Psyllid ID: psy11799

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480---
MFLLKARKLETFDRELLIELLFLINMLAGIFVWSLASQWTGEILTNVSPYPTSVNMASVSTRKGLTGVSVTRDTSYTMAILNVEQDKQGILIFSMLQTRYFNLFYVIIFYVISLKKKKFYSVFLDMDECKEEINGVAVCPKPGTCINTMGSFRCLCPRGFKLDRTGTFCLDQDECTDDSKCREGCQTCEDINECLELSNQCAFRCHNVPGSFRCICPYGYALAPDGRHCIDINECEQFPGLCAHTCTNTEGSYTCGCHPGFELSSDGSGTCLDSDECATGRHICQQICNLLGGYKCGCPEGYVRHPFSNECIDDNECARNPCEPSSNTTGERGGKCFNTAGSYRCGCPDGFQFEAALQLCTQLSSSCLSSPCSFGCTPLGISGFSCECPSGYQRIGQGHCLATISSGLYPGFRSYERPNLGDIDECKEEINGVAVCPKPGTCINTMGSFRCLCPRGFKLDRTGTFCLDQDECTDDSKCREGCQ
cccccccccccccHHHHHHHHHcccccccEEEEccccccccEEccccccccccccccccccccccccEEEEccccccEEEccccccccccccccccEEEccccEEEEEcccEEEcccccccccccccccccccccccccccccEEEEccccEEEEcccccEEcccccccccccccccccccccccccccccccccccccccccEEEEccccEEEEcccccEEcccccccccccccccccccccccEEEccccEEEEcccccEEccccccccccccccccccccccccEEccccEEEEcccccEEccccccccccccccccccccccccccccccEEEEcccccEEEcccccEEccccccccccccccccccccccEEEcccccEEEEcccccEEcccccEEcccccccccccccccccccccccccccccccccccccccEEEEccccEEEEcccccEEcccccccccccccccccccccccc
ccHHHccccccccHHHHHHHccccccccccccccccccccccccccccccccccccEEEEcccccEEEEcccccccccccccccccccccccccccccccEEccccccEEEEccccccccccccccHHcccccccccccccccEEEcccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccEEEEccccccccccccccEccccccccccccccEEEcccccEEEEcccccEcccccccccccccccccccccccccEcccccEEEEcccccccccccccccccHHccccccccccccccccccEEEcccccEEEEccccccccccccccccccccccccccccccEEcccccEEEEcccccccccccccccccccccccccccccccccccEcccccccccccccccccEEEcccccEEEEccccccccccccccccccccccccccccccc
MFLLKARKLETFDRELLIELLFLINMLAGIFVWSLAsqwtgeiltnvspyptsvnmasvstrkgltgvsvtrdtSYTMAILNVEQDKQGILIFSMLQTRYFNLFYVIIFYVISLKKKKFYSVFLDMDeckeeingvavcpkpgtcintmgsfrclcprgfkldrtgtfcldqdectddskcregcqtcEDINEClelsnqcafrchnvpgsfrcicpygyalapdgrhcidineceqfpglcahtctntegsytcgchpgfelssdgsgtcldsdecatgRHICQQICNLlggykcgcpegyvrhpfsneciddnecarnpcepssnttgerggkcfntagsyrcgcpdgfQFEAALQLCTQlsssclsspcsfgctplgisgfscecpsgyqrigqghclatissglypgfrsyerpnlgdideckeeingvavcpkpgtcintmgsfrclcprgfkldrtgtfcldqdectddskcregcq
mfllkarkletFDRELLIELLFLINMLAGIFVWSLASQWTGEILTNVSPYPTSVNMAsvstrkgltgvsvtrDTSYTMAILNVEQDKQGILIFSMLQTRYFNLFYVIIFYVISLKKKKFYSVFLDMDECKEEINGVAVCPKPGTCINTMGSFRCLCPRGFKLDRTGTFCLDQDECTDDSKCREGCQTCEDINECLELSNQCAFRCHNVPGSFRCICPYGYALAPDGRHCIDINECEQFPGLCAHTCTNTEGSYTCGCHPGFELSSDGSGTCLDSDECATGRHICQQICNLLGGYKCGCPEGYVRHPFSNECIDDNECARNPCEpssnttgerggKCFNTAGSYRCGCPDGFQFEAALQLCTQLSSSCLSSPCSFGCTPLGISGFSCECPSGYQRIGQGHCLATISSGLYPGFRSYERPNLGDIDECKEEINGVAVCPKPGTCINTMGSFRCLCPRGFKLDRTGTfcldqdectddskcregcq
MFLLKARKLETFDRelliellfliNMLAGIFVWSLASQWTGEILTNVSPYPTSVNMASVSTRKGLTGVSVTRDTSYTMAILNVEQDKQGILIFSMLQTRYFNLFYVIIFYVISLKKKKFYSVFLDMDECKEEINGVAVCPKPGTCINTMGSFRCLCPRGFKLDRTGTFCLDQDECTDDSKCREGCQTCEDINECLELSNQCAFRCHNVPGSFRCICPYGYALAPDGRHCIDINECEQFPGLCAHTCTNTEGSYTCGCHPGFELSSDGSGTCLDSDECATGRHICQQICNLLGGYKCGCPEGYVRHPFSNECIDDNECARNPCEPSSNTTGERGGKCFNTAGSYRCGCPDGFQFEAAlqlctqlsssclsspcsFGCTPLGISGFSCECPSGYQRIGQGHCLATISSGLYPGFRSYERPNLGDIDECKEEINGVAVCPKPGTCINTMGSFRCLCPRGFKLDRTGTFCLDQDECTDDSKCREGCQ
***LKARKLETFDRELLIELLFLINMLAGIFVWSLASQWTGEILTNVSPYPTSVNMASVSTRKGLTGVSVTRDTSYTMAILNVEQDKQGILIFSMLQTRYFNLFYVIIFYVISLKKKKFYSVFLDMDECKEEINGVAVCPKPGTCINTMGSFRCLCPRGFKLDRTGTFCLDQDECTDDSKCREGCQTCEDINECLELSNQCAFRCHNVPGSFRCICPYGYALAPDGRHCIDINECEQFPGLCAHTCTNTEGSYTCGCHPGFELSSDGSGTCLDSDECATGRHICQQICNLLGGYKCGCPEGYVRHPFSNECIDDNEC****************GKCFNTAGSYRCGCPDGFQFEAALQLCTQLSSSCLSSPCSFGCTPLGISGFSCECPSGYQRIGQGHCLATISSGLYPGFRSYERPNLGDIDECKEEINGVAVCPKPGTCINTMGSFRCLCPRGFKLDRTGTFCLDQD*************
*************************MLAGIFVWSLASQWTGEILTNVSPYPTSVNMASVSTRKGLTGVSVTRDTSYTMAILNVEQDKQGILIFSMLQTRYFNLFYVIIFYVISLKKKKFYSVFLDMDECKEEINGVAVCPKPGTCINTMGSFRCLCPRGFKLDRTGTFCLDQDECTDDSKCREGCQTCEDINECLELSNQCAFRCHNVPGSFRCICPYGYALAPDGRHCIDINECEQFPGLCAHTCTNTEGSYTCGCHPGFELSSDGSGTCLDSDECATGRHICQQICNLLGGYKCGCPEGYVRHPFSNECIDDNECARNPCEPSSNTTGERGGKCFNTAGSYRCGCPDGFQFEAALQLCTQLSSSCLSSPCSFGCTPLGISGFSCECPSGYQRIGQGHCLATISSGLYPGFRSYERPNLGDIDECKEEINGVAVCPKPGTCINTMGSFRCLCPRGFKLDRTGTFCLDQDECTDDSK******
MFLLKARKLETFDRELLIELLFLINMLAGIFVWSLASQWTGEILTNVSPYPTSVNMASVSTRKGLTGVSVTRDTSYTMAILNVEQDKQGILIFSMLQTRYFNLFYVIIFYVISLKKKKFYSVFLDMDECKEEINGVAVCPKPGTCINTMGSFRCLCPRGFKLDRTGTFCLDQDECTDDSKCREGCQTCEDINECLELSNQCAFRCHNVPGSFRCICPYGYALAPDGRHCIDINECEQFPGLCAHTCTNTEGSYTCGCHPGFELSSDGSGTCLDSDECATGRHICQQICNLLGGYKCGCPEGYVRHPFSNECIDDNECARNPCE********RGGKCFNTAGSYRCGCPDGFQFEAALQLCTQLSSSCLSSPCSFGCTPLGISGFSCECPSGYQRIGQGHCLATISSGLYPGFRSYERPNLGDIDECKEEINGVAVCPKPGTCINTMGSFRCLCPRGFKLDRTGTFCLDQDE************
MFLLKARKLETFDRELLIELLFLINMLAGIFVWSLASQWTGEILTNVSPYPTSVNMASVSTRKGLTGVSVTRDTSYTMAILNVEQDKQGILIFSMLQTRYFNLFYVIIFYVISLKKKKFYSVFLDMDECKEEINGVAVCPKPGTCINTMGSFRCLCPRGFKLDRTGTFCLDQDECTDDSKCREGCQTCEDINECLELSNQCAFRCHNVPGSFRCICPYGYALAPDGRHCIDINECEQFPGLCAHTCTNTEGSYTCGCHPGFELSSDGSGTCLDSDECATGRHICQQICNLLGGYKCGCPEGYVRHPFSNECIDDNECARNPCEPSSNTTGERGGKCFNTAGSYRCGCPDGFQFEAALQLCTQLSSSCLSSPCSFGCTPLGISGFSCECPSGYQRIGQGHCLATISSGLYPGFRSYERPNLGDIDECKEEINGVAVCPKPGTCINTMGSFRCLCPRGFKLDRTGTFCLDQDECTDDSKC*****
ooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFLLKARKLETFDRELLIELLFLINMLAGIFVWSLASQWTGEILTNVSPYPTSVNMASVSTRKGLTGVSVTRDTSYTMAILNVEQDKQGILIFSMLQTRYFNLFYVIIFYVISLKKKKFYSVFLDMDECKEEINGVAVCPKPGTCINTMGSFRCLCPRGFKLDRTGTFCLDQDECTDDSKCREGCQTCEDINECLELSNQCAFRCHNVPGSFRCICPYGYALAPDGRHCIDINECEQFPGLCAHTCTNTEGSYTCGCHPGFELSSDGSGTCLDSDECATGRHICQQICNLLGGYKCGCPEGYVRHPFSNECIDDNECARNPCEPSSNTTGERGGKCFNTAGSYRCGCPDGFQFEAALQLCTQLSSSCLSSPCSFGCTPLGISGFSCECPSGYQRIGQGHCLATISSGLYPGFRSYERPNLGDIDECKEEINGVAVCPKPGTCINTMGSFRCLCPRGFKLDRTGTFCLDQDECTDDSKCREGCQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query483 2.2.26 [Sep-21-2011]
P355562912 Fibrillin-2 OS=Homo sapie yes N/A 0.544 0.090 0.408 1e-47
Q615552907 Fibrillin-2 OS=Mus muscul yes N/A 0.544 0.090 0.408 4e-47
Q9TV36 2871 Fibrillin-1 OS=Sus scrofa no N/A 0.619 0.104 0.384 2e-46
P98133 2871 Fibrillin-1 OS=Bos taurus no N/A 0.619 0.104 0.375 5e-46
P35555 2871 Fibrillin-1 OS=Homo sapie no N/A 0.619 0.104 0.375 2e-45
Q61554 2871 Fibrillin-1 OS=Mus muscul no N/A 0.619 0.104 0.372 6e-45
Q75N902809 Fibrillin-3 OS=Homo sapie no N/A 0.575 0.098 0.370 1e-41
Q8NDA2 5065 Hemicentin-2 OS=Homo sapi no N/A 0.579 0.055 0.344 2e-41
A2AJ76 5100 Hemicentin-2 OS=Mus muscu no N/A 0.583 0.055 0.341 5e-41
Q8CG19 1712 Latent-transforming growt no N/A 0.869 0.245 0.301 9e-40
>sp|P35556|FBN2_HUMAN Fibrillin-2 OS=Homo sapiens GN=FBN2 PE=1 SV=3 Back     alignment and function desciption
 Score =  191 bits (485), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 125/306 (40%), Positives = 163/306 (53%), Gaps = 43/306 (14%)

Query: 125  DMDECKEEINGVAVCPKPGTCINTMGSFRCLCPRGFKLDRTGTFCLDQDECTDDSK---- 180
            D+DECK   N   +C   G CINTMGSFRC C  G+  D +GT C+D DEC+   K    
Sbjct: 2449 DIDECKVMPN---LCTN-GQCINTMGSFRCFCKVGYTTDISGTSCIDLDECSQSPKPCNY 2504

Query: 181  ------------------CREGCQTCEDINECLELSNQCAFRCHNVPGSFRCICPYGYAL 222
                               +E  +TC+D++EC    + C F C N  G F C CP G+  
Sbjct: 2505 ICKNTEGSYQCSCPRGYVLQEDGKTCKDLDECQTKQHNCQFLCVNTLGGFTCKCPPGFTQ 2564

Query: 223  APDGRHCIDINECEQFPGLCAHT--CTNTEGSYTCGCHPGFELSSDGSGTCLDSDECATG 280
                  CID NEC   P LC     C NT GS++C C  GF L + G   C D DEC  G
Sbjct: 2565 HHTA--CIDNNECGSQPSLCGAKGICQNTPGSFSCECQRGFSLDATGL-NCEDVDEC-DG 2620

Query: 281  RHICQQIC-NLLGGYKCGCPEGYVRHPFSNECIDDNECARNPCEPSSNTTGERGGKCFNT 339
             H CQ  C N+LGGY+CGCP+GY++H   N+C+D+NEC        SN        C+NT
Sbjct: 2621 NHRCQHGCQNILGGYRCGCPQGYIQHYQWNQCVDENEC--------SNPNACGSASCYNT 2672

Query: 340  AGSYRCGCPDGFQFEAALQLCTQLSS-SCLSSPCSFGCTPLGISGFSCECPSGYQRIGQG 398
             GSY+C CP GF F+     C  ++  S   +PC++GC+     G+ C CP GY R+GQG
Sbjct: 2673 LGSYKCACPSGFSFDQFSSACHDVNECSSSKNPCNYGCSNT-EGGYLCGCPPGYYRVGQG 2731

Query: 399  HCLATI 404
            HC++ +
Sbjct: 2732 HCVSGM 2737
Fibrillins are structural components of 10-12 nm extracellular calcium-binding microfibrils, which occur either in association with elastin or in elastin-free bundles. Fibrillin-2-containing microfibrils regulate the early process of elastic fiber assembly. Regulates osteoblast maturation by controlling TGF-beta bioavailability and calibrating TGF-beta and BMP levels, respectively.
Homo sapiens (taxid: 9606)
>sp|Q61555|FBN2_MOUSE Fibrillin-2 OS=Mus musculus GN=Fbn2 PE=1 SV=2 Back     alignment and function description
>sp|Q9TV36|FBN1_PIG Fibrillin-1 OS=Sus scrofa GN=FBN1 PE=2 SV=1 Back     alignment and function description
>sp|P98133|FBN1_BOVIN Fibrillin-1 OS=Bos taurus GN=FBN1 PE=1 SV=1 Back     alignment and function description
>sp|P35555|FBN1_HUMAN Fibrillin-1 OS=Homo sapiens GN=FBN1 PE=1 SV=3 Back     alignment and function description
>sp|Q61554|FBN1_MOUSE Fibrillin-1 OS=Mus musculus GN=Fbn1 PE=1 SV=1 Back     alignment and function description
>sp|Q75N90|FBN3_HUMAN Fibrillin-3 OS=Homo sapiens GN=FBN3 PE=2 SV=3 Back     alignment and function description
>sp|Q8NDA2|HMCN2_HUMAN Hemicentin-2 OS=Homo sapiens GN=HMCN2 PE=2 SV=2 Back     alignment and function description
>sp|A2AJ76|HMCN2_MOUSE Hemicentin-2 OS=Mus musculus GN=Hmcn2 PE=1 SV=1 Back     alignment and function description
>sp|Q8CG19|LTBP1_MOUSE Latent-transforming growth factor beta-binding protein 1 OS=Mus musculus GN=Ltbp1 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query483
270001930 2865 hypothetical protein TcasGA2_TC000836 [T 0.525 0.088 0.487 6e-63
189234367 2933 PREDICTED: similar to fibrillin 2 [Tribo 0.525 0.086 0.487 8e-63
321472519 2762 hypothetical protein DAPPUDRAFT_315775 [ 0.631 0.110 0.413 5e-60
380016550 2868 PREDICTED: fibrillin-2-like [Apis florea 0.556 0.093 0.452 2e-59
332018680 2757 Fibrillin-2 [Acromyrmex echinatior] 0.643 0.112 0.411 3e-59
328787226 2870 PREDICTED: fibrillin-2-like [Apis mellif 0.556 0.093 0.449 4e-59
350416792 2865 PREDICTED: fibrillin-2-like [Bombus impa 0.525 0.088 0.416 4e-59
340721645 2865 PREDICTED: fibrillin-2-like [Bombus terr 0.525 0.088 0.413 9e-59
307196014 2862 Fibrillin-2 [Harpegnathos saltator] 0.643 0.108 0.411 1e-58
383864528 2865 PREDICTED: fibrillin-2-like [Megachile r 0.525 0.088 0.407 2e-57
>gi|270001930|gb|EEZ98377.1| hypothetical protein TcasGA2_TC000836 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  248 bits (633), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 141/289 (48%), Positives = 176/289 (60%), Gaps = 35/289 (12%)

Query: 141  KPGTCINTMGSFRCLCPRGFKLDRTGTFCLDQDECTDD-SKCREGCQ------------- 186
            + G CINTMGS+RC+C +GFK D +G FC+D +EC    S C+  C+             
Sbjct: 2412 RNGQCINTMGSYRCICNKGFKADASGLFCVDVNECEHSPSPCQHICRNTEGSFVCSCPPG 2471

Query: 187  --------TCEDINECLELSNQCAFRCHNVPGSFRCICPYGYALAPDGRHCIDINECEQF 238
                    TC D++EC    + C   C N  GS+ C CP GY     G  C DINEC++ 
Sbjct: 2472 YLLNADGLTCRDLDECATGQHVCQHTCINTQGSYSCSCPKGYNQI--GDDCEDINECKED 2529

Query: 239  PGLCAHT--CTNTEGSYTCGCHPGFELSSDGSGTCLDSDECATGRHICQQICNLLGGYKC 296
             G+C     C NT GS+ C C   F+L   GS  C+DSDEC       +   NL+GGY+C
Sbjct: 2530 TGICPKPGRCVNTLGSFKCICPRRFKLDKSGS-YCIDSDECLDDSKCPEGCQNLIGGYRC 2588

Query: 297  GCPEGYVRHPFSNECIDDNECARNPCEPSSNTTGERGGKCFNTAGSYRCGCPDGFQFEAA 356
            GCPEGYV H + N+C+DDNECA NPC  S        G CFNT GSYRCGCPDG+QF+A 
Sbjct: 2589 GCPEGYVLHYYYNQCVDDNECASNPCGAS--------GSCFNTPGSYRCGCPDGYQFDAK 2640

Query: 357  LQLCTQLSSSCLSSPCSFGCTPLGISGFSCECPSGYQRIGQGHCLATIS 405
            L +C Q+S+ C  +PC+FGCT +G +GFSC CP GYQRIGQGHCL+TIS
Sbjct: 2641 LSICIQVSAGCSGAPCAFGCTSVGSAGFSCGCPQGYQRIGQGHCLSTIS 2689

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|189234367|ref|XP_974344.2| PREDICTED: similar to fibrillin 2 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|321472519|gb|EFX83489.1| hypothetical protein DAPPUDRAFT_315775 [Daphnia pulex] Back     alignment and taxonomy information
>gi|380016550|ref|XP_003692245.1| PREDICTED: fibrillin-2-like [Apis florea] Back     alignment and taxonomy information
>gi|332018680|gb|EGI59252.1| Fibrillin-2 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|328787226|ref|XP_003250904.1| PREDICTED: fibrillin-2-like [Apis mellifera] Back     alignment and taxonomy information
>gi|350416792|ref|XP_003491105.1| PREDICTED: fibrillin-2-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340721645|ref|XP_003399227.1| PREDICTED: fibrillin-2-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|307196014|gb|EFN77739.1| Fibrillin-2 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|383864528|ref|XP_003707730.1| PREDICTED: fibrillin-2-like [Megachile rotundata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query483
UNIPROTKB|F1M5Q4859 Fbn2 "Protein Fbn2" [Rattus no 0.606 0.341 0.392 3.3e-56
UNIPROTKB|E1C5P62869 FBN3 "Uncharacterized protein" 0.612 0.103 0.404 5.2e-56
UNIPROTKB|P355562912 FBN2 "Fibrillin-2" [Homo sapie 0.602 0.099 0.396 6.8e-56
UNIPROTKB|F1RKK12432 FBN2 "Uncharacterized protein" 0.602 0.119 0.396 8.5e-56
UNIPROTKB|I3LJJ02433 FBN2 "Uncharacterized protein" 0.602 0.119 0.396 8.5e-56
UNIPROTKB|E1C3A62914 FBN2 "Uncharacterized protein" 0.602 0.099 0.4 1.1e-55
UNIPROTKB|F1MTZ43672 Bt.110891 "Uncharacterized pro 0.602 0.079 0.396 1.2e-55
UNIPROTKB|E2RS462921 FBN2 "Uncharacterized protein" 0.602 0.099 0.393 4.8e-55
MGI|MGI:954902907 Fbn2 "fibrillin 2" [Mus muscul 0.602 0.100 0.383 7e-54
UNIPROTKB|F1PP112825 FBN3 "Uncharacterized protein" 0.610 0.104 0.385 1e-52
UNIPROTKB|F1M5Q4 Fbn2 "Protein Fbn2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
 Score = 582 (209.9 bits), Expect = 3.3e-56, P = 3.3e-56
 Identities = 134/341 (39%), Positives = 175/341 (51%)

Query:   125 DMDECKEEINGVAVCPKPGTCINTMGSFRCLCPRGFKLDRTGTFCLDQDECTDDSK---- 180
             D+DECK      ++C   G C+NTMGSFRC C  G+  D +GT C+D DEC+   K    
Sbjct:   394 DIDECKVM---PSLCTN-GQCVNTMGSFRCFCKVGYTTDISGTACVDLDECSQSPKPCNF 449

Query:   181 -CR--EG-----C----------QTCEDINECLELSNQCAFRCHNVPGSFRCICPYGYAL 222
              C+  EG     C          +TC+D++EC    + C F C N  G F C CP G+  
Sbjct:   450 ICKNTEGSYQCSCPRGYVLQEDGKTCKDLDECQTKQHNCQFLCVNTLGGFTCKCPPGFTQ 509

Query:   223 APDGRHCIDINECEQFPGLCAHT--CTNTEGSYTCGCHPGFELSSDGSGTCLDSDECATG 280
                   CID NEC   P LC     C NT GS++C C  GF L + G   C D DEC  G
Sbjct:   510 HHTA--CIDNNECGSQPSLCGAKGICQNTPGSFSCECQRGFSLDASGLN-CEDVDEC-DG 565

Query:   281 RHICQQIC-NLLGGYKCGCPEGYVRHPFSNECIDDNECARNPCEPSSNTTGERGGKCFNT 339
              H CQ  C N+LGGY+CGCP+GYV+H   N+C+D+NEC+ NP        G     C+NT
Sbjct:   566 NHRCQHGCQNILGGYRCGCPQGYVQHYQWNQCVDENECS-NP-----GACGS--ASCYNT 617

Query:   340 AGSYRCGCPDGFQFEA-AXXXXXXXXXXXXXXXXXFGCTPLGISGFSCECPSGYQRIGQG 398
              GSY+C CP GF F+  +                 +GC+     G+ C CP GY R+GQG
Sbjct:   618 LGSYKCACPSGFSFDQFSSACHDVNECSSSKNPCSYGCSNTE-GGYLCGCPPGYFRVGQG 676

Query:   399 HCLATI--SSGLYPGFRSY--ERPNLGDIDECKE-EINGVA 434
             HC++ +  + G Y    S   +  N    + C E +ING A
Sbjct:   677 HCVSGMGFNKGQYLSVDSEAEDDENALSPEACYECKINGYA 717
GO:0005201 "extracellular matrix structural constituent" evidence=IEA
GO:0005509 "calcium ion binding" evidence=IEA
GO:0005578 "proteinaceous extracellular matrix" evidence=IEA
GO:0030326 "embryonic limb morphogenesis" evidence=IEA
GO:0030501 "positive regulation of bone mineralization" evidence=IEA
GO:0035583 "sequestering of TGFbeta in extracellular matrix" evidence=IEA
GO:0045669 "positive regulation of osteoblast differentiation" evidence=IEA
GO:0060346 "bone trabecula formation" evidence=IEA
UNIPROTKB|E1C5P6 FBN3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P35556 FBN2 "Fibrillin-2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RKK1 FBN2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|I3LJJ0 FBN2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1C3A6 FBN2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MTZ4 Bt.110891 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RS46 FBN2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:95490 Fbn2 "fibrillin 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1PP11 FBN3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query483
pfam1266224 pfam12662, cEGF, Complement Clr-like EGF-like 4e-06
pfam0764542 pfam07645, EGF_CA, Calcium-binding EGF domain 6e-06
smart0017939 smart00179, EGF_CA, Calcium-binding EGF-like domai 6e-06
cd0005438 cd00054, EGF_CA, Calcium-binding EGF-like domain, 9e-06
pfam0764542 pfam07645, EGF_CA, Calcium-binding EGF domain 2e-05
smart0017939 smart00179, EGF_CA, Calcium-binding EGF-like domai 3e-05
cd0005438 cd00054, EGF_CA, Calcium-binding EGF-like domain, 4e-05
smart0017939 smart00179, EGF_CA, Calcium-binding EGF-like domai 6e-05
smart0017939 smart00179, EGF_CA, Calcium-binding EGF-like domai 9e-05
cd01475224 cd01475, vWA_Matrilin, VWA_Matrilin: In cartilagin 1e-04
cd0005438 cd00054, EGF_CA, Calcium-binding EGF-like domain, 2e-04
cd01475224 cd01475, vWA_Matrilin, VWA_Matrilin: In cartilagin 2e-04
pfam0764542 pfam07645, EGF_CA, Calcium-binding EGF domain 5e-04
pfam0764542 pfam07645, EGF_CA, Calcium-binding EGF domain 5e-04
smart0017939 smart00179, EGF_CA, Calcium-binding EGF-like domai 0.001
pfam0764542 pfam07645, EGF_CA, Calcium-binding EGF domain 0.002
cd0005438 cd00054, EGF_CA, Calcium-binding EGF-like domain, 0.002
cd0005438 cd00054, EGF_CA, Calcium-binding EGF-like domain, 0.003
cd01475224 cd01475, vWA_Matrilin, VWA_Matrilin: In cartilagin 0.003
>gnl|CDD|221695 pfam12662, cEGF, Complement Clr-like EGF-like Back     alignment and domain information 
 Score = 42.8 bits (102), Expect = 4e-06
 Identities = 14/24 (58%), Positives = 17/24 (70%)

Query: 211 SFRCICPYGYALAPDGRHCIDINE 234
           S+ C CP GY L+ DGR C DI+E
Sbjct: 1   SYTCSCPPGYQLSGDGRTCEDIDE 24

cEGF, or complement Clr-like EGF, domains have six conserved cysteine residues disulfide-bonded into the characteristic pattern 'ababcc'. They are found in blood coagulation proteins such as fibrillin, Clr and Cls, thrombomodulin, and the LDL receptor. The core fold of the EGF domain consists of two small beta-hairpins packed against each other. Two major structural variants have been identified based on the structural context of the C-terminal cysteine residue of disulfide 'c' in the C-terminal hairpin: hEGFs and cEGFs. In cEGFs the C-terminal thiol resides on the C-terminal beta-sheet, resulting in long loop-lengths between the cysteine residues of disulfide 'c', typically C[10+]XC. These longer loop-lengths may have arisen by selective cysteine loss from a four-disulfide EGF template such as laminin or integrin. Tandem cEGF domains have five linking residues between terminal cysteines of adjacent domains. cEGF domains may or may not bind calcium in the linker region. cEGF domains with the consensus motif CXN4X[F,Y]XCXC are hydroxylated exclusively on the asparagine residue. Length = 24
>gnl|CDD|219496 pfam07645, EGF_CA, Calcium-binding EGF domain Back     alignment and domain information
>gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain Back     alignment and domain information
>gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>gnl|CDD|219496 pfam07645, EGF_CA, Calcium-binding EGF domain Back     alignment and domain information
>gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain Back     alignment and domain information
>gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain Back     alignment and domain information
>gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain Back     alignment and domain information
>gnl|CDD|238752 cd01475, vWA_Matrilin, VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity Back     alignment and domain information
>gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>gnl|CDD|238752 cd01475, vWA_Matrilin, VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity Back     alignment and domain information
>gnl|CDD|219496 pfam07645, EGF_CA, Calcium-binding EGF domain Back     alignment and domain information
>gnl|CDD|219496 pfam07645, EGF_CA, Calcium-binding EGF domain Back     alignment and domain information
>gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain Back     alignment and domain information
>gnl|CDD|219496 pfam07645, EGF_CA, Calcium-binding EGF domain Back     alignment and domain information
>gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>gnl|CDD|238752 cd01475, vWA_Matrilin, VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 483
KOG1214|consensus 1289 99.66
KOG1217|consensus487 99.55
KOG1217|consensus487 99.51
KOG1214|consensus 1289 99.44
KOG1219|consensus 4289 99.26
KOG4289|consensus 2531 99.15
KOG4289|consensus 2531 99.12
KOG0994|consensus 1758 99.05
KOG1219|consensus 4289 99.03
KOG0994|consensus 1758 98.68
KOG1225|consensus 525 98.5
KOG4260|consensus350 98.42
KOG4260|consensus350 98.37
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 98.36
KOG1225|consensus525 98.31
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 98.29
PF1266224 cEGF: Complement Clr-like EGF-like 98.07
PF1467036 FXa_inhibition: Coagulation Factor Xa inhibitory s 97.7
KOG1226|consensus 783 97.69
PF1266224 cEGF: Complement Clr-like EGF-like 97.66
PF1294736 EGF_3: EGF domain; InterPro: IPR024731 This entry 97.61
smart0017939 EGF_CA Calcium-binding EGF-like domain. 97.59
PF0000832 EGF: EGF-like domain This is a sub-family of the P 97.58
PF1294736 EGF_3: EGF domain; InterPro: IPR024731 This entry 97.5
KOG1836|consensus 1705 97.47
PF06247197 Plasmod_Pvs28: Plasmodium ookinete surface protein 97.4
PF0000832 EGF: EGF-like domain This is a sub-family of the P 97.24
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 97.07
PF06247197 Plasmod_Pvs28: Plasmodium ookinete surface protein 97.04
PF1467036 FXa_inhibition: Coagulation Factor Xa inhibitory s 97.01
smart0017939 EGF_CA Calcium-binding EGF-like domain. 96.99
KOG1226|consensus783 96.94
cd0005336 EGF Epidermal growth factor domain, found in epide 96.3
smart0018135 EGF Epidermal growth factor-like domain. 96.24
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 96.23
PF1266113 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E 95.94
KOG1836|consensus 1705 95.1
cd0005336 EGF Epidermal growth factor domain, found in epide 95.08
PF0797432 EGF_2: EGF-like domain; InterPro: IPR013111 A sequ 94.94
smart0018135 EGF Epidermal growth factor-like domain. 94.82
PF0797432 EGF_2: EGF-like domain; InterPro: IPR013111 A sequ 94.58
cd01475224 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, 93.99
smart0005163 DSL delta serrate ligand. 92.93
cd01475224 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, 91.94
PF1294637 EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 89.35
KOG1218|consensus316 86.2
smart0005163 DSL delta serrate ligand. 85.12
PF1294637 EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 82.94
>KOG1214|consensus Back     alignment and domain information 
Probab=99.66  E-value=3.5e-15  Score=152.04  Aligned_cols=190  Identities=32%  Similarity=0.758  Sum_probs=137.8

Q ss_pred             chhccCCCCCC--CeEEeCCC-CeEEeCCCCceeCCCCCcccccCcccCCCCCC--CCeeeeCCCCceEeCCCCceecCC
Q psy11799        192 NECLELSNQCA--FRCHNVPG-SFRCICPYGYALAPDGRHCIDINECEQFPGLC--AHTCTNTEGSYTCGCHPGFELSSD  266 (483)
Q Consensus       192 ~~C~~~~~~C~--~~C~~~~g-s~~C~C~~G~~~~~~g~~C~~~~~C~~~~~~~--~~~C~~~~g~~~C~C~~G~~~~~~  266 (483)
                      +.|....+.|.  +.|...++ .|+|.|..||.  .++++|.++++|+..+..+  +..|++.+++|+|+|..||.+..+
T Consensus       693 npCy~gsh~cdt~a~C~pg~~~~~tcecs~g~~--gdgr~c~d~~eca~~~~~CGp~s~Cin~pg~~rceC~~gy~F~dd  770 (1289)
T KOG1214|consen  693 NPCYDGSHMCDTTARCHPGTGVDYTCECSSGYQ--GDGRNCVDENECATGFHRCGPNSVCINLPGSYRCECRSGYEFADD  770 (1289)
T ss_pred             ccceecCcccCCCccccCCCCcceEEEEeeccC--CCCCCCCChhhhccCCCCCCCCceeecCCCceeEEEeecceeccC
Confidence            33443334443  45655544 58999999997  4489999999998655444  789999999999999999998876


Q ss_pred             CCCcccc------CccccCCCCccc--c--cc--cCCCCeeEeCCCCceeCCCCCccccCCcCCCCCCCCCCCCCCCCCC
Q psy11799        267 GSGTCLD------SDECATGRHICQ--Q--IC--NLLGGYKCGCPEGYVRHPFSNECIDDNECARNPCEPSSNTTGERGG  334 (483)
Q Consensus       267 g~~~C~~------~~~C~~~~~~c~--~--~C--~~~g~~~C~C~~G~~g~~~~~~C~~~~~C~~~~C~~~~~~~c~~~g  334 (483)
                      +. +|+.      .+.|..+.+.|.  +  .|  ...+.|.|.|.|||.|+  +..|.++|+|..+.|.+        .+
T Consensus       771 ~~-tCV~i~~pap~n~Ce~g~h~C~i~g~a~c~~hGgs~y~C~CLPGfsGD--G~~c~dvDeC~psrChp--------~A  839 (1289)
T KOG1214|consen  771 RH-TCVLITPPAPANPCEDGSHTCAIAGQARCVHHGGSTYSCACLPGFSGD--GHQCTDVDECSPSRCHP--------AA  839 (1289)
T ss_pred             Cc-ceEEecCCCCCCccccCccccCcCCceEEEecCCceEEEeecCCccCC--ccccccccccCccccCC--------Cc
Confidence            65 7763      467888777775  3  34  45568999999999998  46788999999999999        89


Q ss_pred             EEeeCCCCeeEECCCCCeeccCCCceeeCC---CccCC-----CCCCCC---cEECCCCCeeEeCCCCeeecC
Q psy11799        335 KCFNTAGSYRCGCPDGFQFEAALQLCTQLS---SSCLS-----SPCSFG---CTPLGISGFSCECPSGYQRIG  396 (483)
Q Consensus       335 ~C~~~~g~~~C~C~~G~~~~~~g~~C~~~~---~~C~~-----~~C~~~---c~~~~~~~~~C~C~~Gy~g~~  396 (483)
                      +|.+++++|.|.|.+||.|  +|..|....   ..|..     ..|...   |.+.+.+.+.+.|.++-.|..
T Consensus       840 ~CyntpgsfsC~C~pGy~G--DGf~CVP~~~~~T~C~~er~hpl~chg~t~~~~~~Dp~~~e~p~~~~ppG~~  910 (1289)
T KOG1214|consen  840 TCYNTPGSFSCRCQPGYYG--DGFQCVPDTSSLTPCEQERFHPLQCHGSTGFCWCVDPDGHEVPGTQTPPGST  910 (1289)
T ss_pred             eEecCCCcceeecccCccC--CCceecCCCccCCccccccccceeeccccceeEeeCCCcccCCCCCCCCCCC
Confidence            9999999999999999998  577775431   13331     123321   344444666777666655544

>KOG1217|consensus Back     alignment and domain information
>KOG1217|consensus Back     alignment and domain information
>KOG1214|consensus Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>KOG0994|consensus Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>KOG0994|consensus Back     alignment and domain information
>KOG1225|consensus Back     alignment and domain information
>KOG4260|consensus Back     alignment and domain information
>KOG4260|consensus Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>KOG1225|consensus Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>PF12662 cEGF: Complement Clr-like EGF-like Back     alignment and domain information
>PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A Back     alignment and domain information
>KOG1226|consensus Back     alignment and domain information
>PF12662 cEGF: Complement Clr-like EGF-like Back     alignment and domain information
>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins Back     alignment and domain information
>KOG1836|consensus Back     alignment and domain information
>PF06247 Plasmod_Pvs28: Plasmodium ookinete surface protein Pvs28; InterPro: IPR010423 This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>PF06247 Plasmod_Pvs28: Plasmodium ookinete surface protein Pvs28; InterPro: IPR010423 This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium Back     alignment and domain information
>PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>KOG1226|consensus Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A Back     alignment and domain information
>KOG1836|consensus Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity Back     alignment and domain information
>smart00051 DSL delta serrate ligand Back     alignment and domain information
>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity Back     alignment and domain information
>PF12946 EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 This EGF-like domain is found at the C terminus of the malaria parasite MSP1 protein Back     alignment and domain information
>KOG1218|consensus Back     alignment and domain information
>smart00051 DSL delta serrate ligand Back     alignment and domain information
>PF12946 EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 This EGF-like domain is found at the C terminus of the malaria parasite MSP1 protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query483
3v65_B386 Crystal Structure Of Agrin And Lrp4 Complex Length 1e-10
3v65_B 386 Crystal Structure Of Agrin And Lrp4 Complex Length 2e-05
2w2n_E107 Wt Pcsk9-Deltac Bound To Egf-A H306y Mutant Of Ldlr 2e-09
2w2n_E107 Wt Pcsk9-Deltac Bound To Egf-A H306y Mutant Of Ldlr 6e-06
3gcw_E83 Pcsk9:egfa(H306y) Length = 83 3e-09
3gcw_E83 Pcsk9:egfa(H306y) Length = 83 1e-05
3p5c_L 440 The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE 4e-09
3p5c_L 440 The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE 3e-07
3p5b_L 400 The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE 4e-09
3p5b_L 400 The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE 4e-07
2w2m_E107 Wt Pcsk9-Deltac Bound To Wt Egf-A Of Ldlr Length = 8e-09
2w2m_E107 Wt Pcsk9-Deltac Bound To Wt Egf-A Of Ldlr Length = 1e-06
3bps_E83 Pcsk9:egf-a Complex Length = 83 1e-08
3bps_E83 Pcsk9:egf-a Complex Length = 83 3e-06
1hz8_A82 Solution Structure And Backbone Dynamics Of A Conca 1e-08
1hz8_A82 Solution Structure And Backbone Dynamics Of A Conca 2e-06
1hj7_A80 Nmr Study Of A Pair Of Ldl Receptor Ca2+ Binding Ep 1e-08
1hj7_A80 Nmr Study Of A Pair Of Ldl Receptor Ca2+ Binding Ep 3e-06
2w86_A147 Crystal Structure Of Fibrillin-1 Domains Cbegf9hyb2 2e-08
2w86_A147 Crystal Structure Of Fibrillin-1 Domains Cbegf9hyb2 2e-05
1z6c_A87 Solution Structure Of An Egf Pair (Egf34) From Vita 6e-08
1lmj_A86 Nmr Study Of The Fibrillin-1 Cbegf12-13 Pair Of Ca2 7e-08
1lmj_A86 Nmr Study Of The Fibrillin-1 Cbegf12-13 Pair Of Ca2 4e-06
1lmj_A86 Nmr Study Of The Fibrillin-1 Cbegf12-13 Pair Of Ca2 9e-06
2bo2_A143 Egf Domains 1,2,5 Of Human Emr2, A 7-Tm Immune Syst 1e-07
1uzk_A162 Integrin Binding Cbegf22-tb4-cbegf33 Fragment Of Hu 1e-07
1uzk_A162 Integrin Binding Cbegf22-tb4-cbegf33 Fragment Of Hu 1e-05
1uzk_A162 Integrin Binding Cbegf22-tb4-cbegf33 Fragment Of Hu 1e-04
3m0c_C 791 The X-Ray Crystal Structure Of Pcsk9 In Complex Wit 1e-07
1n7d_A 699 Extracellular Domain Of The Ldl Receptor Length = 6 1e-07
1uzj_A162 Integrin Binding Cbegf22-Tb4-Cbegf33 Fragment Of Hu 1e-07
1uzj_A162 Integrin Binding Cbegf22-Tb4-Cbegf33 Fragment Of Hu 6e-06
1uzj_A162 Integrin Binding Cbegf22-Tb4-Cbegf33 Fragment Of Hu 1e-04
1emn_A82 Nmr Study Of A Pair Of Fibrillin Ca2+ Binding Epide 2e-07
1emn_A82 Nmr Study Of A Pair Of Fibrillin Ca2+ Binding Epide 6e-07
1emn_A82 Nmr Study Of A Pair Of Fibrillin Ca2+ Binding Epide 9e-05
2vj3_A135 Human Notch-1 Egfs 11-13 Length = 135 1e-06
1toz_A116 Nmr Structure Of The Human Notch-1 Ligand Binding R 2e-06
>pdb|3V65|B Chain B, Crystal Structure Of Agrin And Lrp4 Complex Length = 386 Back     alignment and structure 
Iteration: 1

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 41/66 (62%), Gaps = 1/66 (1%)
Query: 201 CAFRCHNVPGSFRCICPYGYALAPDGRHCIDINECEQFPGLCAHTCTNTEGSYTCGCHPG 260
           CA +C  + G+ +C C  GY L  DGR C D+NEC +  G C+  CTN+EG++ C C  G
Sbjct: 13  CAQKCQMIRGAVQCTCHTGYRLTEDGRTCQDVNECAE-EGYCSQGCTNSEGAFQCWCEAG 71
Query: 261 FELSSD 266
           +EL  D
Sbjct: 72  YELRPD 77
>pdb|3V65|B Chain B, Crystal Structure Of Agrin And Lrp4 Complex Length = 386 Back     alignment and structure
>pdb|2W2N|E Chain E, Wt Pcsk9-Deltac Bound To Egf-A H306y Mutant Of Ldlr Length = 107 Back     alignment and structure
>pdb|2W2N|E Chain E, Wt Pcsk9-Deltac Bound To Egf-A H306y Mutant Of Ldlr Length = 107 Back     alignment and structure
>pdb|3GCW|E Chain E, Pcsk9:egfa(H306y) Length = 83 Back     alignment and structure
>pdb|3GCW|E Chain E, Pcsk9:egfa(H306y) Length = 83 Back     alignment and structure
>pdb|3P5C|L Chain L, The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE RECEPTOR IN AN Extended Conformation Length = 440 Back     alignment and structure
>pdb|3P5C|L Chain L, The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE RECEPTOR IN AN Extended Conformation Length = 440 Back     alignment and structure
>pdb|3P5B|L Chain L, The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE RECEPTOR IN AN Extended Conformation Length = 400 Back     alignment and structure
>pdb|3P5B|L Chain L, The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE RECEPTOR IN AN Extended Conformation Length = 400 Back     alignment and structure
>pdb|2W2M|E Chain E, Wt Pcsk9-Deltac Bound To Wt Egf-A Of Ldlr Length = 107 Back     alignment and structure
>pdb|2W2M|E Chain E, Wt Pcsk9-Deltac Bound To Wt Egf-A Of Ldlr Length = 107 Back     alignment and structure
>pdb|3BPS|E Chain E, Pcsk9:egf-a Complex Length = 83 Back     alignment and structure
>pdb|3BPS|E Chain E, Pcsk9:egf-a Complex Length = 83 Back     alignment and structure
>pdb|1HZ8|A Chain A, Solution Structure And Backbone Dynamics Of A Concatemer Of Egf-Homology Modules Of The Human Low Density Lipoprotein Receptor Length = 82 Back     alignment and structure
>pdb|1HZ8|A Chain A, Solution Structure And Backbone Dynamics Of A Concatemer Of Egf-Homology Modules Of The Human Low Density Lipoprotein Receptor Length = 82 Back     alignment and structure
>pdb|1HJ7|A Chain A, Nmr Study Of A Pair Of Ldl Receptor Ca2+ Binding Epidermal Growth Factor-Like Domains, 20 Structures Length = 80 Back     alignment and structure
>pdb|1HJ7|A Chain A, Nmr Study Of A Pair Of Ldl Receptor Ca2+ Binding Epidermal Growth Factor-Like Domains, 20 Structures Length = 80 Back     alignment and structure
>pdb|2W86|A Chain A, Crystal Structure Of Fibrillin-1 Domains Cbegf9hyb2cbegf10, Calcium Saturated Form Length = 147 Back     alignment and structure
>pdb|2W86|A Chain A, Crystal Structure Of Fibrillin-1 Domains Cbegf9hyb2cbegf10, Calcium Saturated Form Length = 147 Back     alignment and structure
>pdb|1Z6C|A Chain A, Solution Structure Of An Egf Pair (Egf34) From Vitamin K- Dependent Protein S Length = 87 Back     alignment and structure
>pdb|1LMJ|A Chain A, Nmr Study Of The Fibrillin-1 Cbegf12-13 Pair Of Ca2+ Binding Epidermal Growth Factor-like Domains Length = 86 Back     alignment and structure
>pdb|1LMJ|A Chain A, Nmr Study Of The Fibrillin-1 Cbegf12-13 Pair Of Ca2+ Binding Epidermal Growth Factor-like Domains Length = 86 Back     alignment and structure
>pdb|1LMJ|A Chain A, Nmr Study Of The Fibrillin-1 Cbegf12-13 Pair Of Ca2+ Binding Epidermal Growth Factor-like Domains Length = 86 Back     alignment and structure
>pdb|2BO2|A Chain A, Egf Domains 1,2,5 Of Human Emr2, A 7-Tm Immune System Molecule, In Complex With Calcium. Length = 143 Back     alignment and structure
>pdb|1UZK|A Chain A, Integrin Binding Cbegf22-tb4-cbegf33 Fragment Of Human Fibrillin-1, Ca Bound To Cbegf23 Domain Only Length = 162 Back     alignment and structure
>pdb|1UZK|A Chain A, Integrin Binding Cbegf22-tb4-cbegf33 Fragment Of Human Fibrillin-1, Ca Bound To Cbegf23 Domain Only Length = 162 Back     alignment and structure
>pdb|1UZK|A Chain A, Integrin Binding Cbegf22-tb4-cbegf33 Fragment Of Human Fibrillin-1, Ca Bound To Cbegf23 Domain Only Length = 162 Back     alignment and structure
>pdb|3M0C|C Chain C, The X-Ray Crystal Structure Of Pcsk9 In Complex With The Ldl Receptor Length = 791 Back     alignment and structure
>pdb|1N7D|A Chain A, Extracellular Domain Of The Ldl Receptor Length = 699 Back     alignment and structure
>pdb|1UZJ|A Chain A, Integrin Binding Cbegf22-Tb4-Cbegf33 Fragment Of Human Fibrillin-1, Holo Form. Length = 162 Back     alignment and structure
>pdb|1UZJ|A Chain A, Integrin Binding Cbegf22-Tb4-Cbegf33 Fragment Of Human Fibrillin-1, Holo Form. Length = 162 Back     alignment and structure
>pdb|1UZJ|A Chain A, Integrin Binding Cbegf22-Tb4-Cbegf33 Fragment Of Human Fibrillin-1, Holo Form. Length = 162 Back     alignment and structure
>pdb|1EMN|A Chain A, Nmr Study Of A Pair Of Fibrillin Ca2+ Binding Epidermal Growth Factor-Like Domains, Minimized Average Structure Length = 82 Back     alignment and structure
>pdb|1EMN|A Chain A, Nmr Study Of A Pair Of Fibrillin Ca2+ Binding Epidermal Growth Factor-Like Domains, Minimized Average Structure Length = 82 Back     alignment and structure
>pdb|1EMN|A Chain A, Nmr Study Of A Pair Of Fibrillin Ca2+ Binding Epidermal Growth Factor-Like Domains, Minimized Average Structure Length = 82 Back     alignment and structure
>pdb|2VJ3|A Chain A, Human Notch-1 Egfs 11-13 Length = 135 Back     alignment and structure
>pdb|1TOZ|A Chain A, Nmr Structure Of The Human Notch-1 Ligand Binding Region Length = 116 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query483
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 4e-41
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 3e-37
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 2e-28
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 7e-16
1uzk_A 162 Fibrillin-1; glycoprotein, extra-cellular matrix, 3e-07
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 1e-31
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 4e-28
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 1e-20
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 4e-10
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 8e-30
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 4e-29
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 8e-13
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 5e-07
2bou_A143 EGF-like module containing mucin-like hormone rece 2e-28
2bou_A143 EGF-like module containing mucin-like hormone rece 2e-26
2bou_A143 EGF-like module containing mucin-like hormone rece 2e-21
2bou_A143 EGF-like module containing mucin-like hormone rece 6e-18
2bou_A143 EGF-like module containing mucin-like hormone rece 9e-09
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 1e-25
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 7e-21
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 7e-21
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 3e-15
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 7e-10
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 5e-06
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 1e-05
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 3e-25
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 6e-21
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 2e-15
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 3e-15
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 6e-09
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 9e-07
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 3e-24
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 5e-23
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 1e-22
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 8e-14
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 8e-09
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 3e-24
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 1e-21
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 7e-20
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 8e-09
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 2e-07
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 2e-05
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 1e-23
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 1e-11
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 2e-19
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 3e-16
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 4e-12
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 6e-04
3v65_B386 Low-density lipoprotein receptor-related protein; 4e-19
3v65_B 386 Low-density lipoprotein receptor-related protein; 2e-15
3v65_B386 Low-density lipoprotein receptor-related protein; 3e-10
3v65_B 386 Low-density lipoprotein receptor-related protein; 5e-07
3v65_B 386 Low-density lipoprotein receptor-related protein; 2e-05
3v65_B386 Low-density lipoprotein receptor-related protein; 2e-04
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 7e-18
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 2e-17
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 2e-12
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 6e-09
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 4e-04
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 9e-18
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 9e-16
3p5b_L400 Low density lipoprotein receptor variant; B-propel 2e-11
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 1e-09
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 3e-05
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 3e-04
1aut_L114 Activated protein C; serine proteinase, plasma cal 6e-16
1aut_L114 Activated protein C; serine proteinase, plasma cal 7e-13
1aut_L114 Activated protein C; serine proteinase, plasma cal 2e-12
1aut_L114 Activated protein C; serine proteinase, plasma cal 7e-08
1aut_L114 Activated protein C; serine proteinase, plasma cal 8e-07
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 5e-15
2vh0_B134 Activated factor XA light chain; serine protease, 4e-13
2vh0_B134 Activated factor XA light chain; serine protease, 5e-08
2vh0_B134 Activated factor XA light chain; serine protease, 1e-07
2vh0_B134 Activated factor XA light chain; serine protease, 2e-05
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 4e-12
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 1e-08
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 2e-08
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 3e-07
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 1e-11
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 5e-10
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 4e-08
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 2e-11
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 4e-11
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 3e-08
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 3e-08
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 4e-07
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 4e-10
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 2e-09
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 1e-05
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 4e-05
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 4e-04
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 5e-10
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 8e-07
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 6e-04
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 2e-09
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 1e-06
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 2e-08
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 4e-06
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 3e-05
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 4e-08
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 2e-06
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 6e-05
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 7e-04
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 5e-08
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 5e-05
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 5e-08
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 2e-07
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 8e-06
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 4e-06
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 8e-06
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 6e-04
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 4e-06
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 9e-06
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 2e-05
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 1e-05
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 3e-05
1nzi_A159 Complement C1S component; calcium, innate immunity 2e-05
1nzi_A159 Complement C1S component; calcium, innate immunity 5e-04
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 6e-05
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 1e-04
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 3e-04
2f83_A 625 Coagulation factor XI; protease, apple domain, hyd 9e-05
1gl4_A285 Nidogen-1, entactin; immunoglobulin-like domain, e 2e-04
1gl4_A285 Nidogen-1, entactin; immunoglobulin-like domain, e 3e-04
2wph_E59 Coagulation factor IXA light chain; serine proteas 2e-04
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 4e-04
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 4e-04
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 8e-04
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 8e-04
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
 Score =  144 bits (364), Expect = 4e-41
 Identities = 43/172 (25%), Positives = 62/172 (36%), Gaps = 13/172 (7%)

Query: 190 DINECLELSNQCAFRCHNVPGSFRCICPYGYALAPDGRHCIDINECEQFPGLCAHTCTNT 249
           D+NECL+ +   +  C N PGS+ C CP  + L P    C+D                  
Sbjct: 2   DVNECLDPTTCISGNCVNTPGSYICDCPPDFELNPTRVGCVDTRSG---NCYLDIRPRGD 58

Query: 250 EGSYTCGCHPGFELSSDGSGTCLDSDECATGRHICQQIC-NLLGGYKCGCPEGYVRHPFS 308
            G   C    G  +S      C    +                    C   EG+  +P +
Sbjct: 59  NGDTACSNEIGVGVSKA--SCCCSLGKAWGTPCEMCPAVNTSEYKILCPGGEGFRPNPIT 116

Query: 309 NECIDDNECARNPCEPSSNTTGERGGKCFNTAGSYRCGCPDGFQFEAALQLC 360
               D +EC   P          +GGKC NT GS++C CP G+      ++C
Sbjct: 117 VILEDIDECQELPG-------LCQGGKCINTFGSFQCRCPTGYYLNEDTRVC 161
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Length = 186 Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Length = 186 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Length = 53 Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Length = 53 Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Length = 53 Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Length = 53 Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Length = 53 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Length = 55 Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Length = 55 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Length = 69 Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Length = 69 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Length = 51 Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Length = 51 Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Length = 349 Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Length = 349 Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Length = 349 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Length = 318 Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Length = 318 Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} Length = 619 Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} Length = 619 Back     alignment and structure
>1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Length = 159 Back     alignment and structure
>1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Length = 159 Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Length = 91 Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Length = 91 Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Length = 91 Back     alignment and structure
>2f83_A Coagulation factor XI; protease, apple domain, hydrolase; HET: NAG; 2.87A {Homo sapiens} PDB: 2j8j_A 2j8l_A Length = 625 Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Length = 285 Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Length = 285 Back     alignment and structure
>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Length = 59 Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Length = 53 Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Length = 628 Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Length = 628 Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query483
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 99.77
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 99.75
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 99.75
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 99.75
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 99.74
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 99.68
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 99.67
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 99.66
2bou_A143 EGF-like module containing mucin-like hormone rece 99.65
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 99.62
2bou_A143 EGF-like module containing mucin-like hormone rece 99.6
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 99.6
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 99.58
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 99.54
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 99.53
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 99.53
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 99.5
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 99.49
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 99.45
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 99.45
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 99.4
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 99.39
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 99.31
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 99.28
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 99.25
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 99.24
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 99.23
1aut_L114 Activated protein C; serine proteinase, plasma cal 99.21
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 99.2
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 99.2
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 99.18
2vh0_B134 Activated factor XA light chain; serine protease, 99.16
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 99.16
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 99.16
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 99.16
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 99.14
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 99.12
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 99.06
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 99.05
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 99.05
1aut_L114 Activated protein C; serine proteinase, plasma cal 98.96
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 98.91
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 98.9
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 98.9
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 98.87
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 98.86
2vh0_B134 Activated factor XA light chain; serine protease, 98.85
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 98.81
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 98.81
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 98.75
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 98.75
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 98.68
3v65_B386 Low-density lipoprotein receptor-related protein; 98.64
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 98.61
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 98.61
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 98.59
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 98.59
3v65_B386 Low-density lipoprotein receptor-related protein; 98.55
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 98.49
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 98.46
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 98.26
2k2s_B61 Micronemal protein 6; microneme protein complex, c 98.18
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 98.12
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 98.11
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 98.05
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 98.04
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 98.03
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 98.0
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 97.97
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 97.85
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 97.82
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 97.79
2k2s_B61 Micronemal protein 6; microneme protein complex, c 97.78
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 97.77
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 97.75
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 97.74
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 97.73
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 97.7
2kl7_A71 Fibulin-4; secreted, calcium, disease mutation, di 97.65
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 97.63
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 97.61
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 97.58
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 97.58
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 97.49
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 97.48
1a3p_A45 Epidermal growth factor; disulfide connectivities, 97.47
2wph_E59 Coagulation factor IXA light chain; serine proteas 97.38
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 97.37
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 97.34
2kl7_A71 Fibulin-4; secreted, calcium, disease mutation, di 97.28
1a3p_A45 Epidermal growth factor; disulfide connectivities, 97.25
1gl4_A 285 Nidogen-1, entactin; immunoglobulin-like domain, e 97.23
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 97.23
1nql_B53 Epidermal growth factor; cell surface receptor, ty 97.19
1gl4_A285 Nidogen-1, entactin; immunoglobulin-like domain, e 97.1
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 97.04
2wph_E59 Coagulation factor IXA light chain; serine proteas 97.01
1nql_B53 Epidermal growth factor; cell surface receptor, ty 96.7
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 96.68
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 96.58
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 96.58
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 96.55
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 96.38
1n1i_A105 Merozoite surface protein-1; MSP1, malaria, surfac 96.14
1ob1_C99 Major merozoite surface protein; immune system, im 96.03
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 96.02
1szb_A170 Mannose binding lectin-associated serine protease- 95.74
2fd6_A122 Urokinase-type plasminogen activator; UPAR, ATF, A 95.69
1szb_A170 Mannose binding lectin-associated serine protease- 95.66
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 95.59
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 95.57
1ob1_C99 Major merozoite surface protein; immune system, im 95.01
3cfw_A164 L-selectin; EGF, cell adhesion, EGF-like domain, g 94.94
1n1i_A105 Merozoite surface protein-1; MSP1, malaria, surfac 94.23
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 93.81
3f1s_B283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 93.79
1nzi_A159 Complement C1S component; calcium, innate immunity 93.59
2fd6_A122 Urokinase-type plasminogen activator; UPAR, ATF, A 93.34
3e50_C50 Protransforming growth factor alpha; IDE, TGF-alph 93.12
1q4g_A 553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 92.97
1iox_A50 Betacellulin; EGF-like fold, hormone/growth factor 92.9
1nzi_A159 Complement C1S component; calcium, innate immunity 92.43
1q4g_A 553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 91.97
3nt1_A 587 Prostaglandin-endoperoxide synthase 2; prostagland 91.57
2i9a_A145 Urokinase-type plasminogen activator; growth facto 91.3
3cfw_A164 L-selectin; EGF, cell adhesion, EGF-like domain, g 91.05
3nt1_A 587 Prostaglandin-endoperoxide synthase 2; prostagland 90.79
2rnl_A50 Amphiregulin; AR, colorectum cell-derived growth f 90.5
2rnl_A50 Amphiregulin; AR, colorectum cell-derived growth f 89.71
3e50_C50 Protransforming growth factor alpha; IDE, TGF-alph 89.61
2ygo_A188 WIF-1, WNT inhibitory factor 1; signaling protein, 89.58
3f1s_B283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 89.15
1iox_A50 Betacellulin; EGF-like fold, hormone/growth factor 89.04
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 87.72
2i9a_A145 Urokinase-type plasminogen activator; growth facto 87.55
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 87.4
1xdt_R79 Hbegf, heparin-binding epidermal growth factor; co 87.35
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 86.78
1g1t_A157 E-selectin; EGF, adhesion molecule, SLEX, immune s 86.73
2ygo_A188 WIF-1, WNT inhibitory factor 1; signaling protein, 86.6
4aqt_A375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 85.29
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 84.56
3asi_A 410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 84.48
1g1t_A157 E-selectin; EGF, adhesion molecule, SLEX, immune s 83.95
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 82.76
4aqt_A375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 82.65
2y38_A403 Laminin subunit alpha-5; structural protein, cell 80.82
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
Probab=99.77  E-value=1.2e-18  Score=148.17  Aligned_cols=124  Identities=36%  Similarity=0.863  Sum_probs=97.6

Q ss_pred             cccCCcCC--CCCCCCCCCCCCCCCCEEeeCCCCeeEECCCCCeeccCCCceeeCCCccCCCCCCCC--cEECCCCCeeE
Q psy11799        311 CIDDNECA--RNPCEPSSNTTGERGGKCFNTAGSYRCGCPDGFQFEAALQLCTQLSSSCLSSPCSFG--CTPLGISGFSC  386 (483)
Q Consensus       311 C~~~~~C~--~~~C~~~~~~~c~~~g~C~~~~g~~~C~C~~G~~~~~~g~~C~~~~~~C~~~~C~~~--c~~~~~~~~~C  386 (483)
                      |+++++|+  .++|.+        +|+|++..++|+|.|++||    .|..|+...++|...+|.++  |+... ++|+|
T Consensus         2 c~dideC~~~~~~C~~--------~g~C~~~~g~~~C~C~~Gy----~G~~C~~~~~~C~~~~C~~~~~C~~~~-g~~~C   68 (135)
T 2vj3_A            2 AQDVDECSLGANPCEH--------AGKCINTLGSFECQCLQGY----TGPRCEIDVNECVSNPCQNDATCLDQI-GEFQC   68 (135)
T ss_dssp             -CCCCTTTSSSCSSST--------TCEEEECSSSEEEECCTTE----ESTTSCEECCTTTTCCCCSSCEEEECS-SCEEE
T ss_pred             CcccccccCCCCCCCC--------CCEeECCCCCEEEECCCCC----cCCcccccCccCCCCCCCCCCEEeCCC-CCcee
Confidence            56789998  478988        8999999999999999999    45678644448999999876  66666 88999


Q ss_pred             eCCCCeeecCCcceecccCCCCCCCcccCCCCCcc-cccccccCCCCccCCCCCCeEeeCCCCeeeeCCCCcccCCCCCC
Q psy11799        387 ECPSGYQRIGQGHCLATISSGLYPGFRSYERPNLG-DIDECKEEINGVAVCPKPGTCINTMGSFRCLCPRGFKLDRTGTF  465 (483)
Q Consensus       387 ~C~~Gy~g~~~g~C~~~~~~~C~~g~~g~~~~~C~-~~~~C~~~~~~~~~C~~~g~C~~~~g~~~C~C~~G~~~~~~g~~  465 (483)
                      .|++||+|..                       |+ ++++|...     +|.++++|++..++|+|+|++||    .|..
T Consensus        69 ~C~~G~~G~~-----------------------C~~~~~~C~~~-----~C~~~g~C~~~~g~~~C~C~~G~----~G~~  116 (135)
T 2vj3_A           69 ICMPGYEGVH-----------------------CEVNTDECASS-----PCLHNGRCLDKINEFQCECPTGF----TGHL  116 (135)
T ss_dssp             ECCTTEESSS-----------------------SCEECCTTTTC-----CSTTTCEEEECSSCEEEECCTTE----ESSS
T ss_pred             eCCCCCcCCc-----------------------ceecCCcccCC-----CcCCCCEeECCCCCeEEECCCCC----cCCc
Confidence            9999999865                       54 67888754     89999999999999999999999    7889


Q ss_pred             CC-CCcCCCCC-CCcc
Q psy11799        466 CL-DQDECTDD-SKCR  479 (483)
Q Consensus       466 C~-~~~~C~~~-~~C~  479 (483)
                      |+ ++++|... +.|.
T Consensus       117 C~~~i~~C~~~~~~c~  132 (135)
T 2vj3_A          117 CQVDLHHILDAQKMVW  132 (135)
T ss_dssp             SCEECC----------
T ss_pred             cCccCccccCCCccee
Confidence            96 78999854 4443
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 Back     alignment and structure
>1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Back     alignment and structure
>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A Back     alignment and structure
>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A Back     alignment and structure
>1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Back     alignment and structure
>1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A Back     alignment and structure
>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Back     alignment and structure
>1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A Back     alignment and structure
>1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... Back     alignment and structure
>2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... Back     alignment and structure
>2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A Back     alignment and structure
>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Back     alignment and structure
>1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A Back     alignment and structure
>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Back     alignment and structure
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Back     alignment and structure
>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Back     alignment and structure
>2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 483
d1kigl_51 g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bo 7e-10
d1kigl_51 g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bo 1e-07
d1kigl_51 g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bo 3e-04
d1kigl_51 g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bo 8e-04
d1kigl_51 g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bo 8e-04
d1uzka143 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sa 1e-09
d1uzka143 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sa 2e-09
d1uzka143 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sa 5e-06
d1uzka143 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sa 8e-06
d1uzka143 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sa 2e-05
d1lmja242 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapien 5e-09
d1lmja242 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapien 2e-08
d1lmja242 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapien 2e-06
d1lmja242 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapien 8e-06
d1lmja242 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapien 2e-04
d1lmja242 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapien 0.001
d1uzka243 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sa 6e-09
d1uzka243 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sa 2e-08
d1uzka243 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sa 4e-06
d1uzka243 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sa 1e-05
d1uzka243 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sa 5e-04
d1uzka243 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sa 0.002
d1emoa143 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sa 1e-08
d1emoa143 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sa 2e-08
d1emoa143 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sa 2e-05
d1emoa143 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sa 1e-04
d1emoa143 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sa 2e-04
d1emoa143 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sa 3e-04
d1dx5i340 g.3.11.1 (I:423-462) Thrombomodulin, different EGF 1e-08
d1dx5i340 g.3.11.1 (I:423-462) Thrombomodulin, different EGF 2e-05
d1dx5i340 g.3.11.1 (I:423-462) Thrombomodulin, different EGF 3e-04
d1dx5i340 g.3.11.1 (I:423-462) Thrombomodulin, different EGF 0.001
d2p3ua151 g.3.11.1 (A:87-137) Factor X, N-terminal module {H 2e-08
d2p3ua151 g.3.11.1 (A:87-137) Factor X, N-terminal module {H 6e-07
d2p3ua151 g.3.11.1 (A:87-137) Factor X, N-terminal module {H 0.001
d1i0ua241 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) r 2e-08
d1i0ua241 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) r 3e-08
d1i0ua241 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) r 4e-04
d1i0ua241 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) r 6e-04
d1i0ua241 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) r 0.002
d1apqa_53 g.3.11.1 (A:) Complement protease C1R {Human (Homo 4e-08
d1apqa_53 g.3.11.1 (A:) Complement protease C1R {Human (Homo 3e-07
d1apqa_53 g.3.11.1 (A:) Complement protease C1R {Human (Homo 2e-06
d1apqa_53 g.3.11.1 (A:) Complement protease C1R {Human (Homo 8e-06
d1apqa_53 g.3.11.1 (A:) Complement protease C1R {Human (Homo 4e-05
d1apqa_53 g.3.11.1 (A:) Complement protease C1R {Human (Homo 0.004
d1szba245 g.3.11.1 (A:124-168) Mannose-binding protein assoc 4e-08
d1szba245 g.3.11.1 (A:124-168) Mannose-binding protein assoc 2e-07
d1szba245 g.3.11.1 (A:124-168) Mannose-binding protein assoc 5e-06
d1szba245 g.3.11.1 (A:124-168) Mannose-binding protein assoc 2e-05
d1szba245 g.3.11.1 (A:124-168) Mannose-binding protein assoc 5e-04
d1lmja144 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens 5e-08
d1lmja144 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens 8e-06
d1lmja144 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens 6e-05
d1lmja144 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens 3e-04
d1lmja144 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens 0.003
d1lmja144 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens 0.003
d1autl250 g.3.11.1 (L:97-146) Activated protein c (autoproth 8e-08
d1autl250 g.3.11.1 (L:97-146) Activated protein c (autoproth 9e-07
d1autl250 g.3.11.1 (L:97-146) Activated protein c (autoproth 9e-04
d1nt0a345 g.3.11.1 (A:120-164) Mannose-binding protein assoc 4e-07
d1nt0a345 g.3.11.1 (A:120-164) Mannose-binding protein assoc 1e-06
d1nt0a345 g.3.11.1 (A:120-164) Mannose-binding protein assoc 1e-05
d1nt0a345 g.3.11.1 (A:120-164) Mannose-binding protein assoc 5e-05
d1nt0a345 g.3.11.1 (A:120-164) Mannose-binding protein assoc 0.001
d3bpse140 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) 4e-07
d3bpse140 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) 2e-05
d3bpse140 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) 2e-04
d1nzia242 g.3.11.1 (A:118-159) Complement C1S component {Hum 7e-07
d1nzia242 g.3.11.1 (A:118-159) Complement C1S component {Hum 1e-06
d1nzia242 g.3.11.1 (A:118-159) Complement C1S component {Hum 7e-04
d1nzia242 g.3.11.1 (A:118-159) Complement C1S component {Hum 7e-04
d1nzia242 g.3.11.1 (A:118-159) Complement C1S component {Hum 0.002
d1rfnb_57 g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens 1e-06
d1rfnb_57 g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens 7e-05
d2bz6l153 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human 2e-05
d2bz6l153 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human 4e-04
d2vj3a142 g.3.11.1 (A:411-452) Neurogenic locus notch homolo 5e-05
d2vj3a142 g.3.11.1 (A:411-452) Neurogenic locus notch homolo 8e-05
d2vj3a142 g.3.11.1 (A:411-452) Neurogenic locus notch homolo 1e-04
d2vj3a142 g.3.11.1 (A:411-452) Neurogenic locus notch homolo 3e-04
d1edmb_39 g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens 6e-04
d1edmb_39 g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens 0.001
d1ijqa250 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) 0.001
d1ijqa250 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) 0.002
d2c4fl137 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrof 0.002
d2c4fl137 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrof 0.004
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Length = 51 Back     information, alignment and structure

class: Small proteins
fold: Knottins (small inhibitors, toxins, lectins)
superfamily: EGF/Laminin
family: EGF-type module
domain: Factor X, N-terminal module
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 52.1 bits (125), Expect = 7e-10
 Identities = 11/49 (22%), Positives = 17/49 (34%), Gaps = 1/49 (2%)

Query: 235 CEQFPGLCAHTCTNTEGSYTCGCHPGFELSSDGSGTCLDSDECATGRHI 283
           C    G C   C        C C  G+ L  D   +C+ ++    G+  
Sbjct: 1   CSLDNGGCDQFCREERSEVRCSCAHGYVLGDDSK-SCVSTERFPCGKFT 48
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Length = 51 Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Length = 51 Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Length = 51 Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Length = 51 Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 50 Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 50 Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 50 Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 45 Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 45 Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 45 Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 45 Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 45 Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 50 Back     information, alignment and structure
>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 50 Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Length = 37 Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Length = 37 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query483
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 98.71
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 98.6
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.58
d1uzka243 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.58
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 98.54
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 98.54
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 98.53
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.5
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.5
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.5
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.47
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.44
d1uzka243 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.42
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 98.39
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 98.38
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 98.37
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.33
d1i0ua241 Low density lipoprotein (LDL) receptor, different 98.32
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 98.3
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 98.3
d1apqa_53 Complement protease C1R {Human (Homo sapiens) [Tax 98.3
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.28
d1nt0a345 Mannose-binding protein associated serine protease 98.27
d1nt0a345 Mannose-binding protein associated serine protease 98.23
d1szba245 Mannose-binding protein associated serine protease 98.21
d1szba245 Mannose-binding protein associated serine protease 98.2
d1apqa_53 Complement protease C1R {Human (Homo sapiens) [Tax 98.2
d1i0ua241 Low density lipoprotein (LDL) receptor, different 98.17
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 98.15
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 98.12
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 98.06
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 98.01
d1nzia242 Complement C1S component {Human (Homo sapiens) [Ta 97.94
d3bpse140 Low density lipoprotein (LDL) receptor, different 97.92
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 97.92
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 97.92
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 97.9
d1dx5i340 Thrombomodulin, different EGF-like domains {Human 97.89
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 97.89
d1dx5i340 Thrombomodulin, different EGF-like domains {Human 97.86
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 97.83
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 97.78
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 97.71
d1nzia242 Complement C1S component {Human (Homo sapiens) [Ta 97.69
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 97.65
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 97.63
d1autl250 Activated protein c (autoprothrombin IIa) {Human ( 97.62
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 97.56
d1kigl_51 Factor X, N-terminal module {Cow (Bos taurus) [Tax 97.55
d2p3ua151 Factor X, N-terminal module {Human (Homo sapiens) 97.55
d3bpse140 Low density lipoprotein (LDL) receptor, different 97.5
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 97.48
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 97.41
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 97.3
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 97.27
d1ijqa250 Low density lipoprotein (LDL) receptor, different 97.07
d1rfnb_57 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 96.98
d1autl250 Activated protein c (autoprothrombin IIa) {Human ( 96.97
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 96.97
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 96.89
d2p3ua151 Factor X, N-terminal module {Human (Homo sapiens) 96.86
d1kigl_51 Factor X, N-terminal module {Cow (Bos taurus) [Tax 96.86
d2bz6l153 Coagulation factor VIIa {Human (Homo sapiens) [Tax 96.54
d1emoa239 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 96.52
d1emoa239 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 96.47
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 96.4
d1ijqa250 Low density lipoprotein (LDL) receptor, different 96.13
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 95.74
d1ioxa_50 Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] 95.6
d1rfnb_57 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 95.45
d1k36a_46 Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI 94.82
d1moxc_49 Transforming growth factor alpha {Human (Homo sapi 94.6
d2bz6l153 Coagulation factor VIIa {Human (Homo sapiens) [Tax 93.75
d1ioxa_50 Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] 93.74
d2i9aa140 Plasminogen activator (urokinase-type) {Human (Hom 93.22
d1moxc_49 Transforming growth factor alpha {Human (Homo sapi 92.83
d1k36a_46 Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI 92.82
d2i9aa140 Plasminogen activator (urokinase-type) {Human (Hom 91.31
d1dx5i143 Thrombomodulin, different EGF-like domains {Human 91.23
d1dx5i143 Thrombomodulin, different EGF-like domains {Human 85.86
d1xdtr_41 Heparin-binding epidermal growth factor, HBEGF {Hu 84.7
d1l3ya_41 Integrin beta EGF-like domains {Human (Homo sapien 81.4
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: Knottins (small inhibitors, toxins, lectins)
superfamily: EGF/Laminin
family: EGF-type module
domain: Neurogenic locus notch homolog protein 1, Notch1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=98.71  E-value=5.6e-09  Score=66.59  Aligned_cols=40  Identities=50%  Similarity=1.088  Sum_probs=34.8

Q ss_pred             ccccccccCCCCccCCCCCCeEeeCCCCeeeeCCCCcccCCCCCCCC
Q psy11799        421 GDIDECKEEINGVAVCPKPGTCINTMGSFRCLCPRGFKLDRTGTFCL  467 (483)
Q Consensus       421 ~~~~~C~~~~~~~~~C~~~g~C~~~~g~~~C~C~~G~~~~~~g~~C~  467 (483)
                      +|||+|....+   ||+++|+|+++.++|+|+|++||    .|..|+
T Consensus         1 qDideC~~~~~---pC~n~g~C~n~~g~y~C~C~~G~----~G~~Ce   40 (42)
T d2vj3a1           1 QDVDECSLGAN---PCEHAGKCINTLGSFECQCLQGY----TGPRCE   40 (42)
T ss_dssp             CCCCTTTSSSC---SSSTTCEEEECSSSEEEECCTTE----ESTTSC
T ss_pred             CCCccccCCCC---CCCCCcEeECCCCCEEeECCCCC----cCCCCc
Confidence            37899976444   99999999999999999999999    787876
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i1 g.3.11.1 (I:345-387) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i1 g.3.11.1 (I:345-387) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure