmo_A 2kmp_A 2kmq_A 2kmr_A Length = 46 | Back alignment and structure |
|---|
| >2arp_F Follistatin; cystine knot, disulfide rich, EGF domain, kazal domain, PROT complex, hormone-growth factor complex; HET: 1PG; 2.00A {Rattus norvegicus} Length = 152 | Back alignment and structure |
|---|
| >2arp_F Follistatin; cystine knot, disulfide rich, EGF domain, kazal domain, PROT complex, hormone-growth factor complex; HET: 1PG; 2.00A {Rattus norvegicus} Length = 152 | Back alignment and structure |
|---|
| >3sek_C Follistatin-related protein 3; protein-protein complex, TB domain, cystine knot motif, TGF- fold, disulfide linked dimer, follistatin domain (FSD); HET: NAG; 2.40A {Homo sapiens} PDB: 2kcx_A Length = 209 | Back alignment and structure |
|---|
| >3sek_C Follistatin-related protein 3; protein-protein complex, TB domain, cystine knot motif, TGF- fold, disulfide linked dimer, follistatin domain (FSD); HET: NAG; 2.40A {Homo sapiens} PDB: 2kcx_A Length = 209 | Back alignment and structure |
|---|
| >1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* Length = 229 | Back alignment and structure |
|---|
| >3b4v_C Follistatin-like 3; ligand-inhibitor signalling complex, cleavage on PAIR of BAS residues, glycoprotein, growth factor, hormone, secreted; HET: NAG; 2.48A {Homo sapiens} Length = 237 | Back alignment and structure |
|---|
| >3b4v_C Follistatin-like 3; ligand-inhibitor signalling complex, cleavage on PAIR of BAS residues, glycoprotein, growth factor, hormone, secreted; HET: NAG; 2.48A {Homo sapiens} Length = 237 | Back alignment and structure |
|---|
| >2f3c_I Thrombin inhibitor infestin; serine protease - inhibitor complex, kazal-type domain, hydrolase/hydrolase inhibitor complex; 2.50A {Triatoma infestans} SCOP: g.68.1.1 PDB: 1kma_A Length = 55 | Back alignment and structure |
|---|
| >3hh2_C Follistatin; protein-protein complex, TB domain, cystine knot motif, TGF- fold, disulfide linked dimer, CLE PAIR of basic residues, cytokine; HET: CIT; 2.15A {Homo sapiens} PDB: 2b0u_C* 2p6a_D Length = 288 | Back alignment and structure |
|---|
| >3hh2_C Follistatin; protein-protein complex, TB domain, cystine knot motif, TGF- fold, disulfide linked dimer, CLE PAIR of basic residues, cytokine; HET: CIT; 2.15A {Homo sapiens} PDB: 2b0u_C* 2p6a_D Length = 288 | Back alignment and structure |
|---|
| >3hh2_C Follistatin; protein-protein complex, TB domain, cystine knot motif, TGF- fold, disulfide linked dimer, CLE PAIR of basic residues, cytokine; HET: CIT; 2.15A {Homo sapiens} PDB: 2b0u_C* 2p6a_D Length = 288 | Back alignment and structure |
|---|
| >1y1b_A Elastase inhibitor; non-classical, kazal-type, protease inhibitor, CSH motif, hydrolase inhibitor; NMR {Synthetic} PDB: 1y1c_A Length = 48 | Back alignment and structure |
|---|
| >1tbr_R RHODNIIN; complex (serine protease-inhibitor), kazal-type inhibitor, T complex (serine protease-inhibitor) complex; 2.60A {Rhodnius prolixus} SCOP: g.68.1.1 g.68.1.1 PDB: 1tbq_R Length = 103 | Back alignment and structure |
|---|
| >1lr7_A Follistatin, FS1; heparin-binding, cystine-rich, sucrose octasulphate, hormone/growth factor complex; HET: SO4; 1.50A {Rattus norvegicus} SCOP: g.3.11.3 g.68.1.1 PDB: 1lr8_A* 1lr9_A Length = 74 | Back alignment and structure |
|---|
| >3qtl_D Kazal-type serine protease inhibitor SPI-1; serine protease -kazal type serine protease inhibitor comple hydrolase inhibitor; 2.60A {Carcinoscorpius rotundicauda} Length = 75 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 308 | |||
| 1pw4_A | 451 | Glycerol-3-phosphate transporter; transmembrane, i | 99.62 | |
| 3o7q_A | 438 | L-fucose-proton symporter; transporter, multi-PASS | 99.61 | |
| 2gfp_A | 375 | EMRD, multidrug resistance protein D; membrane pro | 99.36 | |
| 4aps_A | 491 | DI-OR tripeptide H+ symporter; transport protein, | 99.19 | |
| 2erw_A | 56 | Serine protease inhibitor infestin; kazal type dom | 99.16 | |
| 1ldt_L | 46 | LDTI, tryptase inhibitor; complex (hydrolase/inhib | 99.13 | |
| 1pce_A | 60 | PEC-60; proteinase inhibitor(kazal type); NMR {Sus | 99.01 | |
| 1y1b_A | 48 | Elastase inhibitor; non-classical, kazal-type, pro | 98.92 | |
| 2cfq_A | 417 | Lactose permease; transport, transport mechanism, | 98.89 | |
| 2f3c_I | 55 | Thrombin inhibitor infestin; serine protease - inh | 98.81 | |
| 4gc0_A | 491 | D-xylose-proton symporter; MFS, transport protein; | 98.8 | |
| 1tgs_I | 56 | Pancreatic secretory trypsin inhibitor (kazal type | 98.8 | |
| 1cgj_I | 56 | Pancreatic secretory trypsin inhibitor (kazal type | 98.76 | |
| 1bus_A | 57 | Proteinase inhibitor IIA; HET: PCA; NMR {Bos tauru | 98.69 | |
| 1uvf_A | 61 | Serine proteinase inhibitor kazal type 5; trypsin | 98.6 | |
| 1r0r_I | 51 | Ovomucoid, omtky3; high resolution, serine proteas | 98.56 | |
| 1uvg_A | 78 | Serine proteinase inhibitor kazal type 5; trypsin | 98.31 | |
| 2jxd_A | 62 | Serine protease inhibitor kazal-type 2; anti-paral | 98.28 | |
| 2xut_A | 524 | Proton/peptide symporter family protein; transport | 98.16 | |
| 3pis_D | 42 | Kazal-type serine protease inhibitor SPI-1; typica | 97.89 | |
| 1tbr_R | 103 | RHODNIIN; complex (serine protease-inhibitor), kaz | 97.85 | |
| 2cfq_A | 417 | Lactose permease; transport, transport mechanism, | 97.82 | |
| 1h0z_A | 68 | Serine protease inhibitor kazal-type 5, contains h | 97.8 | |
| 2leo_A | 66 | Serine protease inhibitor kazal-type 7; esophageal | 96.9 | |
| 1lr7_A | 74 | Follistatin, FS1; heparin-binding, cystine-rich, s | 97.46 | |
| 4aps_A | 491 | DI-OR tripeptide H+ symporter; transport protein, | 97.15 | |
| 1tbr_R | 103 | RHODNIIN; complex (serine protease-inhibitor), kaz | 97.14 | |
| 2xut_A | 524 | Proton/peptide symporter family protein; transport | 97.05 | |
| 3qtl_D | 75 | Kazal-type serine protease inhibitor SPI-1; serine | 97.05 | |
| 3qtl_D | 75 | Kazal-type serine protease inhibitor SPI-1; serine | 96.54 | |
| 2arp_F | 152 | Follistatin; cystine knot, disulfide rich, EGF dom | 96.51 | |
| 1hdl_A | 55 | HF6478, serine proteinase inhibitor lekti; putativ | 96.38 | |
| 1nub_A | 229 | Basement membrane protein BM-40; extracellular mod | 96.23 | |
| 3o7q_A | 438 | L-fucose-proton symporter; transporter, multi-PASS | 96.04 | |
| 1pw4_A | 451 | Glycerol-3-phosphate transporter; transmembrane, i | 96.03 | |
| 2arp_F | 152 | Follistatin; cystine knot, disulfide rich, EGF dom | 95.96 | |
| 3sek_C | 209 | Follistatin-related protein 3; protein-protein com | 95.7 | |
| 1yu6_C | 185 | Ovomucoid; protein proteinase inhibitor, protease, | 95.67 | |
| 1yu6_C | 185 | Ovomucoid; protein proteinase inhibitor, protease, | 95.63 | |
| 2gfp_A | 375 | EMRD, multidrug resistance protein D; membrane pro | 95.56 | |
| 3sek_C | 209 | Follistatin-related protein 3; protein-protein com | 95.37 | |
| 3b4v_C | 237 | Follistatin-like 3; ligand-inhibitor signalling co | 95.37 | |
| 3b4v_C | 237 | Follistatin-like 3; ligand-inhibitor signalling co | 95.28 | |
| 3hh2_C | 288 | Follistatin; protein-protein complex, TB domain, c | 95.13 | |
| 3hh2_C | 288 | Follistatin; protein-protein complex, TB domain, c | 95.12 | |
| 4gc0_A | 491 | D-xylose-proton symporter; MFS, transport protein; | 94.32 | |
| 3tjq_A | 140 | Serine protease HTRA1; hydrolase; 2.00A {Homo sapi | 94.21 | |
| 4gi3_C | 83 | Greglin; kazal type inhibitor, hydrolase-hydrolase | 93.63 |
| >1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 | Back alignment and structure |
|---|
Probab=99.62 E-value=1e-15 Score=143.71 Aligned_cols=181 Identities=14% Similarity=0.117 Sum_probs=125.2
Q ss_pred ccccccccchhhhcCccCCCCchhHHHHHHHHHHHHHHHHHHHHHhhhcccccCCCCCCCCCCCCchhHHHHHHHHHHHH
Q psy11785 2 GQTAVYTLGIPYIDDNVANRESPLYFAITIGVRILGPSLGFILGSFCTRLYVDLSIPSDITPSDPRWIGAWWLGLVLVAV 81 (308)
Q Consensus 2 G~a~~~~lg~a~i~d~~~~~~~~~~~gi~~~~~~~Gp~lG~~lGg~ll~~~v~~~~~~~~~~~~~~W~gaWw~~fii~g~ 81 (308)
|.+..++...+++.|++|+++|++++|+...+..+|.++||++++++.+.+ + .|+..|++.++
T Consensus 132 ~~~~~~~~~~~~i~~~~~~~~r~~~~~~~~~~~~~g~~~g~~~~~~l~~~~------------g-----~w~~~f~~~~~ 194 (451)
T 1pw4_A 132 FQGMGWPPCGRTMVHWWSQKERGGIVSVWNCAHNVGGGIPPLLFLLGMAWF------------N-----DWHAALYMPAF 194 (451)
T ss_dssp HHHHTHHHHHHHHHTTCTTTHHHHHHHHHHHHHHHHHTSHHHHHHHHHHHT------------C-----CSTTCTHHHHH
T ss_pred HhhhccchHHHHHHHHCCchhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHh------------c-----cHHHHHHHHHH
Confidence 445677888999999999999999999999999999999999999987643 1 14455666666
Q ss_pred HHHHHHHHH-HhccCCCCCCCCccCCcccccC-CCccc-cccCCCCCCcchHHHHHhhcChHHHHHHHHHHHHHHHHHHH
Q psy11785 82 FLMLAAVAM-FMFPKTLTKASPVNGTTTVATL-PTKKE-SNQKNPSLKDFPKAVKRLLKNDILMYRTASSVLHILPIAGL 158 (308)
Q Consensus 82 ~~ll~~i~~-~~~p~~~p~~~~~~~~~~~~~~-~~~~~-~~~~~~~~~~~~~~~~~Ll~n~~f~~~~l~~~~~~~~~~~~ 158 (308)
+.++..+.. +..|++ |+..+.+..++.... ++..+ +++.+.+.++ ...++++|||.++...+..++.....+++
T Consensus 195 ~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 271 (451)
T 1pw4_A 195 CAILVALFAFAMMRDT-PQSCGLPPIEEYKNDYPDDYNEKAEQELTAKQ--IFMQYVLPNKLLWYIAIANVFVYLLRYGI 271 (451)
T ss_dssp HHHHHHHHHHHHCCCS-STTTCCCSCTTTCCC-------------CCTH--HHHHHTSSCHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHhhccCC-HhhcCCCChhhhcccccccchhhhhccccccc--chHHHHHcCHHHHHHHHHHHHHHHHHHHH
Confidence 555554443 444543 322211111110000 00000 0001111121 22578899999999999988888999999
Q ss_pred HhHHHHHHHHHhCCCcccccccchhhhhhhhHHHhhhhheehhhc
Q psy11785 159 YTFLPKYFETQFRLPSHTANMVSGVGGILVMGIGIILSGVFILKF 203 (308)
Q Consensus 159 ~~~~P~yl~~~~gls~~~agl~~g~~~i~~~~iG~~lgG~l~~r~ 203 (308)
..++|.|+++++|+++.+++++.....+ +.++|.++.|++.||+
T Consensus 272 ~~~~~~~~~~~~g~~~~~~~~~~~~~~~-~~~~~~~~~g~l~~~~ 315 (451)
T 1pw4_A 272 LDWSPTYLKEVKHFALDKSSWAYFLYEY-AGIPGTLLCGWMSDKV 315 (451)
T ss_dssp HHHHHHHBTTBSCCCHHHHHHHHHHHHH-HHHHHHHHHHHHHHHT
T ss_pred HHHHHHHHHHhcCCCHHHHHHHHHHHHH-HHHHHHHHHHHHHHHH
Confidence 9999999999999999999987765543 5678899999999998
|
| >3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* | Back alignment and structure |
|---|
| >2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} | Back alignment and structure |
|---|
| >4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} | Back alignment and structure |
|---|
| >2erw_A Serine protease inhibitor infestin; kazal type domain, blood clotting, hydrolase inhibitor; 1.40A {Triatoma infestans} SCOP: g.68.1.1 | Back alignment and structure |
|---|
| >1ldt_L LDTI, tryptase inhibitor; complex (hydrolase/inhibitor), hydrolase, inflammation; 1.90A {Hirudo medicinalis} SCOP: g.68.1.1 PDB: 1an1_I 2kmo_A 2kmp_A 2kmq_A 2kmr_A | Back alignment and structure |
|---|
| >1pce_A PEC-60; proteinase inhibitor(kazal type); NMR {Sus scrofa} SCOP: g.68.1.1 | Back alignment and structure |
|---|
| >1y1b_A Elastase inhibitor; non-classical, kazal-type, protease inhibitor, CSH motif, hydrolase inhibitor; NMR {Synthetic} PDB: 1y1c_A | Back alignment and structure |
|---|
| >2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* | Back alignment and structure |
|---|
| >2f3c_I Thrombin inhibitor infestin; serine protease - inhibitor complex, kazal-type domain, hydrolase/hydrolase inhibitor complex; 2.50A {Triatoma infestans} SCOP: g.68.1.1 PDB: 1kma_A | Back alignment and structure |
|---|
| >4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* | Back alignment and structure |
|---|
| >1tgs_I Pancreatic secretory trypsin inhibitor (kazal type); complex (proteinase/inhibitor); 1.80A {Sus scrofa} SCOP: g.68.1.1 PDB: 1cgi_I 1hpt_A | Back alignment and structure |
|---|
| >1cgj_I Pancreatic secretory trypsin inhibitor (kazal type) variant 4; serine protease/inhibitor complex; 2.30A {Homo sapiens} SCOP: g.68.1.1 | Back alignment and structure |
|---|
| >1bus_A Proteinase inhibitor IIA; HET: PCA; NMR {Bos taurus} SCOP: g.68.1.1 PDB: 2bus_A* | Back alignment and structure |
|---|
| >1r0r_I Ovomucoid, omtky3; high resolution, serine protease, protein inhibitor, hydrolase; 1.10A {Meleagris gallopavo} SCOP: g.68.1.1 PDB: 1sgr_I 2gkr_I 1cho_I 1omt_A 1omu_A 1ppf_I* 1tur_A 1tus_A 3sgb_I 2ovo_A 4ovo_A 1iy5_A 1cso_I 1ct4_I 2sgf_I 2gkt_I 2gkv_A 2nu0_I 1m8b_A 1m8c_A ... | Back alignment and structure |
|---|
| >2jxd_A Serine protease inhibitor kazal-type 2; anti-parallel beta sheet, beta-bulge, disulfide bond, alpha helix, pyrrolidone carboxylic acid, secreted; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >3pis_D Kazal-type serine protease inhibitor SPI-1; typical non-classical kazal type inhibitor fold; 2.00A {Carcinoscorpius rotundicauda} | Back alignment and structure |
|---|
| >1tbr_R RHODNIIN; complex (serine protease-inhibitor), kazal-type inhibitor, T complex (serine protease-inhibitor) complex; 2.60A {Rhodnius prolixus} SCOP: g.68.1.1 g.68.1.1 PDB: 1tbq_R | Back alignment and structure |
|---|
| >2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* | Back alignment and structure |
|---|
| >1h0z_A Serine protease inhibitor kazal-type 5, contains hemofiltrate peptide HF6478, hemofiltrate...; serine proteinase inhibitor; NMR {Homo sapiens} SCOP: g.68.1.2 | Back alignment and structure |
|---|
| >2leo_A Serine protease inhibitor kazal-type 7; esophageal cancer-related gene 2, hydrol inhibitor; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1lr7_A Follistatin, FS1; heparin-binding, cystine-rich, sucrose octasulphate, hormone/growth factor complex; HET: SO4; 1.50A {Rattus norvegicus} SCOP: g.3.11.3 g.68.1.1 PDB: 1lr8_A* 1lr9_A | Back alignment and structure |
|---|
| >4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} | Back alignment and structure |
|---|
| >1tbr_R RHODNIIN; complex (serine protease-inhibitor), kazal-type inhibitor, T complex (serine protease-inhibitor) complex; 2.60A {Rhodnius prolixus} SCOP: g.68.1.1 g.68.1.1 PDB: 1tbq_R | Back alignment and structure |
|---|
| >2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >3qtl_D Kazal-type serine protease inhibitor SPI-1; serine protease -kazal type serine protease inhibitor comple hydrolase inhibitor; 2.60A {Carcinoscorpius rotundicauda} | Back alignment and structure |
|---|
| >3qtl_D Kazal-type serine protease inhibitor SPI-1; serine protease -kazal type serine protease inhibitor comple hydrolase inhibitor; 2.60A {Carcinoscorpius rotundicauda} | Back alignment and structure |
|---|
| >2arp_F Follistatin; cystine knot, disulfide rich, EGF domain, kazal domain, PROT complex, hormone-growth factor complex; HET: 1PG; 2.00A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1hdl_A HF6478, serine proteinase inhibitor lekti; putative serine proteinase inhibitor; NMR {Homo sapiens} SCOP: g.68.1.2 PDB: 1uuc_A | Back alignment and structure |
|---|
| >1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* | Back alignment and structure |
|---|
| >3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* | Back alignment and structure |
|---|
| >1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 | Back alignment and structure |
|---|
| >2arp_F Follistatin; cystine knot, disulfide rich, EGF domain, kazal domain, PROT complex, hormone-growth factor complex; HET: 1PG; 2.00A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3sek_C Follistatin-related protein 3; protein-protein complex, TB domain, cystine knot motif, TGF- fold, disulfide linked dimer, follistatin domain (FSD); HET: NAG; 2.40A {Homo sapiens} PDB: 2kcx_A | Back alignment and structure |
|---|
| >1yu6_C Ovomucoid; protein proteinase inhibitor, protease, hydrolase; 1.55A {Meleagris gallopavo} SCOP: g.68.1.1 PDB: 1z7k_B* | Back alignment and structure |
|---|
| >1yu6_C Ovomucoid; protein proteinase inhibitor, protease, hydrolase; 1.55A {Meleagris gallopavo} SCOP: g.68.1.1 PDB: 1z7k_B* | Back alignment and structure |
|---|
| >2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} | Back alignment and structure |
|---|
| >3sek_C Follistatin-related protein 3; protein-protein complex, TB domain, cystine knot motif, TGF- fold, disulfide linked dimer, follistatin domain (FSD); HET: NAG; 2.40A {Homo sapiens} PDB: 2kcx_A | Back alignment and structure |
|---|
| >3b4v_C Follistatin-like 3; ligand-inhibitor signalling complex, cleavage on PAIR of BAS residues, glycoprotein, growth factor, hormone, secreted; HET: NAG; 2.48A {Homo sapiens} | Back alignment and structure |
|---|
| >3b4v_C Follistatin-like 3; ligand-inhibitor signalling complex, cleavage on PAIR of BAS residues, glycoprotein, growth factor, hormone, secreted; HET: NAG; 2.48A {Homo sapiens} | Back alignment and structure |
|---|
| >3hh2_C Follistatin; protein-protein complex, TB domain, cystine knot motif, TGF- fold, disulfide linked dimer, CLE PAIR of basic residues, cytokine; HET: CIT; 2.15A {Homo sapiens} PDB: 2b0u_C* 2p6a_D | Back alignment and structure |
|---|
| >3hh2_C Follistatin; protein-protein complex, TB domain, cystine knot motif, TGF- fold, disulfide linked dimer, CLE PAIR of basic residues, cytokine; HET: CIT; 2.15A {Homo sapiens} PDB: 2b0u_C* 2p6a_D | Back alignment and structure |
|---|
| >4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* | Back alignment and structure |
|---|
| >3tjq_A Serine protease HTRA1; hydrolase; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4gi3_C Greglin; kazal type inhibitor, hydrolase-hydrolase inhibitor complex; 1.75A {Schistocerca gregaria} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 308 | ||||
| d1ldtl_ | 46 | g.68.1.1 (L:) Leech derived tryptase inhibitor (LD | 4e-10 | |
| d2erwa1 | 53 | g.68.1.1 (A:4-56) Blood-sucking insect-derived try | 1e-08 | |
| d2f3ci1 | 46 | g.68.1.1 (I:5-50) Blood-sucking insect-derived try | 6e-08 | |
| d1tbrr2 | 52 | g.68.1.1 (R:52-103) Blood-sucking insect-derived t | 8e-07 | |
| d1nuba3 | 58 | g.68.1.1 (A:78-135) Domain of BM-40/SPARC/osteonec | 4e-06 | |
| d1pcea_ | 60 | g.68.1.1 (A:) PEC-60 peptide {Pig (Sus scrofa) [Ta | 2e-05 | |
| d1lr7a2 | 48 | g.68.1.1 (A:89-136) Domain of follistatin {Rat (Ra | 7e-05 | |
| d1hpta_ | 56 | g.68.1.1 (A:) Secretory trypsin inhibitor {Human ( | 1e-04 | |
| d1tgsi_ | 56 | g.68.1.1 (I:) Secretory trypsin inhibitor {Pig (Su | 1e-04 | |
| d2busa_ | 57 | g.68.1.1 (A:) Seminal plasma inhibitor IIa {Cow (B | 7e-04 | |
| d1z7kb1 | 62 | g.68.1.1 (B:2-63) Ovomucoid domains {Turkey (Melea | 8e-04 | |
| d1r0ri_ | 51 | g.68.1.1 (I:) Ovomucoid domains {Turkey (Meleagris | 0.001 | |
| d1h0za_ | 68 | g.68.1.2 (A:) Serine proteinase inhibitor lekti {H | 0.003 |
| >d1ldtl_ g.68.1.1 (L:) Leech derived tryptase inhibitor (LDTI-C) {Medicinal leech (Hirudo medicinalis) [TaxId: 6421]} Length = 46 | Back information, alignment and structure |
|---|
class: Small proteins fold: Kazal-type serine protease inhibitors superfamily: Kazal-type serine protease inhibitors family: Ovomucoid domain III-like domain: Leech derived tryptase inhibitor (LDTI-C) species: Medicinal leech (Hirudo medicinalis) [TaxId: 6421]
Score = 52.1 bits (125), Expect = 4e-10
Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 1/33 (3%)
Query: 259 GCECDHSKFNPICGGDGRTYFSACHAGCQNISS 291
C C P+CG DGRTY ++C A C +S
Sbjct: 3 VCACPKI-LKPVCGSDGRTYANSCIARCNGVSI 34
|
| >d2erwa1 g.68.1.1 (A:4-56) Blood-sucking insect-derived tryptase inhibitor {Triatoma infestans [TaxId: 30076]} Length = 53 | Back information, alignment and structure |
|---|
| >d2f3ci1 g.68.1.1 (I:5-50) Blood-sucking insect-derived tryptase inhibitor {Triatoma infestans [TaxId: 30076]} Length = 46 | Back information, alignment and structure |
|---|
| >d1tbrr2 g.68.1.1 (R:52-103) Blood-sucking insect-derived tryptase inhibitor {Bug (Rhodnius prolixus), rhodniin [TaxId: 13249]} Length = 52 | Back information, alignment and structure |
|---|
| >d1nuba3 g.68.1.1 (A:78-135) Domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Length = 58 | Back information, alignment and structure |
|---|
| >d1pcea_ g.68.1.1 (A:) PEC-60 peptide {Pig (Sus scrofa) [TaxId: 9823]} Length = 60 | Back information, alignment and structure |
|---|
| >d1lr7a2 g.68.1.1 (A:89-136) Domain of follistatin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 48 | Back information, alignment and structure |
|---|
| >d1hpta_ g.68.1.1 (A:) Secretory trypsin inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1tgsi_ g.68.1.1 (I:) Secretory trypsin inhibitor {Pig (Sus scrofa) [TaxId: 9823]} Length = 56 | Back information, alignment and structure |
|---|
| >d2busa_ g.68.1.1 (A:) Seminal plasma inhibitor IIa {Cow (Bos taurus) [TaxId: 9913]} Length = 57 | Back information, alignment and structure |
|---|
| >d1z7kb1 g.68.1.1 (B:2-63) Ovomucoid domains {Turkey (Meleagris gallopavo) [TaxId: 9103]} Length = 62 | Back information, alignment and structure |
|---|
| >d1r0ri_ g.68.1.1 (I:) Ovomucoid domains {Turkey (Meleagris gallopavo) [TaxId: 9103]} Length = 51 | Back information, alignment and structure |
|---|
| >d1h0za_ g.68.1.2 (A:) Serine proteinase inhibitor lekti {Human (Homo sapiens) [TaxId: 9606]} Length = 68 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 308 | |||
| d1pw4a_ | 447 | Glycerol-3-phosphate transporter {Escherichia coli | 99.63 | |
| d1ldtl_ | 46 | Leech derived tryptase inhibitor (LDTI-C) {Medicin | 99.33 | |
| d2erwa1 | 53 | Blood-sucking insect-derived tryptase inhibitor {T | 99.01 | |
| d2f3ci1 | 46 | Blood-sucking insect-derived tryptase inhibitor {T | 98.86 | |
| d1lr7a2 | 48 | Domain of follistatin {Rat (Rattus norvegicus) [Ta | 98.43 | |
| d1tbrr2 | 52 | Blood-sucking insect-derived tryptase inhibitor {B | 98.39 | |
| d1pv7a_ | 417 | Lactose permease {Escherichia coli [TaxId: 562]} | 98.28 | |
| d1nuba3 | 58 | Domain of BM-40/SPARC/osteonectin {Human (Homo sap | 98.1 | |
| d1z7kb1 | 62 | Ovomucoid domains {Turkey (Meleagris gallopavo) [T | 97.85 | |
| d1r0ri_ | 51 | Ovomucoid domains {Turkey (Meleagris gallopavo) [T | 97.85 | |
| d1pv7a_ | 417 | Lactose permease {Escherichia coli [TaxId: 562]} | 97.83 | |
| d2busa_ | 57 | Seminal plasma inhibitor IIa {Cow (Bos taurus) [Ta | 97.82 | |
| d1pcea_ | 60 | PEC-60 peptide {Pig (Sus scrofa) [TaxId: 9823]} | 97.8 | |
| d1tgsi_ | 56 | Secretory trypsin inhibitor {Pig (Sus scrofa) [Tax | 97.79 | |
| d1hpta_ | 56 | Secretory trypsin inhibitor {Human (Homo sapiens) | 97.76 | |
| d1h0za_ | 68 | Serine proteinase inhibitor lekti {Human (Homo sap | 97.38 | |
| d1pw4a_ | 447 | Glycerol-3-phosphate transporter {Escherichia coli | 96.44 | |
| d1hdla_ | 55 | Serine proteinase inhibitor lekti {Human (Homo sap | 95.88 | |
| d1n1ua_ | 29 | Kalata B1 {African plant (Oldenlandia affinis) [Ta | 81.35 |
| >d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Membrane and cell surface proteins and peptides fold: MFS general substrate transporter superfamily: MFS general substrate transporter family: Glycerol-3-phosphate transporter domain: Glycerol-3-phosphate transporter species: Escherichia coli [TaxId: 562]
Probab=99.63 E-value=3e-16 Score=144.21 Aligned_cols=190 Identities=13% Similarity=0.074 Sum_probs=134.2
Q ss_pred ccccccccchhhhcCccCCCCchhHHHHHHHHHHHHHHHHHHHHHhhhcccccCCCCCCCCCCCCchhHHHHHHHHHHHH
Q psy11785 2 GQTAVYTLGIPYIDDNVANRESPLYFAITIGVRILGPSLGFILGSFCTRLYVDLSIPSDITPSDPRWIGAWWLGLVLVAV 81 (308)
Q Consensus 2 G~a~~~~lg~a~i~d~~~~~~~~~~~gi~~~~~~~Gp~lG~~lGg~ll~~~v~~~~~~~~~~~~~~W~gaWw~~fii~g~ 81 (308)
|.+..++...+++.|++|+++|++++|++..+..+|.++||++++.+...+. .|+..|++.++
T Consensus 129 ~~~~~~~~~~~~i~~~~~~~~r~~~~~~~~~~~~~g~~i~~~~~~~~~~~~~-----------------~w~~~~~~~~~ 191 (447)
T d1pw4a_ 129 FQGMGWPPCGRTMVHWWSQKERGGIVSVWNCAHNVGGGIPPLLFLLGMAWFN-----------------DWHAALYMPAF 191 (447)
T ss_dssp HHHHTHHHHHHHHHTTCTTTHHHHHHHHHHHHHHHHHTSHHHHHHHHHHHTC-----------------CSTTCTHHHHH
T ss_pred hhhhhhhHHHHHHHHHHHhhcccccccccccccchhhhhhhhhhhhHhhhhh-----------------cccccchhhhh
Confidence 3456778889999999999999999999999999999999999998876432 24555666666
Q ss_pred HHHHHHHHHHhccCCCCCCCCccCCcccccCCCccccccCCCCCCcchHHHHHhhcChHHHHHHHHHHHHHHHHHHHHhH
Q psy11785 82 FLMLAAVAMFMFPKTLTKASPVNGTTTVATLPTKKESNQKNPSLKDFPKAVKRLLKNDILMYRTASSVLHILPIAGLYTF 161 (308)
Q Consensus 82 ~~ll~~i~~~~~p~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Ll~n~~f~~~~l~~~~~~~~~~~~~~~ 161 (308)
+.++.++..+.++++.|+.......++.+.......+++.+++........+++++|+.++...+..++.....+++.++
T Consensus 192 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 271 (447)
T d1pw4a_ 192 CAILVALFAFAMMRDTPQSCGLPPIEEYKNDYPDDYNEKAEQELTAKQIFMQYVLPNKLLWYIAIANVFVYLLRYGILDW 271 (447)
T ss_dssp HHHHHHHHHHHHCCCSSTTTCCCSCTTTCCC-------------CCTHHHHHHTSSCHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred hHHHHHHHHHHhcccchhhcccchhhhhhhhcccchhhccccccchhhHHHHHHHcCchHHHHHHHhhhhhhhhhcchhh
Confidence 66666666666666666544322111100000000001111112223345678999999999988889999999999999
Q ss_pred HHHHHHHHhCCCcccccccchhhhhhhhHHHhhhhheehhhccCCccc
Q psy11785 162 LPKYFETQFRLPSHTANMVSGVGGILVMGIGIILSGVFILKFKPNARF 209 (308)
Q Consensus 162 ~P~yl~~~~gls~~~agl~~g~~~i~~~~iG~~lgG~l~~r~~~~~~~ 209 (308)
+|.|+++.++++..++++......+ ..++|.+++|++.||++++.+.
T Consensus 272 ~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~g~~~~~~~~~~~~ 318 (447)
T d1pw4a_ 272 SPTYLKEVKHFALDKSSWAYFLYEY-AGIPGTLLCGWMSDKVFRGNRG 318 (447)
T ss_dssp HHHHBTTBSCCCHHHHHHHHHHHHH-HHHHHHHHHHHHHHHTSTTCHH
T ss_pred hhhhcccccccccchhhhhhhcchh-hhhhhhhhhhhhhhhccccccc
Confidence 9999999999999999887765543 5678999999999999866443
|
| >d1ldtl_ g.68.1.1 (L:) Leech derived tryptase inhibitor (LDTI-C) {Medicinal leech (Hirudo medicinalis) [TaxId: 6421]} | Back information, alignment and structure |
|---|
| >d2erwa1 g.68.1.1 (A:4-56) Blood-sucking insect-derived tryptase inhibitor {Triatoma infestans [TaxId: 30076]} | Back information, alignment and structure |
|---|
| >d2f3ci1 g.68.1.1 (I:5-50) Blood-sucking insect-derived tryptase inhibitor {Triatoma infestans [TaxId: 30076]} | Back information, alignment and structure |
|---|
| >d1lr7a2 g.68.1.1 (A:89-136) Domain of follistatin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1tbrr2 g.68.1.1 (R:52-103) Blood-sucking insect-derived tryptase inhibitor {Bug (Rhodnius prolixus), rhodniin [TaxId: 13249]} | Back information, alignment and structure |
|---|
| >d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nuba3 g.68.1.1 (A:78-135) Domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7kb1 g.68.1.1 (B:2-63) Ovomucoid domains {Turkey (Meleagris gallopavo) [TaxId: 9103]} | Back information, alignment and structure |
|---|
| >d1r0ri_ g.68.1.1 (I:) Ovomucoid domains {Turkey (Meleagris gallopavo) [TaxId: 9103]} | Back information, alignment and structure |
|---|
| >d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2busa_ g.68.1.1 (A:) Seminal plasma inhibitor IIa {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1pcea_ g.68.1.1 (A:) PEC-60 peptide {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1tgsi_ g.68.1.1 (I:) Secretory trypsin inhibitor {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1hpta_ g.68.1.1 (A:) Secretory trypsin inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h0za_ g.68.1.2 (A:) Serine proteinase inhibitor lekti {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hdla_ g.68.1.2 (A:) Serine proteinase inhibitor lekti {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n1ua_ g.3.3.1 (A:) Kalata B1 {African plant (Oldenlandia affinis) [TaxId: 60225]} | Back information, alignment and structure |
|---|