Psyllid ID: psy11797


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------25
MSQVTFICSDVDECRTPANTCKFSCKNLIDVDECRTPANTCKFSCKNLIGSYMCTCPPGYQQVTHSTVAIATTDTRTAESGGKSHECVDVNECELNLDSCANGRCVNLEGSYRCECERGFKLSLDGKQCLGKGQFVEFRIILSMPKAENSVNNNNNQRLGFCYRSLTNGRCVLPTGPALLMEVTRMDCCCTMGMAWGPQCQLCPTRGSQEYTDLCLESGLTVDGRDIDECVTIPAVESSKLAKMFLRAY
cccccccccccccccccccccccEEEcccccccccccccccccEEEEccccEEEEcccccEEccccccccccccccccccccccccccccccccccccccccccEEEccccEEEEcccccEEcccccccccccccccccccccccccccccccccccccccEEEccccccEEccccccccccccccEEEEcccccccccccccccccccEEEEcccccccccccccccccccccccccccEEEcccccc
ccccccEccccHcccccccccccccccccccHHccccccccccEEEcccccEEEEcccccEEcccccEccccccccccccccccccccccHHHccccccccccEEEcccccEEEEcccccEEcccccEEEcccccccccccccccccccccccccccccccEEccccccEEcccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccHHHHcccccccccEEEcccccc
msqvtficsdvdecrtpantckfscknlidvdecrtpantckfscknligsymctcppgyqqvthsTVAIattdtrtaesggkshecvdvnecelnldscangrcvnlegsyrcecergfklsldgkqclgkgqfVEFRIILSmpkaensvnnnnnqrlgfcyrsltngrcvlptgpalLMEVTRMdccctmgmawgpqcqlcptrgsqeytdlclesgltvdgrdidecvtipavesSKLAKMFLRAY
msqvtficsdvdecrtpantckfscknlidvdecrtpANTCKFSCKNLIGSYMCTCPPGYQQVTHSTVAIATTDtrtaesggkshECVDVNECELNLDSCANGRCVNLEGSYRCECERGFKLsldgkqclGKGQFVEFRIILSMPkaensvnnnNNQRLGFCYRSLTNGRCVLPTGPALLMEVTRMDCCCTMGMAWGPQCQLCPTRGSQEYTDLCLESGLTVDGRDIDECvtipavessklAKMFLRAY
MSQVTFICSDVDECRTPANTCKFSCKNLIDVDECRTPANTCKFSCKNLIGSYMCTCPPGYQQVTHSTVAIATTDTRTAESGGKSHECVDVNECELNLDSCANGRCVNLEGSYRCECERGFKLSLDGKQCLGKGQFVEFRIILSMPKAENSVNNNNNQRLGFCYRSLTNGRCVLPTGPALLMEVTRMDCCCTMGMAWGPQCQLCPTRGSQEYTDLCLESGLTVDGRDIDECVTIPAVESSKLAKMFLRAY
***VTFICSDVDECRTPANTCKFSCKNLIDVDECRTPANTCKFSCKNLIGSYMCTCPPGYQQVTHSTVAIATTDT*********HECVDVNECELNLDSCANGRCVNLEGSYRCECERGFKLSLDGKQCLGKGQFVEFRIILS***************LGFCYRSLTNGRCVLPTGPALLMEVTRMDCCCTMGMAWGPQCQLCPTRGSQEYTDLCLESGLTVDGRDIDECVTIPAVE************
MSQVTFICSDVDECRTPANTCKFSCKNLIDVDECRTPANTCKFSCKNLIGSYMCTCPPGYQQVTHSTVAIATTDTRTAESGGKSHECVDVNECELNLDSCANGRCVNLEGSYRCECERGFKLSLDGKQCLGKGQFVEFRIILSMPKAENSVNNNNNQRLGFCYRSLTNGRCVLPTGPALLMEVTRMDCCCTMGMAWGPQCQLCPTRGSQEYTDLCLESGLTVDGRDIDECVTIPAVESSKLAKMFLRAY
MSQVTFICSDVDECRTPANTCKFSCKNLIDVDECRTPANTCKFSCKNLIGSYMCTCPPGYQQVTHSTVAIATTD***********ECVDVNECELNLDSCANGRCVNLEGSYRCECERGFKLSLDGKQCLGKGQFVEFRIILSMPKAENSVNNNNNQRLGFCYRSLTNGRCVLPTGPALLMEVTRMDCCCTMGMAWGPQCQLCPTRGSQEYTDLCLESGLTVDGRDIDECVTIPAVESSKLAKMFLRAY
****TFICSDVDECRTPANTCKFSCKNLIDVDECRTPANTCKFSCKNLIGSYMCTCPPGYQQVTHSTVAIATTDTRTAESGGKSHECVDVNECELNLDSCANGRCVNLEGSYRCECERGFKLSLDGKQCLGKGQFVEFRIILSMPKAENSVNNNNNQRLGFCYRSLTNGRCVLPTGPALLMEVTRMDCCCTMGMAWGPQCQLCPTRGSQEYTDLCLESGLTVDGRDIDECVTIPAVESSKLAKMFLRAY
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSQVTFICSDVDECRTPANTCKFSCKNLIDVDECRTPANTCKFSCKNLIGSYMCTCPPGYQQVTHSTVAIATTDTRTAESGGKSHECVDVNECELNLDSCANGRCVNLEGSYRCECERGFKLSLDGKQCLGKGQFVEFRIILSMPKAENSVNNNNNQRLGFCYRSLTNGRCVLPTGPALLMEVTRMDCCCTMGMAWGPQCQLCPTRGSQEYTDLCLESGLTVDGRDIDECVTIPAVESSKLAKMFLRAY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query249 2.2.26 [Sep-21-2011]
P35556 2912 Fibrillin-2 OS=Homo sapie yes N/A 0.738 0.063 0.334 1e-26
Q61555 2907 Fibrillin-2 OS=Mus muscul yes N/A 0.738 0.063 0.330 1e-26
P35555 2871 Fibrillin-1 OS=Homo sapie no N/A 0.746 0.064 0.316 4e-24
P98133 2871 Fibrillin-1 OS=Bos taurus no N/A 0.746 0.064 0.316 4e-24
Q9TV36 2871 Fibrillin-1 OS=Sus scrofa no N/A 0.746 0.064 0.312 3e-23
Q61554 2871 Fibrillin-1 OS=Mus muscul no N/A 0.746 0.064 0.308 3e-22
Q75N90 2809 Fibrillin-3 OS=Homo sapie no N/A 0.650 0.057 0.301 9e-19
O08999 1813 Latent-transforming growt no N/A 0.630 0.086 0.312 2e-14
Q00918 1712 Latent-transforming growt no N/A 0.457 0.066 0.342 5e-14
Q9NS151303 Latent-transforming growt no N/A 0.598 0.114 0.329 9e-14
>sp|P35556|FBN2_HUMAN Fibrillin-2 OS=Homo sapiens GN=FBN2 PE=1 SV=3 Back     alignment and function desciption
 Score =  120 bits (301), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 85/254 (33%), Positives = 109/254 (42%), Gaps = 70/254 (27%)

Query: 8    CSDVDECRTPANTCKFSCKNLI---------------------DVDECRTPANTCK---F 43
            C D++EC      C F C N                       D+DEC    + C+    
Sbjct: 2251 CEDINECAQNPLLCAFRCMNTFGSYECTCPIGYALREDQKMCKDLDECAEGLHDCESRGM 2310

Query: 44   SCKNLIGSYMCTCPPGYQQVTHSTVAIATTDTRTAESGGKSHECVDVNECELNLDSCANG 103
             CKNLIG++MC CPPG                R  +  G    CVD NEC      C NG
Sbjct: 2311 MCKNLIGTFMCICPPGM--------------ARRPDGEG----CVDENECRTKPGICENG 2352

Query: 104  RCVNLEGSYRCECERGFKLSLDGKQCLGKGQFVEFRIILSMPKAENSVNNNNNQRLGFCY 163
            RCVN+ GSYRCEC  GF+ S  G +CL                         + R G C+
Sbjct: 2353 RCVNIIGSYRCECNEGFQSSSSGTECL-------------------------DNRQGLCF 2387

Query: 164  RSLTNGRCVLPTGPALLMEVTRMDCCCTMGMAWGPQCQLCPTRGSQEYTDLCLES-GLTV 222
              +    C + +    L  VT+ +CCC  G  WG QC+LCP  G+ +Y  +C    G T 
Sbjct: 2388 AEVLQTICQMASSSRNL--VTKSECCCDGGRGWGHQCELCPLPGTAQYKKICPHGPGYTT 2445

Query: 223  DGRDIDECVTIPAV 236
            DGRDIDEC  +P +
Sbjct: 2446 DGRDIDECKVMPNL 2459




Fibrillins are structural components of 10-12 nm extracellular calcium-binding microfibrils, which occur either in association with elastin or in elastin-free bundles. Fibrillin-2-containing microfibrils regulate the early process of elastic fiber assembly. Regulates osteoblast maturation by controlling TGF-beta bioavailability and calibrating TGF-beta and BMP levels, respectively.
Homo sapiens (taxid: 9606)
>sp|Q61555|FBN2_MOUSE Fibrillin-2 OS=Mus musculus GN=Fbn2 PE=1 SV=2 Back     alignment and function description
>sp|P35555|FBN1_HUMAN Fibrillin-1 OS=Homo sapiens GN=FBN1 PE=1 SV=3 Back     alignment and function description
>sp|P98133|FBN1_BOVIN Fibrillin-1 OS=Bos taurus GN=FBN1 PE=1 SV=1 Back     alignment and function description
>sp|Q9TV36|FBN1_PIG Fibrillin-1 OS=Sus scrofa GN=FBN1 PE=2 SV=1 Back     alignment and function description
>sp|Q61554|FBN1_MOUSE Fibrillin-1 OS=Mus musculus GN=Fbn1 PE=1 SV=1 Back     alignment and function description
>sp|Q75N90|FBN3_HUMAN Fibrillin-3 OS=Homo sapiens GN=FBN3 PE=2 SV=3 Back     alignment and function description
>sp|O08999|LTBP2_MOUSE Latent-transforming growth factor beta-binding protein 2 OS=Mus musculus GN=Ltbp2 PE=1 SV=2 Back     alignment and function description
>sp|Q00918|LTBP1_RAT Latent-transforming growth factor beta-binding protein 1 OS=Rattus norvegicus GN=Ltbp1 PE=1 SV=1 Back     alignment and function description
>sp|Q9NS15|LTBP3_HUMAN Latent-transforming growth factor beta-binding protein 3 OS=Homo sapiens GN=LTBP3 PE=1 SV=4 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query249
321472519 2762 hypothetical protein DAPPUDRAFT_315775 [ 0.742 0.066 0.442 6e-48
380016550 2868 PREDICTED: fibrillin-2-like [Apis florea 0.807 0.070 0.419 7e-48
383864528 2865 PREDICTED: fibrillin-2-like [Megachile r 0.807 0.070 0.411 1e-47
328787226 2870 PREDICTED: fibrillin-2-like [Apis mellif 0.807 0.070 0.411 7e-47
332018680 2757 Fibrillin-2 [Acromyrmex echinatior] 0.795 0.071 0.412 7e-47
307166306 2876 Fibrillin-2 [Camponotus floridanus] 0.795 0.068 0.405 8e-47
350416792 2865 PREDICTED: fibrillin-2-like [Bombus impa 0.807 0.070 0.404 3e-46
340721645 2865 PREDICTED: fibrillin-2-like [Bombus terr 0.807 0.070 0.404 4e-46
307196014 2862 Fibrillin-2 [Harpegnathos saltator] 0.742 0.064 0.422 4e-46
328715164 3100 PREDICTED: fibrillin-2-like [Acyrthosiph 0.807 0.064 0.408 2e-45
>gi|321472519|gb|EFX83489.1| hypothetical protein DAPPUDRAFT_315775 [Daphnia pulex] Back     alignment and taxonomy information
 Score =  196 bits (499), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 111/251 (44%), Positives = 137/251 (54%), Gaps = 66/251 (26%)

Query: 7    ICSDVDECRTPANTCKFSCKNLI---------------------DVDECRTPANTCKFSC 45
            IC DVDEC+   + C F C N+                      DVDEC TPAN CKF+C
Sbjct: 2095 ICEDVDECQEMGHQCAFRCHNVPGSFRCICPYGYTLAADGRHCQDVDECSTPANNCKFAC 2154

Query: 46   KNLIGSYMCTCPPGYQQVTHSTVAIATTDTRTAESGGKSHECVDVNECELNLDSCANGRC 105
            KNLIGS+MC CP GY QV                  G + +C DVNEC  N + C NG C
Sbjct: 2155 KNLIGSFMCICPEGYTQV------------------GMTDDCRDVNECAANGNLCKNGHC 2196

Query: 106  VNLEGSYRCECERGFKLSLDGKQCLGKGQFVEFRIILSMPKAENSVNNNNNQRLGFCYRS 165
            VN +GSY+CEC  GF++S DGK C+                         ++R G+C+R 
Sbjct: 2197 VNTKGSYKCECYEGFEVSSDGKSCI-------------------------DRRTGYCFRQ 2231

Query: 166  LTNGRCVLPTGPALLMEVTRMDCCCTMGMAWGPQCQLCPTRGSQEYTDLCLESGLTVDGR 225
            L +G C   T    LM+VT+ DCCCTMG AWGP C+ CP +GS+EY +LCLE G +VDG 
Sbjct: 2232 LMSGMCTTHT--DGLMQVTKADCCCTMGAAWGPMCEHCPRKGSEEYEELCLEVGYSVDGH 2289

Query: 226  DIDECVTIPAV 236
            DIDEC TIP +
Sbjct: 2290 DIDECNTIPNL 2300




Source: Daphnia pulex

Species: Daphnia pulex

Genus: Daphnia

Family: Daphniidae

Order: Diplostraca

Class: Branchiopoda

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|380016550|ref|XP_003692245.1| PREDICTED: fibrillin-2-like [Apis florea] Back     alignment and taxonomy information
>gi|383864528|ref|XP_003707730.1| PREDICTED: fibrillin-2-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|328787226|ref|XP_003250904.1| PREDICTED: fibrillin-2-like [Apis mellifera] Back     alignment and taxonomy information
>gi|332018680|gb|EGI59252.1| Fibrillin-2 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307166306|gb|EFN60488.1| Fibrillin-2 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|350416792|ref|XP_003491105.1| PREDICTED: fibrillin-2-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340721645|ref|XP_003399227.1| PREDICTED: fibrillin-2-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|307196014|gb|EFN77739.1| Fibrillin-2 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|328715164|ref|XP_001945971.2| PREDICTED: fibrillin-2-like [Acyrthosiphon pisum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query249
UNIPROTKB|E1C5P6 2869 FBN3 "Uncharacterized protein" 0.742 0.064 0.315 1.1e-23
UNIPROTKB|E2RS46 2921 FBN2 "Uncharacterized protein" 0.867 0.073 0.302 2e-20
UNIPROTKB|P35556 2912 FBN2 "Fibrillin-2" [Homo sapie 0.867 0.074 0.306 2e-20
UNIPROTKB|G3V511 1769 LTBP2 "Latent-transforming gro 0.542 0.076 0.343 2e-22
UNIPROTKB|Q14767 1821 LTBP2 "Latent-transforming gro 0.542 0.074 0.343 2.2e-22
UNIPROTKB|F1M5Q4 859 Fbn2 "Protein Fbn2" [Rattus no 0.767 0.222 0.301 2.6e-22
UNIPROTKB|G3V9M6 2872 Fbn1 "Fibrillin 1, isoform CRA 0.746 0.064 0.297 3.3e-22
RGD|620908 2872 Fbn1 "fibrillin 1" [Rattus nor 0.746 0.064 0.297 3.3e-22
UNIPROTKB|E1C3A6 2914 FBN2 "Uncharacterized protein" 0.867 0.074 0.295 9.8e-21
UNIPROTKB|F1MTZ4 3672 Bt.110891 "Uncharacterized pro 0.867 0.058 0.298 4.3e-20
UNIPROTKB|E1C5P6 FBN3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 265 (98.3 bits), Expect = 1.1e-23, Sum P(2) = 1.1e-23
 Identities = 71/225 (31%), Positives = 103/225 (45%)

Query:    30 DVDECRTPANTCKFSCKNLIGSYMCTCPPGYQQVTHSTVAIATTDTRTAESGGKSHECVD 89
             D++EC +    C F C N  GSY CTCP GY        A+   D R         EC +
Sbjct:  2211 DINECASNPLLCAFRCINTFGSYECTCPSGY--------ALRD-DRRMCRD---LDECAE 2258

Query:    90 -VNECELNLDSCANGR-CVNLEGSYRCECERGFKLSLDGKQCLGKGQFVEFRIILSMPKA 147
              +++CE      + G  C NL G++ C C  G +   DG+ C  + +      I    + 
Sbjct:  2259 GLHDCE------SRGMLCKNLIGTFMCICPPGMQRRPDGEGCTDENECRTKPGICPNGRC 2312

Query:   148 ENSVNNNN---NQ--------------RLGFCYRSLTNGRCVLPTGPALLMEVTRMDCCC 190
              N+V +     N+              R GFC+  +    C + +    L  VT+ +CCC
Sbjct:  2313 INTVGSYRCDCNEGFEVSPSGTECIDTRQGFCFTEVLQTMCQMSSTNRNL--VTKSECCC 2370

Query:   191 TMGMAWGPQCQLCPTRGSQEYTDLCLES-GLTVDGRDIDECVTIP 234
               G +WGPQC+LCP  G+ +Y  +C    G + DGRDIDEC  +P
Sbjct:  2371 NSGRSWGPQCELCPLLGTAQYKKMCPHGPGYSTDGRDIDECKVLP 2415


GO:0005201 "extracellular matrix structural constituent" evidence=IEA
GO:0005509 "calcium ion binding" evidence=IEA
GO:0005578 "proteinaceous extracellular matrix" evidence=IEA
UNIPROTKB|E2RS46 FBN2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P35556 FBN2 "Fibrillin-2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|G3V511 LTBP2 "Latent-transforming growth factor beta-binding protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q14767 LTBP2 "Latent-transforming growth factor beta-binding protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1M5Q4 Fbn2 "Protein Fbn2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|G3V9M6 Fbn1 "Fibrillin 1, isoform CRA_a" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|620908 Fbn1 "fibrillin 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1C3A6 FBN2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MTZ4 Bt.110891 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query249
pfam0068342 pfam00683, TB, TB domain 9e-07
pfam0764542 pfam07645, EGF_CA, Calcium-binding EGF domain 9e-06
smart0017939 smart00179, EGF_CA, Calcium-binding EGF-like domai 1e-05
pfam0764542 pfam07645, EGF_CA, Calcium-binding EGF domain 4e-05
cd0005438 cd00054, EGF_CA, Calcium-binding EGF-like domain, 7e-05
smart0017939 smart00179, EGF_CA, Calcium-binding EGF-like domai 2e-04
cd0005438 cd00054, EGF_CA, Calcium-binding EGF-like domain, 4e-04
>gnl|CDD|201391 pfam00683, TB, TB domain Back     alignment and domain information
 Score = 44.2 bits (105), Expect = 9e-07
 Identities = 19/46 (41%), Positives = 27/46 (58%), Gaps = 4/46 (8%)

Query: 169 GRCVLPTGPALLMEVTRMDCCCTMGMAWGPQCQLCPTRGSQEYTDL 214
           GRC  P        VT+ +CCC++G AWG  C+ CP +G+ E+  L
Sbjct: 1   GRCSNPLPGN----VTKSECCCSLGRAWGTPCEPCPVQGTAEFRQL 42


This domain is also known as the 8 cysteine domain. This family includes the hybrid domains. This cysteine rich repeat is found in TGF binding protein and fibrillin. Length = 42

>gnl|CDD|219496 pfam07645, EGF_CA, Calcium-binding EGF domain Back     alignment and domain information
>gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain Back     alignment and domain information
>gnl|CDD|219496 pfam07645, EGF_CA, Calcium-binding EGF domain Back     alignment and domain information
>gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain Back     alignment and domain information
>gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 249
KOG1214|consensus 1289 99.31
KOG1214|consensus 1289 99.28
KOG1219|consensus 4289 99.08
KOG1219|consensus 4289 98.93
KOG4289|consensus 2531 98.87
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 98.68
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 98.57
KOG1217|consensus 487 98.48
KOG1217|consensus 487 98.35
PF1467036 FXa_inhibition: Coagulation Factor Xa inhibitory s 98.23
KOG4260|consensus350 98.14
PF1266224 cEGF: Complement Clr-like EGF-like 98.06
KOG4289|consensus 2531 97.96
PF1266224 cEGF: Complement Clr-like EGF-like 97.95
PF1467036 FXa_inhibition: Coagulation Factor Xa inhibitory s 97.85
smart0017939 EGF_CA Calcium-binding EGF-like domain. 97.8
KOG4260|consensus350 97.69
PF1294736 EGF_3: EGF domain; InterPro: IPR024731 This entry 97.53
PF0000832 EGF: EGF-like domain This is a sub-family of the P 97.51
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 97.45
smart0017939 EGF_CA Calcium-binding EGF-like domain. 97.41
KOG1225|consensus 525 97.33
PF1294736 EGF_3: EGF domain; InterPro: IPR024731 This entry 97.25
PF0068342 TB: TB domain; InterPro: IPR002212 Transforming gr 96.87
KOG1225|consensus 525 96.8
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 96.79
PF0000832 EGF: EGF-like domain This is a sub-family of the P 96.63
cd0005336 EGF Epidermal growth factor domain, found in epide 96.35
cd01475224 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, 96.32
smart0018135 EGF Epidermal growth factor-like domain. 96.32
smart0018135 EGF Epidermal growth factor-like domain. 96.21
PF06247197 Plasmod_Pvs28: Plasmodium ookinete surface protein 96.19
cd0005336 EGF Epidermal growth factor domain, found in epide 96.07
cd01475224 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, 95.84
PF1266113 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E 94.29
KOG0994|consensus 1758 92.8
KOG0994|consensus 1758 92.56
KOG1226|consensus 783 90.28
PF0797432 EGF_2: EGF-like domain; InterPro: IPR013111 A sequ 89.9
PF06247197 Plasmod_Pvs28: Plasmodium ookinete surface protein 88.26
PF1294637 EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 81.0
>KOG1214|consensus Back     alignment and domain information
Probab=99.31  E-value=6.5e-12  Score=115.15  Aligned_cols=158  Identities=27%  Similarity=0.556  Sum_probs=114.8

Q ss_pred             CCccCCCCCCCC--CCceecCC-CeeeecCCCccccCCCcccccccCCccccCCCCCCceecCcccccCCCCCC-CCeee
Q psy11797         31 VDECRTPANTCK--FSCKNLIG-SYMCTCPPGYQQVTHSTVAIATTDTRTAESGGKSHECVDVNECELNLDSCA-NGRCV  106 (249)
Q Consensus        31 id~C~~~~~~c~--~~C~n~~g-sy~C~C~~G~~g~~~~~~~~~~~~~~~~~~~~~~~~C~~i~~C~~~~~~C~-~g~C~  106 (249)
                      ++.|..+.+.|.  +.|....+ .|+|.|..||.|++                    ..|.|+++|+.....|. +.+|+
T Consensus       692 ~npCy~gsh~cdt~a~C~pg~~~~~tcecs~g~~gdg--------------------r~c~d~~eca~~~~~CGp~s~Ci  751 (1289)
T KOG1214|consen  692 VNPCYDGSHMCDTTARCHPGTGVDYTCECSSGYQGDG--------------------RNCVDENECATGFHRCGPNSVCI  751 (1289)
T ss_pred             cccceecCcccCCCccccCCCCcceEEEEeeccCCCC--------------------CCCCChhhhccCCCCCCCCceee
Confidence            567777777776  77876654 59999999999876                    67899999998788899 88999


Q ss_pred             eCCCcceeecCCCceeCCCCCCcccCCCccceeeeecCCcccccccC--CCCCcc--cccccc-CCCCcccCCCCCCccC
Q psy11797        107 NLEGSYRCECERGFKLSLDGKQCLGKGQFVEFRIILSMPKAENSVNN--NNNQRL--GFCYRS-LTNGRCVLPTGPALLM  181 (249)
Q Consensus       107 ~~~g~~~C~C~~G~~~~~~g~~C~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~--~~C~~~-~~~~~C~c~~g~~~~~  181 (249)
                      +.+++|+|.|..||...+++.+|..+..-+.          .+.|..  ..|.-.  ..|... .+.|.|.|.+||.++.
T Consensus       752 n~pg~~rceC~~gy~F~dd~~tCV~i~~pap----------~n~Ce~g~h~C~i~g~a~c~~hGgs~y~C~CLPGfsGDG  821 (1289)
T KOG1214|consen  752 NLPGSYRCECRSGYEFADDRHTCVLITPPAP----------ANPCEDGSHTCAIAGQARCVHHGGSTYSCACLPGFSGDG  821 (1289)
T ss_pred             cCCCceeEEEeecceeccCCcceEEecCCCC----------CCccccCccccCcCCceEEEecCCceEEEeecCCccCCc
Confidence            9999999999999999999999987432111          111211  223333  344444 3459999999998875


Q ss_pred             --CCCcceeecCCCCccCCCCccCCCCCCchhhccCCCCCccCCC
Q psy11797        182 --EVTRMDCCCTMGMAWGPQCQLCPTRGSQEYTDLCLESGLTVDG  224 (249)
Q Consensus       182 --~~~~~~C~C~~g~~~g~~C~~C~~~~~~~~~c~Cp~~G~~~~~  224 (249)
                        +.+.++|.=+..+- .++|    ....++|.|.| .+||.||+
T Consensus       822 ~~c~dvDeC~psrChp-~A~C----yntpgsfsC~C-~pGy~GDG  860 (1289)
T KOG1214|consen  822 HQCTDVDECSPSRCHP-AATC----YNTPGSFSCRC-QPGYYGDG  860 (1289)
T ss_pred             cccccccccCccccCC-CceE----ecCCCcceeec-ccCccCCC
Confidence              45667775222222 4455    45557799999 89999988



>KOG1214|consensus Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>KOG1217|consensus Back     alignment and domain information
>KOG1217|consensus Back     alignment and domain information
>PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A Back     alignment and domain information
>KOG4260|consensus Back     alignment and domain information
>PF12662 cEGF: Complement Clr-like EGF-like Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>PF12662 cEGF: Complement Clr-like EGF-like Back     alignment and domain information
>PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>KOG4260|consensus Back     alignment and domain information
>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>KOG1225|consensus Back     alignment and domain information
>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins Back     alignment and domain information
>PF00683 TB: TB domain; InterPro: IPR002212 Transforming growth factor beta (TGF-beta)-binding protein-like (TB) domain comes from human fibrillin-1[] Back     alignment and domain information
>KOG1225|consensus Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>PF06247 Plasmod_Pvs28: Plasmodium ookinete surface protein Pvs28; InterPro: IPR010423 This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity Back     alignment and domain information
>PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A Back     alignment and domain information
>KOG0994|consensus Back     alignment and domain information
>KOG0994|consensus Back     alignment and domain information
>KOG1226|consensus Back     alignment and domain information
>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>PF06247 Plasmod_Pvs28: Plasmodium ookinete surface protein Pvs28; InterPro: IPR010423 This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium Back     alignment and domain information
>PF12946 EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 This EGF-like domain is found at the C terminus of the malaria parasite MSP1 protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query249
1uzj_A162 Integrin Binding Cbegf22-Tb4-Cbegf33 Fragment Of Hu 1e-10
1uzk_A162 Integrin Binding Cbegf22-tb4-cbegf33 Fragment Of Hu 3e-10
3p5b_L 400 The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE 1e-07
3p5c_L 440 The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE 1e-07
3m0c_C 791 The X-Ray Crystal Structure Of Pcsk9 In Complex Wit 1e-07
1n7d_A 699 Extracellular Domain Of The Ldl Receptor Length = 6 1e-07
2w2n_E107 Wt Pcsk9-Deltac Bound To Egf-A H306y Mutant Of Ldlr 2e-07
3gcw_E83 Pcsk9:egfa(H306y) Length = 83 4e-07
1emn_A82 Nmr Study Of A Pair Of Fibrillin Ca2+ Binding Epide 5e-07
1lmj_A86 Nmr Study Of The Fibrillin-1 Cbegf12-13 Pair Of Ca2 6e-07
2w2m_E107 Wt Pcsk9-Deltac Bound To Wt Egf-A Of Ldlr Length = 7e-07
1z6c_A87 Solution Structure Of An Egf Pair (Egf34) From Vita 8e-07
3bps_E83 Pcsk9:egf-a Complex Length = 83 1e-06
1hz8_A82 Solution Structure And Backbone Dynamics Of A Conca 1e-06
1hj7_A80 Nmr Study Of A Pair Of Ldl Receptor Ca2+ Binding Ep 2e-06
2w86_A147 Crystal Structure Of Fibrillin-1 Domains Cbegf9hyb2 7e-06
2w86_A147 Crystal Structure Of Fibrillin-1 Domains Cbegf9hyb2 2e-05
2vj3_A135 Human Notch-1 Egfs 11-13 Length = 135 2e-05
1toz_A116 Nmr Structure Of The Human Notch-1 Ligand Binding R 5e-05
2bo2_A143 Egf Domains 1,2,5 Of Human Emr2, A 7-Tm Immune Syst 6e-05
3v65_B 386 Crystal Structure Of Agrin And Lrp4 Complex Length 9e-05
1apj_A74 Nmr Study Of The Transforming Growth Factor Beta Bi 2e-04
1ksq_A75 Nmr Study Of The Third Tb Domain From Latent Transf 4e-04
>pdb|1UZJ|A Chain A, Integrin Binding Cbegf22-Tb4-Cbegf33 Fragment Of Human Fibrillin-1, Holo Form. Length = 162 Back     alignment and structure

Iteration: 1

Score = 63.5 bits (153), Expect = 1e-10, Method: Compositional matrix adjust. Identities = 46/158 (29%), Positives = 73/158 (46%), Gaps = 36/158 (22%) Query: 88 VDVNECELNLDSCANGRCVNLEGSYRCECERGFKLSLDGKQCLGKGQ---FVEFRIILSM 144 DVNEC L+ +C +G CVN GSY C+C F+L+ C+ +++ R Sbjct: 1 TDVNEC-LDPTTCISGNCVNTPGSYICDCPPDFELNPTRVGCVDTRSGNCYLDIR----- 54 Query: 145 PKAENSVNNNNNQRLGFCYRSLTNGRCVLPTGPALLMEVTRMDCCCTMGMAWGPQCQLCP 204 P+ +N +N+ + + V++ CCC++G AWG C++CP Sbjct: 55 PRGDNGDTACSNE---------------------IGVGVSKASCCCSLGKAWGTPCEMCP 93 Query: 205 TRGSQEYTDLC------LESGLTVDGRDIDECVTIPAV 236 + EY LC + +TV DIDEC +P + Sbjct: 94 AVNTSEYKILCPGGEGFRPNPITVILEDIDECQELPGL 131
>pdb|1UZK|A Chain A, Integrin Binding Cbegf22-tb4-cbegf33 Fragment Of Human Fibrillin-1, Ca Bound To Cbegf23 Domain Only Length = 162 Back     alignment and structure
>pdb|3P5B|L Chain L, The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE RECEPTOR IN AN Extended Conformation Length = 400 Back     alignment and structure
>pdb|3P5C|L Chain L, The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE RECEPTOR IN AN Extended Conformation Length = 440 Back     alignment and structure
>pdb|3M0C|C Chain C, The X-Ray Crystal Structure Of Pcsk9 In Complex With The Ldl Receptor Length = 791 Back     alignment and structure
>pdb|1N7D|A Chain A, Extracellular Domain Of The Ldl Receptor Length = 699 Back     alignment and structure
>pdb|2W2N|E Chain E, Wt Pcsk9-Deltac Bound To Egf-A H306y Mutant Of Ldlr Length = 107 Back     alignment and structure
>pdb|3GCW|E Chain E, Pcsk9:egfa(H306y) Length = 83 Back     alignment and structure
>pdb|1EMN|A Chain A, Nmr Study Of A Pair Of Fibrillin Ca2+ Binding Epidermal Growth Factor-Like Domains, Minimized Average Structure Length = 82 Back     alignment and structure
>pdb|1LMJ|A Chain A, Nmr Study Of The Fibrillin-1 Cbegf12-13 Pair Of Ca2+ Binding Epidermal Growth Factor-like Domains Length = 86 Back     alignment and structure
>pdb|2W2M|E Chain E, Wt Pcsk9-Deltac Bound To Wt Egf-A Of Ldlr Length = 107 Back     alignment and structure
>pdb|1Z6C|A Chain A, Solution Structure Of An Egf Pair (Egf34) From Vitamin K- Dependent Protein S Length = 87 Back     alignment and structure
>pdb|3BPS|E Chain E, Pcsk9:egf-a Complex Length = 83 Back     alignment and structure
>pdb|1HZ8|A Chain A, Solution Structure And Backbone Dynamics Of A Concatemer Of Egf-Homology Modules Of The Human Low Density Lipoprotein Receptor Length = 82 Back     alignment and structure
>pdb|1HJ7|A Chain A, Nmr Study Of A Pair Of Ldl Receptor Ca2+ Binding Epidermal Growth Factor-Like Domains, 20 Structures Length = 80 Back     alignment and structure
>pdb|2W86|A Chain A, Crystal Structure Of Fibrillin-1 Domains Cbegf9hyb2cbegf10, Calcium Saturated Form Length = 147 Back     alignment and structure
>pdb|2W86|A Chain A, Crystal Structure Of Fibrillin-1 Domains Cbegf9hyb2cbegf10, Calcium Saturated Form Length = 147 Back     alignment and structure
>pdb|2VJ3|A Chain A, Human Notch-1 Egfs 11-13 Length = 135 Back     alignment and structure
>pdb|1TOZ|A Chain A, Nmr Structure Of The Human Notch-1 Ligand Binding Region Length = 116 Back     alignment and structure
>pdb|2BO2|A Chain A, Egf Domains 1,2,5 Of Human Emr2, A 7-Tm Immune System Molecule, In Complex With Calcium. Length = 143 Back     alignment and structure
>pdb|3V65|B Chain B, Crystal Structure Of Agrin And Lrp4 Complex Length = 386 Back     alignment and structure
>pdb|1APJ|A Chain A, Nmr Study Of The Transforming Growth Factor Beta Binding Protein-Like Domain (Tb Module8-Cys Domain), Nmr, 21 Structures Length = 74 Back     alignment and structure
>pdb|1KSQ|A Chain A, Nmr Study Of The Third Tb Domain From Latent Transforming Growth Factor-Beta Binding Protein-1 Length = 75 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query249
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 1e-23
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 3e-04
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 3e-19
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 9e-10
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 4e-09
2bou_A143 EGF-like module containing mucin-like hormone rece 8e-19
2bou_A143 EGF-like module containing mucin-like hormone rece 4e-11
2bou_A143 EGF-like module containing mucin-like hormone rece 6e-07
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 2e-18
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 2e-15
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 3e-09
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 3e-18
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 2e-09
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 4e-09
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 3e-17
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 4e-10
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 9e-17
1apj_A74 Fibrillin; microfibril, TB module, marfan syndrome 5e-13
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 5e-11
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 4e-05
1aut_L114 Activated protein C; serine proteinase, plasma cal 2e-10
3v65_B 386 Low-density lipoprotein receptor-related protein; 8e-10
3v65_B 386 Low-density lipoprotein receptor-related protein; 2e-06
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 1e-08
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 7e-08
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 9e-08
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 1e-07
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 2e-06
1ksq_A75 Latent transforming growth factor beta binding pro 2e-07
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 3e-07
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 5e-07
2vh0_B134 Activated factor XA light chain; serine protease, 7e-07
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 1e-06
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 6e-06
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 1e-06
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 3e-04
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 1e-05
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 3e-04
1gl4_A 285 Nidogen-1, entactin; immunoglobulin-like domain, e 6e-04
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 Back     alignment and structure
 Score = 90.0 bits (224), Expect = 1e-23
 Identities = 33/102 (32%), Positives = 45/102 (44%), Gaps = 18/102 (17%)

Query: 30  DVDECRTPANTCK-FSCKNLIGSYMCTCPPGYQQVTHSTVAIATTDTRTAESGGKSHECV 88
           D+DECR   + C    C N  G + C C  GY+                         C+
Sbjct: 2   DIDECRISPDLCGRGQCVNTPGDFECKCDEGYES-----------------GFMMMKNCM 44

Query: 89  DVNECELNLDSCANGRCVNLEGSYRCECERGFKLSLDGKQCL 130
           D++EC+ +   C  G C N EGSYRCEC  G +LS +   C+
Sbjct: 45  DIDECQRDPLLCRGGVCHNTEGSYRCECPPGHQLSPNISACI 86


>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 Back     alignment and structure
>1apj_A Fibrillin; microfibril, TB module, marfan syndrome, connective tissue, novel fold, extracellular matrix; NMR {Homo sapiens} SCOP: g.23.1.1 Length = 74 Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 Back     alignment and structure
>1ksq_A Latent transforming growth factor beta binding protein 1; structure, LTBP-1, TGF-beta, TB domain, latency associated propeptide, LAP; NMR {Homo sapiens} SCOP: g.23.1.1 Length = 75 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Length = 53 Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Length = 53 Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Length = 186 Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Length = 186 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Length = 285 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query249
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 99.74
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 99.74
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 99.69
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 99.67
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 99.66
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 99.66
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 99.59
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 99.59
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 99.57
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 99.56
2bou_A143 EGF-like module containing mucin-like hormone rece 99.56
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 99.55
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 99.55
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 99.55
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 99.52
2bou_A143 EGF-like module containing mucin-like hormone rece 99.51
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 99.5
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 99.49
1aut_L114 Activated protein C; serine proteinase, plasma cal 99.46
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 99.46
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 99.44
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 99.43
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 99.41
2vh0_B134 Activated factor XA light chain; serine protease, 99.4
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 99.39
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 99.37
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 99.31
3v65_B 386 Low-density lipoprotein receptor-related protein; 99.3
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 99.3
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 99.27
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 99.26
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 99.23
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 99.13
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 99.12
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 99.1
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 99.04
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 99.03
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 99.0
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 98.99
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 98.98
1aut_L114 Activated protein C; serine proteinase, plasma cal 98.82
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 98.81
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 98.81
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 98.77
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 98.73
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 98.72
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 98.72
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 98.7
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 98.68
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 98.65
2vh0_B134 Activated factor XA light chain; serine protease, 98.64
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 98.6
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 98.6
3v65_B 386 Low-density lipoprotein receptor-related protein; 98.59
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 98.59
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 98.57
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 98.55
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 98.49
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 98.49
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 98.42
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 98.37
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 98.36
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 98.31
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 98.3
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 98.28
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 98.22
2k2s_B61 Micronemal protein 6; microneme protein complex, c 98.14
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 98.14
1apj_A74 Fibrillin; microfibril, TB module, marfan syndrome 98.13
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 98.12
2wph_E59 Coagulation factor IXA light chain; serine proteas 98.1
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 98.02
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 98.0
2wph_E59 Coagulation factor IXA light chain; serine proteas 97.99
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 97.99
2kl7_A71 Fibulin-4; secreted, calcium, disease mutation, di 97.89
1a3p_A45 Epidermal growth factor; disulfide connectivities, 97.89
2kl7_A71 Fibulin-4; secreted, calcium, disease mutation, di 97.86
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 97.8
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 97.8
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 97.78
1gl4_A285 Nidogen-1, entactin; immunoglobulin-like domain, e 97.68
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 97.6
1ksq_A75 Latent transforming growth factor beta binding pro 97.54
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 97.51
1szb_A170 Mannose binding lectin-associated serine protease- 97.5
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 97.43
1gl4_A 285 Nidogen-1, entactin; immunoglobulin-like domain, e 97.4
3f1s_B 283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 97.22
2k2s_B61 Micronemal protein 6; microneme protein complex, c 97.18
1szb_A170 Mannose binding lectin-associated serine protease- 97.03
1a3p_A45 Epidermal growth factor; disulfide connectivities, 96.97
3v64_C 349 Agrin; beta propeller, laminin-G, signaling, prote 96.84
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 96.83
3f1s_B283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 96.71
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 96.7
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 96.7
1ob1_C99 Major merozoite surface protein; immune system, im 96.68
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 96.67
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 96.64
1nql_B53 Epidermal growth factor; cell surface receptor, ty 96.64
1n1i_A105 Merozoite surface protein-1; MSP1, malaria, surfac 96.59
1nzi_A159 Complement C1S component; calcium, innate immunity 96.57
3v64_C 349 Agrin; beta propeller, laminin-G, signaling, prote 96.34
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 96.18
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 95.96
1nzi_A159 Complement C1S component; calcium, innate immunity 95.93
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 95.92
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 95.9
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 95.88
1nql_B53 Epidermal growth factor; cell surface receptor, ty 95.71
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 95.54
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 95.48
1q4g_A 553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 95.43
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 95.4
3nt1_A 587 Prostaglandin-endoperoxide synthase 2; prostagland 95.19
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 95.0
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 94.87
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 94.59
2fd6_A122 Urokinase-type plasminogen activator; UPAR, ATF, A 94.51
2fd6_A122 Urokinase-type plasminogen activator; UPAR, ATF, A 94.26
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 93.77
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 93.58
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 93.55
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 93.52
3e50_C50 Protransforming growth factor alpha; IDE, TGF-alph 93.47
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 92.76
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 92.46
3cfw_A164 L-selectin; EGF, cell adhesion, EGF-like domain, g 92.38
2rnl_A50 Amphiregulin; AR, colorectum cell-derived growth f 92.25
1q4g_A 553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 92.11
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 91.87
1iox_A50 Betacellulin; EGF-like fold, hormone/growth factor 91.67
1g1t_A157 E-selectin; EGF, adhesion molecule, SLEX, immune s 91.62
3cfw_A164 L-selectin; EGF, cell adhesion, EGF-like domain, g 91.41
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 91.29
1xdt_R79 Hbegf, heparin-binding epidermal growth factor; co 90.09
3nt1_A 587 Prostaglandin-endoperoxide synthase 2; prostagland 90.06
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 89.47
1xdt_R79 Hbegf, heparin-binding epidermal growth factor; co 88.92
1n1i_A105 Merozoite surface protein-1; MSP1, malaria, surfac 88.41
1iox_A50 Betacellulin; EGF-like fold, hormone/growth factor 88.02
2rnl_A50 Amphiregulin; AR, colorectum cell-derived growth f 87.98
1ob1_C99 Major merozoite surface protein; immune system, im 87.82
2i9a_A145 Urokinase-type plasminogen activator; growth facto 86.84
3asi_A410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 86.58
3e50_C50 Protransforming growth factor alpha; IDE, TGF-alph 85.66
1g1t_A157 E-selectin; EGF, adhesion molecule, SLEX, immune s 82.54
2i9a_A145 Urokinase-type plasminogen activator; growth facto 82.17
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
Probab=99.74  E-value=6e-18  Score=127.20  Aligned_cols=117  Identities=31%  Similarity=0.674  Sum_probs=89.4

Q ss_pred             CCCccCCCCCCC--CCCceecCCCeeeecCCCccccCCCcccccccCCccccCCCCCCceecCcccccCCCCCC-CCeee
Q psy11797         30 DVDECRTPANTC--KFSCKNLIGSYMCTCPPGYQQVTHSTVAIATTDTRTAESGGKSHECVDVNECELNLDSCA-NGRCV  106 (249)
Q Consensus        30 did~C~~~~~~c--~~~C~n~~gsy~C~C~~G~~g~~~~~~~~~~~~~~~~~~~~~~~~C~~i~~C~~~~~~C~-~g~C~  106 (249)
                      |||+|+.....|  .++|+++.++|+|.|++||+|..++                     .++++|..  .+|. ++.|+
T Consensus         4 dideC~~~~~~C~~~g~C~~~~g~~~C~C~~Gy~G~~C~---------------------~~~~~C~~--~~C~~~~~C~   60 (135)
T 2vj3_A            4 DVDECSLGANPCEHAGKCINTLGSFECQCLQGYTGPRCE---------------------IDVNECVS--NPCQNDATCL   60 (135)
T ss_dssp             CCCTTTSSSCSSSTTCEEEECSSSEEEECCTTEESTTSC---------------------EECCTTTT--CCCCSSCEEE
T ss_pred             ccccccCCCCCCCCCCEeECCCCCEEEECCCCCcCCccc---------------------ccCccCCC--CCCCCCCEEe
Confidence            556666433334  3678888899999999999997655                     58899985  7898 56999


Q ss_pred             eCCCcceeecCCCceeCCCCCCcc-cCCCccceeeeecCCcccccccCCCCCccccccccCCCCcccCCCCCCccC-CCC
Q psy11797        107 NLEGSYRCECERGFKLSLDGKQCL-GKGQFVEFRIILSMPKAENSVNNNNNQRLGFCYRSLTNGRCVLPTGPALLM-EVT  184 (249)
Q Consensus       107 ~~~g~~~C~C~~G~~~~~~g~~C~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~~~~~~~C~c~~g~~~~~-~~~  184 (249)
                      ++.++|+|.|++||.    +..|+ ++++                |...+|.+.++|.+..++|+|.|++||++.. ...
T Consensus        61 ~~~g~~~C~C~~G~~----G~~C~~~~~~----------------C~~~~C~~~g~C~~~~g~~~C~C~~G~~G~~C~~~  120 (135)
T 2vj3_A           61 DQIGEFQCICMPGYE----GVHCEVNTDE----------------CASSPCLHNGRCLDKINEFQCECPTGFTGHLCQVD  120 (135)
T ss_dssp             ECSSCEEEECCTTEE----SSSSCEECCT----------------TTTCCSTTTCEEEECSSCEEEECCTTEESSSSCEE
T ss_pred             CCCCCceeeCCCCCc----CCcceecCCc----------------ccCCCcCCCCEeECCCCCeEEECCCCCcCCccCcc
Confidence            999999999999999    88886 4443                3445678889999999999999999998775 245


Q ss_pred             cceee
Q psy11797        185 RMDCC  189 (249)
Q Consensus       185 ~~~C~  189 (249)
                      +++|.
T Consensus       121 i~~C~  125 (135)
T 2vj3_A          121 LHHIL  125 (135)
T ss_dssp             CC---
T ss_pred             Ccccc
Confidence            55654



>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Back     alignment and structure
>1apj_A Fibrillin; microfibril, TB module, marfan syndrome, connective tissue, novel fold, extracellular matrix; NMR {Homo sapiens} SCOP: g.23.1.1 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>1ksq_A Latent transforming growth factor beta binding protein 1; structure, LTBP-1, TGF-beta, TB domain, latency associated propeptide, LAP; NMR {Homo sapiens} SCOP: g.23.1.1 Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 Back     alignment and structure
>1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A Back     alignment and structure
>2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3cfw_A L-selectin; EGF, cell adhesion, EGF-like domain, glycoprotein, membrane, sushi, transmembrane; HET: NAG MAN BMA; 2.20A {Homo sapiens} Back     alignment and structure
>2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A Back     alignment and structure
>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 Back     alignment and structure
>1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A Back     alignment and structure
>2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A Back     alignment and structure
>2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Back     alignment and structure
>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A Back     alignment and structure
>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A Back     alignment and structure
>2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 249
d1apja_74 g.23.1.1 (A:) Fibrillin {Human (Homo sapiens) [Tax 6e-14
d1uzka376 g.23.1.1 (A:1529-1604) Fibrillin {Human (Homo sapi 5e-12
d1ksqa_75 g.23.1.1 (A:) Transforming growth factor-beta bind 1e-10
d1lmja242 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapien 2e-10
d1lmja242 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapien 8e-05
d1uzka243 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sa 3e-10
d1uzka243 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sa 8e-05
d1lmja144 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens 1e-08
d1lmja144 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens 5e-05
d1uzka143 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sa 1e-07
d1uzka143 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sa 2e-05
d1apqa_53 g.3.11.1 (A:) Complement protease C1R {Human (Homo 1e-07
d1apqa_53 g.3.11.1 (A:) Complement protease C1R {Human (Homo 9e-05
d1emoa143 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sa 2e-07
d1emoa143 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sa 7e-06
d1szba245 g.3.11.1 (A:124-168) Mannose-binding protein assoc 7e-06
d1szba245 g.3.11.1 (A:124-168) Mannose-binding protein assoc 0.002
d1i0ua241 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) r 1e-05
d1i0ua241 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) r 5e-04
d1nt0a345 g.3.11.1 (A:120-164) Mannose-binding protein assoc 2e-05
d1nt0a345 g.3.11.1 (A:120-164) Mannose-binding protein assoc 0.004
d1nzia242 g.3.11.1 (A:118-159) Complement C1S component {Hum 3e-05
d1dx5i340 g.3.11.1 (I:423-462) Thrombomodulin, different EGF 3e-05
d1dx5i340 g.3.11.1 (I:423-462) Thrombomodulin, different EGF 1e-04
d2vj3a142 g.3.11.1 (A:411-452) Neurogenic locus notch homolo 6e-05
d2vj3a142 g.3.11.1 (A:411-452) Neurogenic locus notch homolo 7e-05
d3bpse140 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) 1e-04
d3bpse140 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) 3e-04
d2p3ua151 g.3.11.1 (A:87-137) Factor X, N-terminal module {H 6e-04
d1autl250 g.3.11.1 (L:97-146) Activated protein c (autoproth 7e-04
d1kigl_51 g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bo 0.001
d1edmb_39 g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens 0.004
>d1apja_ g.23.1.1 (A:) Fibrillin {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure

class: Small proteins
fold: TB module/8-cys domain
superfamily: TB module/8-cys domain
family: TB module/8-cys domain
domain: Fibrillin
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 63.0 bits (153), Expect = 6e-14
 Identities = 22/72 (30%), Positives = 34/72 (47%), Gaps = 6/72 (8%)

Query: 157 QRLGFCYRSLTNGRCVLPTGPALLMEVTRMDCCCTM-GMAWGPQCQLCPTRGSQEYTDLC 215
            R+ +CY     G+C  P         ++ +CCC + G  WG  C+LCPT   + +  +C
Sbjct: 5   LRMSYCYAKFEGGKCSSP----KSRNHSKQECCCALKGEGWGDPCELCPTEPDEAFRQIC 60

Query: 216 LE-SGLTVDGRD 226
              SG+ V   D
Sbjct: 61  PYGSGIIVGPDD 72


>d1uzka3 g.23.1.1 (A:1529-1604) Fibrillin {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1ksqa_ g.23.1.1 (A:) Transforming growth factor-beta binding protein-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 45 Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 45 Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 50 Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Length = 51 Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query249
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 99.02
d1uzka243 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.99
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.93
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.91
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.9
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.88
d1i0ua241 Low density lipoprotein (LDL) receptor, different 98.86
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.8
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.77
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 98.76
d1uzka243 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.76
d1i0ua241 Low density lipoprotein (LDL) receptor, different 98.74
d1apqa_53 Complement protease C1R {Human (Homo sapiens) [Tax 98.74
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 98.73
d1szba245 Mannose-binding protein associated serine protease 98.73
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.73
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 98.72
d1nt0a345 Mannose-binding protein associated serine protease 98.71
d1apqa_53 Complement protease C1R {Human (Homo sapiens) [Tax 98.71
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 98.68
d1szba245 Mannose-binding protein associated serine protease 98.64
d1nt0a345 Mannose-binding protein associated serine protease 98.63
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 98.62
d1dx5i340 Thrombomodulin, different EGF-like domains {Human 98.62
d1nzia242 Complement C1S component {Human (Homo sapiens) [Ta 98.58
d1dx5i340 Thrombomodulin, different EGF-like domains {Human 98.54
d1apja_74 Fibrillin {Human (Homo sapiens) [TaxId: 9606]} 98.51
d3bpse140 Low density lipoprotein (LDL) receptor, different 98.48
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 98.42
d1kigl_51 Factor X, N-terminal module {Cow (Bos taurus) [Tax 98.4
d1autl250 Activated protein c (autoprothrombin IIa) {Human ( 98.4
d2p3ua151 Factor X, N-terminal module {Human (Homo sapiens) 98.4
d3bpse140 Low density lipoprotein (LDL) receptor, different 98.39
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 98.37
d1nzia242 Complement C1S component {Human (Homo sapiens) [Ta 98.32
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 98.3
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 98.27
d1ksqa_75 Transforming growth factor-beta binding protein-1 98.23
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 98.23
d1uzka376 Fibrillin {Human (Homo sapiens) [TaxId: 9606]} 98.17
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 98.08
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 98.04
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 98.04
d1rfnb_57 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 98.02
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 97.99
d1kigl_51 Factor X, N-terminal module {Cow (Bos taurus) [Tax 97.98
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 97.93
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 97.93
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 97.91
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 97.91
d1autl250 Activated protein c (autoprothrombin IIa) {Human ( 97.89
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 97.88
d1ijqa250 Low density lipoprotein (LDL) receptor, different 97.85
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 97.84
d2p3ua151 Factor X, N-terminal module {Human (Homo sapiens) 97.83
d2bz6l153 Coagulation factor VIIa {Human (Homo sapiens) [Tax 97.76
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 97.72
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 97.61
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 97.6
d1emoa239 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.5
d1ijqa250 Low density lipoprotein (LDL) receptor, different 97.42
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 97.4
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 97.37
d1rfnb_57 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 97.21
d1emoa239 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.17
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 96.9
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 96.86
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 96.84
d2bz6l153 Coagulation factor VIIa {Human (Homo sapiens) [Tax 96.64
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 96.6
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 96.37
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 95.11
d1k36a_46 Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI 94.99
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 94.54
d1k36a_46 Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI 92.38
d1ioxa_50 Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] 90.97
d1ioxa_50 Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] 90.27
d1moxc_49 Transforming growth factor alpha {Human (Homo sapi 89.03
d1moxc_49 Transforming growth factor alpha {Human (Homo sapi 87.77
d1dx5i143 Thrombomodulin, different EGF-like domains {Human 86.94
d2i9aa140 Plasminogen activator (urokinase-type) {Human (Hom 86.51
d1xdtr_41 Heparin-binding epidermal growth factor, HBEGF {Hu 84.83
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: Knottins (small inhibitors, toxins, lectins)
superfamily: EGF/Laminin
family: EGF-type module
domain: Fibrillin-1
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.02  E-value=5.8e-11  Score=68.36  Aligned_cols=42  Identities=45%  Similarity=0.953  Sum_probs=37.6

Q ss_pred             cCcccccCCCCCCCCeeeeCCCcceeecCCCceeCCCCCCcc
Q psy11797         89 DVNECELNLDSCANGRCVNLEGSYRCECERGFKLSLDGKQCL  130 (249)
Q Consensus        89 ~i~~C~~~~~~C~~g~C~~~~g~~~C~C~~G~~~~~~g~~C~  130 (249)
                      |||||+..+..|.++.|+|++|+|+|.|++||.+..+++.|.
T Consensus         1 DidEC~~~~~~C~~~~C~Nt~Gsy~C~C~~Gy~l~~d~~~Cv   42 (42)
T d1lmja2           1 DIDECQRDPLLCRGGVCHNTEGSYRCECPPGHQLSPNISACI   42 (42)
T ss_dssp             ECCHHHHCSSTTTTSEEEEETTEEEEESCTTSCCCSSSCCCC
T ss_pred             CccccCCCCCCCCCCEeECCCCCeEEeCCCCCeECcCCCccC
Confidence            689999878889888999999999999999999888887763



>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1apja_ g.23.1.1 (A:) Fibrillin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ksqa_ g.23.1.1 (A:) Transforming growth factor-beta binding protein-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka3 g.23.1.1 (A:1529-1604) Fibrillin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i1 g.3.11.1 (I:345-387) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure