Psyllid ID: psy11837

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190--
MSRCHQHGSQGGRLYSPRTYVILMCIATGASMALKEAGCILLEPYMYLEIISDEQYVHGILADLSRRRADIRSVEDRGSSKVIIAEAPLSELLGYCQRVRTLSSGRSHFSMEFLCFKQVSSQNEAQAVRNITGFDPVIIAEAPLSELLGYCQRVRTLSSGRSHFSMEFLCFKQVSSQNEAQAVRNITGFDPV
ccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccEEEEEEcccccccccccccccccccccccccccccEEEEEEcccccccccccccccccccccEEEEEEccHHHccHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHcccccEEEEEEccccccccHHHHHHHHHHHcccccc
ccccccccccccccccccHHHHHHHHHHHHHHHHHHcccEEEcccEEEEEEccHHHcccHHcccccccccEcccccccccEEEEEEccHHHHHccccccHccccccEEEEEEEccHHHccHHHHHHHHHHHcccccEEEEEccHHHHHHHHHHHEEccccccccEEHEEEHcEcccHHHHHHHHHccccccc
msrchqhgsqggrlysprTYVILMCIATGASMALKEAGCillepymyleiisdeqYVHGILADLSrrradirsvedrgsskviiaEAPLSELLGYCQRVrtlssgrshfsmEFLCFKQVSSQNEAQAVRnitgfdpviiaEAPLSELLGYCQRVrtlssgrshfsmEFLCFKQVSSQNEAQAVRNITGFDPV
msrchqhgsqggrlyspRTYVILMCIATGASMALKEAGCILLEPYMYLEIISDEQYVHGILADLSRRRADirsvedrgsskviiaeaplselLGYCQRVRTLSSGRSHFSMEFLCFKQVSSQNEAQAVRNITGFDPVIIAEAPLSELLGYCQRVRTLSSGRSHFSMEFLCFKQVSSQNEAQAVRNITGFDPV
MSRCHQHGSQGGRLYSPRTYVILMCIATGASMALKEAGCILLEPYMYLEIISDEQYVHGILADLSRRRADIRSVEDRGSSKVIIAEAPLSELLGYCQRVRTLSSGRSHFSMEFLCFKQVSSQNEAQAVRNITGFDPVIIAEAPLSELLGYCQRVRTLSSGRSHFSMEFLCFKQVSSQNEAQAVRNITGFDPV
*************LYSPRTYVILMCIATGASMALKEAGCILLEPYMYLEIISDEQYVHGILADLSRRRADIRSV****SSKVIIAEAPLSELLGYCQRVRTLSSGRSHFSMEFLCFKQVSSQNEAQAVRNITGFDPVIIAEAPLSELLGYCQRVRTLSSGRSHFSMEFLCFKQV******************
*************LYSPRTYVILMCIATGASMALKEAGCILLEPYMYLEIISDEQYVHGILADLSRRRA***********KVIIAEAPLSELLGYCQRVRTLSSGRSHFSMEFLCFKQVSSQNEAQAVRNITGFDPVIIAEAPLSELLGYCQRVRTLSSGRSHFSMEFLCFKQVSSQNEAQAVRNITGF***
************RLYSPRTYVILMCIATGASMALKEAGCILLEPYMYLEIISDEQYVHGILADLSRRRAD*********SKVIIAEAPLSELLGYCQRVRTLSSGRSHFSMEFLCFKQVSSQNEAQAVRNITGFDPVIIAEAPLSELLGYCQRVRTLSSGRSHFSMEFLCFKQVSSQNEAQAVRNITGFDPV
***************SPRTYVILMCIATGASMALKEAGCILLEPYMYLEIISDEQYVHGILADLSRRRADIRSVEDRGSSKVIIAEAPLSELLGYCQRVRTLSSGRSHFSMEFLCFKQVSSQNEAQAVRNITGFDPVIIAEAPLSELLGYCQRVRTLSSGRSHFSMEFLCFKQVSSQNEAQ****IT***P*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSRCHQHGSQGGRLYSPRTYVILMCIATGASMALKEAGCILLEPYMYLEIISDEQYVHGILADLSRRRADIRSVEDRGSSKVIIAEAPLSELLGYCQRVRTLSSGRSHFSMEFLCFKQVSSQNEAQAVRNITGFDPVIIAEAPLSELLGYCQRVRTLSSGRSHFSMEFLCFKQVSSQNEAQAVRNITGFDPV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query192 2.2.26 [Sep-21-2011]
P38525692 Elongation factor G OS=Th yes N/A 0.515 0.143 0.446 4e-18
Q9I244702 Elongation factor G 2 OS= yes N/A 0.510 0.139 0.421 8e-18
B9K883695 Elongation factor G OS=Th yes N/A 0.515 0.142 0.436 8e-18
A0M5A0703 Elongation factor G OS=Gr yes N/A 0.546 0.149 0.4 8e-18
B1LBP3695 Elongation factor G OS=Th yes N/A 0.515 0.142 0.436 9e-18
A5IM80695 Elongation factor G OS=Th yes N/A 0.515 0.142 0.436 9e-18
Q0VSL8699 Elongation factor G OS=Al yes N/A 0.546 0.150 0.417 1e-17
A0JMI9762 Ribosome-releasing factor yes N/A 0.572 0.144 0.363 5e-17
Q8KTB6699 Elongation factor G OS=Ri yes N/A 0.401 0.110 0.463 8e-17
B4JSI3734 Ribosome-releasing factor N/A N/A 0.531 0.138 0.427 9e-17
>sp|P38525|EFG_THEMA Elongation factor G OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=fusA PE=3 SV=2 Back     alignment and function desciption
 Score = 90.9 bits (224), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 46/103 (44%), Positives = 66/103 (64%), Gaps = 4/103 (3%)

Query: 24  MCIATGASMALKEA----GCILLEPYMYLEIISDEQYVHGILADLSRRRADIRSVEDRGS 79
           M     ASMA KEA      +LLEP M LEI + E+Y+  I++DL+ RRA + S+E RG 
Sbjct: 581 MAFKIAASMAFKEAMKKAQPVLLEPIMKLEITTPEEYMGNIISDLNSRRAKVESLETRGH 640

Query: 80  SKVIIAEAPLSELLGYCQRVRTLSSGRSHFSMEFLCFKQVSSQ 122
            KVI+A+ PLSE  GY   +R+LS GR+ + M+F  +++V  +
Sbjct: 641 LKVIVAKVPLSETFGYATVLRSLSQGRASYIMQFSHYQEVPEK 683
Catalyzes the GTP-dependent ribosomal translocation step during translation elongation. During this step, the ribosome changes from the pre-translocational (PRE) to the post-translocational (POST) state as the newly formed A-site-bound peptidyl-tRNA and P-site-bound deacylated tRNA move to the P and E sites, respectively. Catalyzes the coordinated movement of the two tRNA molecules, the mRNA and conformational changes in the ribosome.
Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) (taxid: 243274)
>sp|Q9I244|EFG2_PSEAE Elongation factor G 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=fusB PE=3 SV=1 Back     alignment and function description
>sp|B9K883|EFG_THENN Elongation factor G OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=fusA PE=3 SV=1 Back     alignment and function description
>sp|A0M5A0|EFG_GRAFK Elongation factor G OS=Gramella forsetii (strain KT0803) GN=fusA PE=3 SV=1 Back     alignment and function description
>sp|B1LBP3|EFG_THESQ Elongation factor G OS=Thermotoga sp. (strain RQ2) GN=fusA PE=3 SV=1 Back     alignment and function description
>sp|A5IM80|EFG_THEP1 Elongation factor G OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=fusA PE=3 SV=1 Back     alignment and function description
>sp|Q0VSL8|EFG_ALCBS Elongation factor G OS=Alcanivorax borkumensis (strain SK2 / ATCC 700651 / DSM 11573) GN=fusA PE=3 SV=1 Back     alignment and function description
>sp|A0JMI9|RRF2M_DANRE Ribosome-releasing factor 2, mitochondrial OS=Danio rerio GN=gfm2 PE=2 SV=2 Back     alignment and function description
>sp|Q8KTB6|EFG_RICMO Elongation factor G OS=Rickettsia montana GN=fusA PE=3 SV=1 Back     alignment and function description
>sp|B4JSI3|RRF2M_DROGR Ribosome-releasing factor 2, mitochondrial OS=Drosophila grimshawi GN=EF-G2 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query192
321478588 705 hypothetical protein DAPPUDRAFT_220624 [ 0.546 0.148 0.466 1e-21
328701929 742 PREDICTED: ribosome-releasing factor 2, 0.536 0.138 0.456 4e-21
345490758 741 PREDICTED: ribosome-releasing factor 2, 0.526 0.136 0.455 5e-20
260813667 748 hypothetical protein BRAFLDRAFT_127730 [ 0.578 0.148 0.387 3e-19
357615795 767 putative mitochondrial elongation factor 0.510 0.127 0.5 2e-18
391331887 731 PREDICTED: ribosome-releasing factor 2, 0.604 0.158 0.439 1e-17
242013426 669 elongation factor G 2, putative [Pedicul 0.526 0.150 0.465 1e-17
322792141 695 hypothetical protein SINV_02354 [Solenop 0.526 0.145 0.455 1e-17
241853608 622 translation elongation factor G, putativ 0.531 0.163 0.450 3e-17
407697615 699 translation elongation factor G [Alcaniv 0.494 0.135 0.458 3e-17
>gi|321478588|gb|EFX89545.1| hypothetical protein DAPPUDRAFT_220624 [Daphnia pulex] Back     alignment and taxonomy information
 Score =  108 bits (270), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 49/105 (46%), Positives = 73/105 (69%)

Query: 31  SMALKEAGCILLEPYMYLEIISDEQYVHGILADLSRRRADIRSVEDRGSSKVIIAEAPLS 90
           S  L++ G  L+EP+M LE+I +E ++H +L D ++ R+DI  V +R   KV+IAE+PLS
Sbjct: 600 SQLLRKGGTCLMEPFMKLEVIIEEHFLHAVLGDFAQHRSDILEVTERHELKVVIAESPLS 659

Query: 91  ELLGYCQRVRTLSSGRSHFSMEFLCFKQVSSQNEAQAVRNITGFD 135
           EL GY +R+R L+SG + FSMEF C+K +S  ++ +A   ITG D
Sbjct: 660 ELRGYSKRIRILTSGTATFSMEFSCYKLMSPLDQKKATTEITGID 704

Source: Daphnia pulex

Species: Daphnia pulex

Genus: Daphnia

Family: Daphniidae

Order: Diplostraca

Class: Branchiopoda

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328701929|ref|XP_001944132.2| PREDICTED: ribosome-releasing factor 2, mitochondrial-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|345490758|ref|XP_001601004.2| PREDICTED: ribosome-releasing factor 2, mitochondrial-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|260813667|ref|XP_002601538.1| hypothetical protein BRAFLDRAFT_127730 [Branchiostoma floridae] gi|229286836|gb|EEN57550.1| hypothetical protein BRAFLDRAFT_127730 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|357615795|gb|EHJ69835.1| putative mitochondrial elongation factor G2 [Danaus plexippus] Back     alignment and taxonomy information
>gi|391331887|ref|XP_003740372.1| PREDICTED: ribosome-releasing factor 2, mitochondrial-like [Metaseiulus occidentalis] Back     alignment and taxonomy information
>gi|242013426|ref|XP_002427408.1| elongation factor G 2, putative [Pediculus humanus corporis] gi|212511785|gb|EEB14670.1| elongation factor G 2, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|322792141|gb|EFZ16193.1| hypothetical protein SINV_02354 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|241853608|ref|XP_002415894.1| translation elongation factor G, putative [Ixodes scapularis] gi|215510108|gb|EEC19561.1| translation elongation factor G, putative [Ixodes scapularis] Back     alignment and taxonomy information
>gi|407697615|ref|YP_006822403.1| translation elongation factor G [Alcanivorax dieselolei B5] gi|407254953|gb|AFT72060.1| translation elongation factor G [Alcanivorax dieselolei B5] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query192
ZFIN|ZDB-GENE-060201-3762 gfm2 "G elongation factor, mit 0.588 0.148 0.353 4.6e-16
UNIPROTKB|E1C430782 GFM2 "Uncharacterized protein" 0.588 0.144 0.371 7.8e-16
UNIPROTKB|B4JSI3734 EF-G2 "Ribosome-releasing fact 0.593 0.155 0.391 9.1e-16
UNIPROTKB|B4M416712 EF-G2 "Ribosome-releasing fact 0.593 0.160 0.391 1.4e-15
UNIPROTKB|Q7Q3I6737 AGAP007894 "Ribosome-releasing 0.531 0.138 0.475 2.5e-15
UNIPROTKB|B3M011741 EF-G2 "Ribosome-releasing fact 0.593 0.153 0.391 3.2e-15
TIGR_CMR|ECH_0961690 ECH_0961 "translation elongati 0.5 0.139 0.375 3.6e-15
RGD|1309854779 Gfm2 "G elongation factor, mit 0.625 0.154 0.333 7.2e-15
UNIPROTKB|Q5BJP6779 Gfm2 "Ribosome-releasing facto 0.625 0.154 0.333 7.2e-15
MGI|MGI:2444783779 Gfm2 "G elongation factor, mit 0.625 0.154 0.325 9.2e-15
ZFIN|ZDB-GENE-060201-3 gfm2 "G elongation factor, mitochondrial 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 211 (79.3 bits), Expect = 4.6e-16, P = 4.6e-16
 Identities = 40/113 (35%), Positives = 74/113 (65%)

Query:    21 VILMCIATGASMALKEAGCILLEPYMYLEIISDEQYVHGILADLSRRRADIRSVEDRGSS 80
             ++  C++     ALK+AG  +LEP M LE+   E+++  +LADLS+RR  I  ++ R  +
Sbjct:   648 MVSACVSRCMLKALKQAGGQVLEPVMALEVTVGEEHLSSVLADLSQRRGTICDIQSRQDN 707

Query:    81 KVIIAEAPLSELLGYCQRVRTLSSGRSHFSMEFLCFKQVSSQNEAQAVRNITG 133
             K+++A+ PL+E++GY   +RTL+SG + FS+E   ++ ++SQ++   +  + G
Sbjct:   708 KILLADVPLAEMMGYSTVLRTLTSGNATFSLELSSYEPMNSQDQNILLNKMAG 760
GO:0005525 "GTP binding" evidence=IEA
GO:0003924 "GTPase activity" evidence=IEA;ISS
GO:0032543 "mitochondrial translation" evidence=ISS
GO:0005739 "mitochondrion" evidence=IEA;ISS
GO:0032790 "ribosome disassembly" evidence=ISS
GO:0000166 "nucleotide binding" evidence=IEA
GO:0006412 "translation" evidence=IEA
UNIPROTKB|E1C430 GFM2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|B4JSI3 EF-G2 "Ribosome-releasing factor 2, mitochondrial" [Drosophila grimshawi (taxid:7222)] Back     alignment and assigned GO terms
UNIPROTKB|B4M416 EF-G2 "Ribosome-releasing factor 2, mitochondrial" [Drosophila virilis (taxid:7244)] Back     alignment and assigned GO terms
UNIPROTKB|Q7Q3I6 AGAP007894 "Ribosome-releasing factor 2, mitochondrial" [Anopheles gambiae (taxid:7165)] Back     alignment and assigned GO terms
UNIPROTKB|B3M011 EF-G2 "Ribosome-releasing factor 2, mitochondrial" [Drosophila ananassae (taxid:7217)] Back     alignment and assigned GO terms
TIGR_CMR|ECH_0961 ECH_0961 "translation elongation factor G" [Ehrlichia chaffeensis str. Arkansas (taxid:205920)] Back     alignment and assigned GO terms
RGD|1309854 Gfm2 "G elongation factor, mitochondrial 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q5BJP6 Gfm2 "Ribosome-releasing factor 2, mitochondrial" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:2444783 Gfm2 "G elongation factor, mitochondrial 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query192
PRK12739691 PRK12739, PRK12739, elongation factor G; Reviewed 1e-26
PRK00007693 PRK00007, PRK00007, elongation factor G; Reviewed 1e-25
PRK12740668 PRK12740, PRK12740, elongation factor G; Reviewed 2e-24
cd0371378 cd03713, EFG_mtEFG_C, EFG_mtEFG_C: domains similar 3e-23
TIGR00484689 TIGR00484, EF-G, translation elongation factor EF- 9e-23
smart0083885 smart00838, EFG_C, Elongation factor G C-terminus 2e-22
PRK13351687 PRK13351, PRK13351, elongation factor G; Reviewed 6e-22
pfam0067989 pfam00679, EFG_C, Elongation factor G C-terminus 1e-21
cd0151479 cd01514, Elongation_Factor_C, Elongation factor G 6e-20
COG0480697 COG0480, FusA, Translation elongation factors (GTP 6e-20
PRK07560731 PRK07560, PRK07560, elongation factor EF-2; Review 1e-12
cd0409778 cd04097, mtEFG1_C, mtEFG1_C: C-terminus of mitocho 2e-12
TIGR00490720 TIGR00490, aEF-2, translation elongation factor aE 7e-10
PRK12740668 PRK12740, PRK12740, elongation factor G; Reviewed 2e-09
cd0371378 cd03713, EFG_mtEFG_C, EFG_mtEFG_C: domains similar 2e-09
cd0371178 cd03711, Tet_C, Tet_C: C-terminus of ribosomal pro 1e-07
cd0151479 cd01514, Elongation_Factor_C, Elongation factor G 1e-06
TIGR00484689 TIGR00484, EF-G, translation elongation factor EF- 7e-06
smart0083885 smart00838, EFG_C, Elongation factor G C-terminus 8e-06
cd0409778 cd04097, mtEFG1_C, mtEFG1_C: C-terminus of mitocho 6e-05
PRK07560731 PRK07560, PRK07560, elongation factor EF-2; Review 0.002
TIGR01393595 TIGR01393, lepA, GTP-binding protein LepA 0.003
>gnl|CDD|237185 PRK12739, PRK12739, elongation factor G; Reviewed Back     alignment and domain information 
 Score =  105 bits (265), Expect = 1e-26
 Identities = 41/97 (42%), Positives = 66/97 (68%), Gaps = 4/97 (4%)

Query: 30  ASMALKE----AGCILLEPYMYLEIISDEQYVHGILADLSRRRADIRSVEDRGSSKVIIA 85
           ASMALKE    AG ++LEP M +E+++ E+Y+  ++ DL+RRR  I+ +E RG ++++ A
Sbjct: 583 ASMALKEAAKKAGPVILEPIMKVEVVTPEEYMGDVIGDLNRRRGQIQGMEARGGAQIVKA 642

Query: 86  EAPLSELLGYCQRVRTLSSGRSHFSMEFLCFKQVSSQ 122
             PLSE+ GY   +R+ + GR+ FSMEF  +++V   
Sbjct: 643 FVPLSEMFGYATDLRSATQGRATFSMEFDHYEEVPKN 679

Length = 691
>gnl|CDD|234569 PRK00007, PRK00007, elongation factor G; Reviewed Back     alignment and domain information
>gnl|CDD|237186 PRK12740, PRK12740, elongation factor G; Reviewed Back     alignment and domain information
>gnl|CDD|239683 cd03713, EFG_mtEFG_C, EFG_mtEFG_C: domains similar to the C-terminal domain of the bacterial translational elongation factor (EF) EF-G Back     alignment and domain information
>gnl|CDD|129575 TIGR00484, EF-G, translation elongation factor EF-G Back     alignment and domain information
>gnl|CDD|197906 smart00838, EFG_C, Elongation factor G C-terminus Back     alignment and domain information
>gnl|CDD|237358 PRK13351, PRK13351, elongation factor G; Reviewed Back     alignment and domain information
>gnl|CDD|201388 pfam00679, EFG_C, Elongation factor G C-terminus Back     alignment and domain information
>gnl|CDD|238772 cd01514, Elongation_Factor_C, Elongation factor G C-terminus Back     alignment and domain information
>gnl|CDD|223556 COG0480, FusA, Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|236047 PRK07560, PRK07560, elongation factor EF-2; Reviewed Back     alignment and domain information
>gnl|CDD|239764 cd04097, mtEFG1_C, mtEFG1_C: C-terminus of mitochondrial Elongation factor G1 (mtEFG1)-like proteins found in eukaryotes Back     alignment and domain information
>gnl|CDD|129581 TIGR00490, aEF-2, translation elongation factor aEF-2 Back     alignment and domain information
>gnl|CDD|237186 PRK12740, PRK12740, elongation factor G; Reviewed Back     alignment and domain information
>gnl|CDD|239683 cd03713, EFG_mtEFG_C, EFG_mtEFG_C: domains similar to the C-terminal domain of the bacterial translational elongation factor (EF) EF-G Back     alignment and domain information
>gnl|CDD|239682 cd03711, Tet_C, Tet_C: C-terminus of ribosomal protection proteins Tet(M) and Tet(O) Back     alignment and domain information
>gnl|CDD|238772 cd01514, Elongation_Factor_C, Elongation factor G C-terminus Back     alignment and domain information
>gnl|CDD|129575 TIGR00484, EF-G, translation elongation factor EF-G Back     alignment and domain information
>gnl|CDD|197906 smart00838, EFG_C, Elongation factor G C-terminus Back     alignment and domain information
>gnl|CDD|239764 cd04097, mtEFG1_C, mtEFG1_C: C-terminus of mitochondrial Elongation factor G1 (mtEFG1)-like proteins found in eukaryotes Back     alignment and domain information
>gnl|CDD|236047 PRK07560, PRK07560, elongation factor EF-2; Reviewed Back     alignment and domain information
>gnl|CDD|130460 TIGR01393, lepA, GTP-binding protein LepA Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 192
KOG0465|consensus721 99.92
COG0480697 FusA Translation elongation factors (GTPases) [Tra 99.9
TIGR00490720 aEF-2 translation elongation factor aEF-2. This mo 99.9
PRK07560731 elongation factor EF-2; Reviewed 99.89
PRK00007693 elongation factor G; Reviewed 99.87
PLN00116843 translation elongation factor EF-2 subunit; Provis 99.87
KOG0465|consensus721 99.84
TIGR00484689 EF-G translation elongation factor EF-G. After pep 99.83
PRK12739691 elongation factor G; Reviewed 99.83
TIGR00484689 EF-G translation elongation factor EF-G. After pep 99.83
PRK12739691 elongation factor G; Reviewed 99.83
PTZ00416836 elongation factor 2; Provisional 99.82
PRK13351687 elongation factor G; Reviewed 99.82
PRK13351687 elongation factor G; Reviewed 99.81
PF0067989 EFG_C: Elongation factor G C-terminus; InterPro: I 99.81
PRK12740668 elongation factor G; Reviewed 99.8
smart0083885 EFG_C Elongation factor G C-terminus. This domain 99.79
cd0409880 eEF2_C_snRNP eEF2_C_snRNP: This family includes a 99.78
cd0409778 mtEFG1_C mtEFG1_C: C-terminus of mitochondrial Elo 99.77
PRK12740668 elongation factor G; Reviewed 99.76
cd0371079 BipA_TypA_C BipA_TypA_C: a C-terminal portion of B 99.75
PTZ00416836 elongation factor 2; Provisional 99.75
cd0371178 Tet_C Tet_C: C-terminus of ribosomal protection pr 99.75
cd0371378 EFG_mtEFG_C EFG_mtEFG_C: domains similar to the C- 99.74
cd0409680 eEF2_snRNP_like_C eEF2_snRNP_like_C: this family r 99.73
cd0370980 lepA_C lepA_C: This family represents the C-termin 99.72
cd0151479 Elongation_Factor_C Elongation factor G C-terminus 99.71
cd0409880 eEF2_C_snRNP eEF2_C_snRNP: This family includes a 99.69
cd0409680 eEF2_snRNP_like_C eEF2_snRNP_like_C: this family r 99.59
smart0083885 EFG_C Elongation factor G C-terminus. This domain 99.58
cd0409778 mtEFG1_C mtEFG1_C: C-terminus of mitochondrial Elo 99.58
PRK05433600 GTP-binding protein LepA; Provisional 99.56
TIGR01394594 TypA_BipA GTP-binding protein TypA/BipA. This bact 99.55
TIGR01393595 lepA GTP-binding protein LepA. LepA (GUF1 in Sacca 99.54
PF0067989 EFG_C: Elongation factor G C-terminus; InterPro: I 99.54
cd0371178 Tet_C Tet_C: C-terminus of ribosomal protection pr 99.54
KOG0469|consensus842 99.53
cd0371378 EFG_mtEFG_C EFG_mtEFG_C: domains similar to the C- 99.52
cd0371079 BipA_TypA_C BipA_TypA_C: a C-terminal portion of B 99.51
cd0370980 lepA_C lepA_C: This family represents the C-termin 99.5
PRK10218607 GTP-binding protein; Provisional 99.5
cd0151479 Elongation_Factor_C Elongation factor G C-terminus 99.45
KOG0464|consensus753 99.38
KOG0468|consensus971 99.26
TIGR01394 594 TypA_BipA GTP-binding protein TypA/BipA. This bact 99.24
PRK10218 607 GTP-binding protein; Provisional 99.17
KOG0467|consensus887 99.16
KOG0464|consensus753 99.11
COG0481603 LepA Membrane GTPase LepA [Cell envelope biogenesi 99.09
PRK05433 600 GTP-binding protein LepA; Provisional 99.08
KOG0462|consensus650 99.0
TIGR01393595 lepA GTP-binding protein LepA. LepA (GUF1 in Sacca 98.99
COG1217603 TypA Predicted membrane GTPase involved in stress 98.89
KOG0469|consensus842 98.76
KOG0468|consensus971 98.48
COG0480697 FusA Translation elongation factors (GTPases) [Tra 98.35
PRK07560731 elongation factor EF-2; Reviewed 98.17
PRK00007693 elongation factor G; Reviewed 98.08
TIGR00490720 aEF-2 translation elongation factor aEF-2. This mo 98.03
PLN00116843 translation elongation factor EF-2 subunit; Provis 97.92
cd01684115 Tet_like_IV EF-G_domain IV_RPP domain is a part of 97.72
KOG0467|consensus887 97.68
cd01693120 mtEFG2_like_IV mtEF-G2 domain IV. This subfamily i 97.33
TIGR00257204 IMPACT_YIGZ uncharacterized protein, YigZ family. 97.27
PRK11568204 hypothetical protein; Provisional 97.19
KOG0462|consensus650 97.07
cd01434116 EFG_mtEFG1_IV EFG_mtEFG1_IV: domains similar to do 97.03
PF0918656 DUF1949: Domain of unknown function (DUF1949); Int 96.83
cd01680116 EFG_like_IV Elongation Factor G-like domain IV. Th 96.75
PF03764120 EFG_IV: Elongation factor G, domain IV; InterPro: 96.51
cd01681177 aeEF2_snRNP_like_IV This family represents domain 95.66
COG0481 603 LepA Membrane GTPase LepA [Cell envelope biogenesi 95.11
COG1217 603 TypA Predicted membrane GTPase involved in stress 94.5
cd01683178 EF2_IV_snRNP EF-2_domain IV_snRNP domain is a part 94.43
PRK13760231 putative RNA-associated protein; Provisional 86.99
PF0802975 HisG_C: HisG, C-terminal domain; InterPro: IPR0131 84.21
>KOG0465|consensus Back     alignment and domain information 
Probab=99.92  E-value=7.9e-26  Score=200.17  Aligned_cols=148  Identities=18%  Similarity=0.265  Sum_probs=126.3

Q ss_pred             CChHHHHHHHHHHHHHHHHHcCceeeeeeEEEEEEecCCchhhHH-HHHhhcCceeeeeee----c-----CCeEEEEEe
Q psy11837         17 PRTYVILMCIATGASMALKEAGCILLEPYMYLEIISDEQYVHGIL-ADLSRRRADIRSVED----R-----GSSKVIIAE   86 (192)
Q Consensus        17 ~~~~~~~~a~~~~~~~al~~ag~~l~EPv~~v~I~vp~~~~g~V~-~~l~~rrg~i~~~~~----~-----~~~~~i~~~   86 (192)
                      -.|.+|++|+++|+.+++.+ ||+.++|+.+|++.+.++..|+|+ ++++..++...++..    +     .|+|.|+++
T Consensus       563 ~~P~~f~pa~ekg~~e~~~~-G~L~ghpl~~~r~~l~Dga~h~vds~elaf~~at~~a~r~a~~~a~p~iLEPIM~Vevt  641 (721)
T KOG0465|consen  563 NVPKQFIPAVEKGFEEIVAK-GPLIGHPLSNLRIVLQDGAHHPVDSSELAFMKATRNAFREAFKRAPPRILEPIMNVEVT  641 (721)
T ss_pred             CCchhHHHHHHHHHHHHHhc-CCccCCcccceEEEEecCCcCcccccHHHHHHHHHHHHHHHHHhCCcceeecceeeEEe
Confidence            37889999999999999986 999999999999999999999995 677766554444333    2     479999999


Q ss_pred             ecchhhcchhhhhhhhccceEEeeeeecceeecCchHHHHHHhcccCCCcceeccCchhhhhhhhhhhhhhccCceeEEE
Q psy11837         87 APLSELLGYCQRVRTLSSGRSHFSMEFLCFKQVSSQNEAQAVRNITGFDPVIIAEAPLSELLGYCQRVRTLSSGRSHFSM  166 (192)
Q Consensus        87 vP~~~~~~~~~~L~s~T~G~g~~~~~~~~y~~~p~~~~~~i~~~~~~~~~~i~a~~P~~~~~~y~~~lrs~T~G~g~~~~  166 (192)
                      +|.+..|.+.++|.   +.+|.+...                 +..+++++|.|++||.+|++|+++|||+|+|+|+|+|
T Consensus       642 ~P~EfqG~Vi~~L~---kR~a~I~~~-----------------d~~~~~~ti~A~VPL~~mfgYss~LRslTqGkgeftM  701 (721)
T KOG0465|consen  642 TPEEFQGTVIGDLN---KRKAQITGI-----------------DSSEDYKTIKAEVPLNEMFGYSSELRSLTQGKGEFTM  701 (721)
T ss_pred             cchhhhhhhhhhhh---hcccEEecc-----------------cCCCceEEEEecccHHHHhhhhhhhhhhhcCcceEEE
Confidence            99999999999996   344443210                 2345689999999999999999999999999999999


Q ss_pred             EecccccCCcHHHHHHHHH
Q psy11837        167 EFLCFKQVSSQNEAQAVRN  185 (192)
Q Consensus       167 ~~~~y~~v~~~~~~~~~~~  185 (192)
                      +|++|+|||+++|++++.+
T Consensus       702 Eys~y~p~~~~vq~~~~~~  720 (721)
T KOG0465|consen  702 EYSRYSPVPPDVQDQLVHK  720 (721)
T ss_pred             eecccCCCchHHHHHhhcc
Confidence            9999999999999999865

>COG0480 FusA Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00490 aEF-2 translation elongation factor aEF-2 Back     alignment and domain information
>PRK07560 elongation factor EF-2; Reviewed Back     alignment and domain information
>PRK00007 elongation factor G; Reviewed Back     alignment and domain information
>PLN00116 translation elongation factor EF-2 subunit; Provisional Back     alignment and domain information
>KOG0465|consensus Back     alignment and domain information
>TIGR00484 EF-G translation elongation factor EF-G Back     alignment and domain information
>PRK12739 elongation factor G; Reviewed Back     alignment and domain information
>TIGR00484 EF-G translation elongation factor EF-G Back     alignment and domain information
>PRK12739 elongation factor G; Reviewed Back     alignment and domain information
>PTZ00416 elongation factor 2; Provisional Back     alignment and domain information
>PRK13351 elongation factor G; Reviewed Back     alignment and domain information
>PRK13351 elongation factor G; Reviewed Back     alignment and domain information
>PF00679 EFG_C: Elongation factor G C-terminus; InterPro: IPR000640 Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome [, , ] Back     alignment and domain information
>PRK12740 elongation factor G; Reviewed Back     alignment and domain information
>smart00838 EFG_C Elongation factor G C-terminus Back     alignment and domain information
>cd04098 eEF2_C_snRNP eEF2_C_snRNP: This family includes a C-terminal portion of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p Back     alignment and domain information
>cd04097 mtEFG1_C mtEFG1_C: C-terminus of mitochondrial Elongation factor G1 (mtEFG1)-like proteins found in eukaryotes Back     alignment and domain information
>PRK12740 elongation factor G; Reviewed Back     alignment and domain information
>cd03710 BipA_TypA_C BipA_TypA_C: a C-terminal portion of BipA or TypA having homology to the C terminal domains of the elongation factors EF-G and EF-2 Back     alignment and domain information
>PTZ00416 elongation factor 2; Provisional Back     alignment and domain information
>cd03711 Tet_C Tet_C: C-terminus of ribosomal protection proteins Tet(M) and Tet(O) Back     alignment and domain information
>cd03713 EFG_mtEFG_C EFG_mtEFG_C: domains similar to the C-terminal domain of the bacterial translational elongation factor (EF) EF-G Back     alignment and domain information
>cd04096 eEF2_snRNP_like_C eEF2_snRNP_like_C: this family represents a C-terminal domain of eukaryotic elongation factor 2 (eEF-2) and a homologous domain of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p Back     alignment and domain information
>cd03709 lepA_C lepA_C: This family represents the C-terminal region of LepA, a GTP-binding protein localized in the cytoplasmic membrane Back     alignment and domain information
>cd01514 Elongation_Factor_C Elongation factor G C-terminus Back     alignment and domain information
>cd04098 eEF2_C_snRNP eEF2_C_snRNP: This family includes a C-terminal portion of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p Back     alignment and domain information
>cd04096 eEF2_snRNP_like_C eEF2_snRNP_like_C: this family represents a C-terminal domain of eukaryotic elongation factor 2 (eEF-2) and a homologous domain of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p Back     alignment and domain information
>smart00838 EFG_C Elongation factor G C-terminus Back     alignment and domain information
>cd04097 mtEFG1_C mtEFG1_C: C-terminus of mitochondrial Elongation factor G1 (mtEFG1)-like proteins found in eukaryotes Back     alignment and domain information
>PRK05433 GTP-binding protein LepA; Provisional Back     alignment and domain information
>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA Back     alignment and domain information
>TIGR01393 lepA GTP-binding protein LepA Back     alignment and domain information
>PF00679 EFG_C: Elongation factor G C-terminus; InterPro: IPR000640 Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome [, , ] Back     alignment and domain information
>cd03711 Tet_C Tet_C: C-terminus of ribosomal protection proteins Tet(M) and Tet(O) Back     alignment and domain information
>KOG0469|consensus Back     alignment and domain information
>cd03713 EFG_mtEFG_C EFG_mtEFG_C: domains similar to the C-terminal domain of the bacterial translational elongation factor (EF) EF-G Back     alignment and domain information
>cd03710 BipA_TypA_C BipA_TypA_C: a C-terminal portion of BipA or TypA having homology to the C terminal domains of the elongation factors EF-G and EF-2 Back     alignment and domain information
>cd03709 lepA_C lepA_C: This family represents the C-terminal region of LepA, a GTP-binding protein localized in the cytoplasmic membrane Back     alignment and domain information
>PRK10218 GTP-binding protein; Provisional Back     alignment and domain information
>cd01514 Elongation_Factor_C Elongation factor G C-terminus Back     alignment and domain information
>KOG0464|consensus Back     alignment and domain information
>KOG0468|consensus Back     alignment and domain information
>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA Back     alignment and domain information
>PRK10218 GTP-binding protein; Provisional Back     alignment and domain information
>KOG0467|consensus Back     alignment and domain information
>KOG0464|consensus Back     alignment and domain information
>COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK05433 GTP-binding protein LepA; Provisional Back     alignment and domain information
>KOG0462|consensus Back     alignment and domain information
>TIGR01393 lepA GTP-binding protein LepA Back     alignment and domain information
>COG1217 TypA Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] Back     alignment and domain information
>KOG0469|consensus Back     alignment and domain information
>KOG0468|consensus Back     alignment and domain information
>COG0480 FusA Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK07560 elongation factor EF-2; Reviewed Back     alignment and domain information
>PRK00007 elongation factor G; Reviewed Back     alignment and domain information
>TIGR00490 aEF-2 translation elongation factor aEF-2 Back     alignment and domain information
>PLN00116 translation elongation factor EF-2 subunit; Provisional Back     alignment and domain information
>cd01684 Tet_like_IV EF-G_domain IV_RPP domain is a part of bacterial ribosomal protected proteins (RPP) family Back     alignment and domain information
>KOG0467|consensus Back     alignment and domain information
>cd01693 mtEFG2_like_IV mtEF-G2 domain IV Back     alignment and domain information
>TIGR00257 IMPACT_YIGZ uncharacterized protein, YigZ family Back     alignment and domain information
>PRK11568 hypothetical protein; Provisional Back     alignment and domain information
>KOG0462|consensus Back     alignment and domain information
>cd01434 EFG_mtEFG1_IV EFG_mtEFG1_IV: domains similar to domain IV of the bacterial translational elongation factor (EF) EF-G Back     alignment and domain information
>PF09186 DUF1949: Domain of unknown function (DUF1949); InterPro: IPR015269 Members of this entry are a set of functionally uncharacterised hypothetical bacterial proteins Back     alignment and domain information
>cd01680 EFG_like_IV Elongation Factor G-like domain IV Back     alignment and domain information
>PF03764 EFG_IV: Elongation factor G, domain IV; InterPro: IPR005517 Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome [, , ] Back     alignment and domain information
>cd01681 aeEF2_snRNP_like_IV This family represents domain IV of archaeal and eukaryotic elongation factor 2 (aeEF-2) and of an evolutionarily conserved U5 snRNP-specific protein Back     alignment and domain information
>COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG1217 TypA Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] Back     alignment and domain information
>cd01683 EF2_IV_snRNP EF-2_domain IV_snRNP domain is a part of 116kD U5-specific protein of the U5 small nucleoprotein (snRNP) particle, essential component of the spliceosome Back     alignment and domain information
>PRK13760 putative RNA-associated protein; Provisional Back     alignment and domain information
>PF08029 HisG_C: HisG, C-terminal domain; InterPro: IPR013115 ATP phosphoribosyltransferase (2 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query192
4fn5_A709 Elongation Factor G 1 (Pseudomonas Aeruginosa) In C 2e-17
3j0e_H702 Models For The T. Thermophilus Ribosome Recycling F 2e-15
2rdo_7704 50s Subunit With Ef-G(Gdpnp) And Rrf Bound Length = 2e-15
2bv3_A691 Crystal Structure Of A Mutant Elongation Factor G T 7e-15
2bm1_A691 Ribosomal Elongation Factor G (Ef-G) Fusidic Acid R 7e-15
2bm0_A691 Ribosomal Elongation Factor G (Ef-G) Fusidic Acid R 7e-15
1ktv_A691 Crystal Structure Of Elongation Factor G Dimer With 7e-15
1fnm_A691 Structure Of Thermus Thermophilus Ef-G H573a Length 7e-15
2j7k_A691 Crystal Structure Of The T84a Mutant Ef-G:gdpcp Com 7e-15
1efg_A691 The Crystal Structure Of Elongation Factor G Comple 7e-15
1zn0_B655 Coordinates Of Rrf And Ef-G Fitted Into Cryo-Em Map 1e-14
3izp_E688 Conformation Of Ef-G During Translocation Length = 1e-14
2xex_A693 Crystal Structure Of Staphylococcus Aureus Elongati 4e-13
3zzu_A693 Crystal Structure Of Staphylococcus Aureus Elongati 4e-13
3zzt_A693 Crystal Structure Of Staphylococcus Aureus Elongati 4e-13
3zz0_A693 Crystal Structure Of Ribosomal Elongation Factor (E 4e-13
1wdt_A665 Crystal Structure Of Ttk003000868 From Thermus Ther 7e-10
1jqs_C68 Fitting Of L11 Protein And Elongation Factor G (Dom 2e-09
>pdb|4FN5|A Chain A, Elongation Factor G 1 (Pseudomonas Aeruginosa) In Complex With Argyrin B Length = 709 Back     alignment and structure 
Iteration: 1

 Score = 85.5 bits (210), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 43/102 (42%), Positives = 62/102 (60%), Gaps = 4/102 (3%)
Query: 24  MCIATGASMALKE----AGCILLEPYMYLEIISDEQYVHGILADLSRRRADIRSVEDRGS 79
           M     ASMA K+     G  +LEP M +E+++ E Y+  ++ DL+RRR  I+ +ED  S
Sbjct: 597 MAFKIAASMATKQLAQKGGGKVLEPIMKVEVVTPEDYMGDVMGDLNRRRGLIQGMEDTVS 656
Query: 80  SKVIIAEAPLSELLGYCQRVRTLSSGRSHFSMEFLCFKQVSS 121
            KVI AE PL E+ GY   VR++S GR+ +SMEF  + +  S
Sbjct: 657 GKVIRAEVPLGEMFGYATDVRSMSQGRASYSMEFSKYAEAPS 698
>pdb|3J0E|H Chain H, Models For The T. Thermophilus Ribosome Recycling Factor And The E. Coli Elongation Factor G Bound To The E. Coli Post-Termination Complex Length = 702 Back     alignment and structure
>pdb|2RDO|7 Chain 7, 50s Subunit With Ef-G(Gdpnp) And Rrf Bound Length = 704 Back     alignment and structure
>pdb|2BV3|A Chain A, Crystal Structure Of A Mutant Elongation Factor G Trapped With A Gtp Analogue Length = 691 Back     alignment and structure
>pdb|2BM1|A Chain A, Ribosomal Elongation Factor G (Ef-G) Fusidic Acid Resistant Mutant G16v Length = 691 Back     alignment and structure
>pdb|2BM0|A Chain A, Ribosomal Elongation Factor G (Ef-G) Fusidic Acid Resistant Mutant T84a Length = 691 Back     alignment and structure
>pdb|1KTV|A Chain A, Crystal Structure Of Elongation Factor G Dimer Without Nucleotide Length = 691 Back     alignment and structure
>pdb|1FNM|A Chain A, Structure Of Thermus Thermophilus Ef-G H573a Length = 691 Back     alignment and structure
>pdb|2J7K|A Chain A, Crystal Structure Of The T84a Mutant Ef-G:gdpcp Complex Length = 691 Back     alignment and structure
>pdb|1EFG|A Chain A, The Crystal Structure Of Elongation Factor G Complexed With Gdp, At 2.7 Angstroms Resolution Length = 691 Back     alignment and structure
>pdb|1ZN0|B Chain B, Coordinates Of Rrf And Ef-G Fitted Into Cryo-Em Map Of The 50s Subunit Bound With Both Ef-G (Gdpnp) And Rrf Length = 655 Back     alignment and structure
>pdb|3IZP|E Chain E, Conformation Of Ef-G During Translocation Length = 688 Back     alignment and structure
>pdb|2XEX|A Chain A, Crystal Structure Of Staphylococcus Aureus Elongation Factor G Length = 693 Back     alignment and structure
>pdb|3ZZU|A Chain A, Crystal Structure Of Staphylococcus Aureus Elongation Factor G With Mutations M16i And F88l Length = 693 Back     alignment and structure
>pdb|3ZZT|A Chain A, Crystal Structure Of Staphylococcus Aureus Elongation Factor G With A Fusidic-Acid-Resistant Mutation F88l Length = 693 Back     alignment and structure
>pdb|3ZZ0|A Chain A, Crystal Structure Of Ribosomal Elongation Factor (Ef)-G From Staphylococcus Aureus With A Fusidic Acid Hyper-Sensitivity Mutation M16i Length = 693 Back     alignment and structure
>pdb|1WDT|A Chain A, Crystal Structure Of Ttk003000868 From Thermus Thermophilus Hb8 Length = 665 Back     alignment and structure
>pdb|1JQS|C Chain C, Fitting Of L11 Protein And Elongation Factor G (Domain G' And V) In The Cryo-Em Map Of E. Coli 70s Ribosome Bound With Ef-G And Gmppcp, A Nonhydrolysable Gtp Analog Length = 68 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query192
1dar_A691 EF-G, elongation factor G; ribosomal translocase, 1e-27
2rdo_7704 EF-G, elongation factor G; elongation factor G, EF 1e-27
2dy1_A665 Elongation factor G; translocation, GTP complex, s 2e-27
2xex_A693 Elongation factor G; GTPase, translation, biosynth 1e-26
1n0u_A842 EF-2, elongation factor 2; G-protein, CIS-proline, 9e-15
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Length = 691 Back     alignment and structure
 Score =  107 bits (271), Expect = 1e-27
 Identities = 37/107 (34%), Positives = 63/107 (58%), Gaps = 7/107 (6%)

Query: 26  IATGASMALKE----AGCILLEPYMYLEIISDEQYVHGILADLSRRRADIRSVEDRGSSK 81
           IA   SMA+KE       ++LEP M +E+ + E+Y+  ++ DL+ RR  I  +E RG+++
Sbjct: 584 IA--GSMAIKEAVQKGDPVILEPIMRVEVTTPEEYMGDVIGDLNARRGQILGMEPRGNAQ 641

Query: 82  VIIAEAPLSELLGYCQRVRTLSSGRSHFSMEFLCFKQVSSQNEAQAV 128
           VI A  PL+E+ GY   +R+ + GR  F M F  +++V  +   + +
Sbjct: 642 VIRAFVPLAEMFGYATDLRSKTQGRGSFVMFFDHYQEV-PKQVQEKL 687
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Length = 704 Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Length = 665 Back     alignment and structure
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Length = 693 Back     alignment and structure
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Length = 842 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query192
1n0u_A842 EF-2, elongation factor 2; G-protein, CIS-proline, 99.92
2rdo_7704 EF-G, elongation factor G; elongation factor G, EF 99.88
2xex_A693 Elongation factor G; GTPase, translation, biosynth 99.88
1dar_A691 EF-G, elongation factor G; ribosomal translocase, 99.88
2xex_A693 Elongation factor G; GTPase, translation, biosynth 99.87
2rdo_7704 EF-G, elongation factor G; elongation factor G, EF 99.87
2dy1_A665 Elongation factor G; translocation, GTP complex, s 99.87
4fn5_A709 EF-G 1, elongation factor G 1; translation, transl 99.87
3j25_A638 Tetracycline resistance protein TETM; antibiotic r 99.86
4fn5_A709 EF-G 1, elongation factor G 1; translation, transl 99.86
2dy1_A665 Elongation factor G; translocation, GTP complex, s 99.86
1dar_A691 EF-G, elongation factor G; ribosomal translocase, 99.85
3j25_A638 Tetracycline resistance protein TETM; antibiotic r 99.8
3e3x_A332 BIPA; MCSG,PSI2, structural genomics, protein stru 99.62
3cb4_D599 GTP-binding protein LEPA; GTPase, OB-fold, membran 99.56
2ywe_A600 GTP-binding protein LEPA; G domain, beta-barrel, f 99.56
3e3x_A 332 BIPA; MCSG,PSI2, structural genomics, protein stru 99.29
3cb4_D 599 GTP-binding protein LEPA; GTPase, OB-fold, membran 99.14
2ywe_A600 GTP-binding protein LEPA; G domain, beta-barrel, f 99.13
1n0u_A842 EF-2, elongation factor 2; G-protein, CIS-proline, 98.35
2cve_A191 Hypothetical protein TTHA1053; COG1739, UPF0029, s 97.57
1vi7_A217 Hypothetical protein YIGZ; structural genomics, un 97.52
3lh2_S76 4E10_1VI7A_S0_002_N (T88); epitope-scaffold, immun 96.56
2wbm_A252 MTHSBDS, ribosome maturation protein SDO1 homolog; 87.65
1t95_A240 Hypothetical protein AF0491; shwachman-bodian-diam 87.2
2kdo_A252 Ribosome maturation protein SBDS; SBDS protein, pr 83.94
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Back     alignment and structure
Probab=99.92  E-value=6.6e-25  Score=205.73  Aligned_cols=120  Identities=24%  Similarity=0.320  Sum_probs=107.4

Q ss_pred             hHHHHHHHHHHHHHHHHHcCceeeeeeEEEEEEecCCchhhHHHHHhhcCceeeeeeecCCeEEEEEeecchhhcchhhh
Q psy11837         19 TYVILMCIATGASMALKEAGCILLEPYMYLEIISDEQYVHGILADLSRRRADIRSVEDRGSSKVIIAEAPLSELLGYCQR   98 (192)
Q Consensus        19 ~~~~~~a~~~~~~~al~~ag~~l~EPv~~v~I~vp~~~~g~V~~~l~~rrg~i~~~~~~~~~~~i~~~vP~~~~~~~~~~   98 (192)
                      +.+|++|++++|++|+.+|+|.++||||.|+|.+|++++|.|+++|++|||.|.+.+..                     
T Consensus       702 ~g~f~~a~~~a~~~a~~~a~p~LLEPi~~veI~vP~e~~G~V~~dL~~RRG~i~~~~~~---------------------  760 (842)
T 1n0u_A          702 GGQIIPTMRRATYAGFLLADPKIQEPVFLVEIQCPEQAVGGIYSVLNKKRGQVVSEEQR---------------------  760 (842)
T ss_dssp             HHHHHHHHHHHHHHHHHHSCEEEEEEEEEEEEEECGGGHHHHHHHHHTTTCEEEEEEC----------------------
T ss_pred             hhHHHHHHHHHHHHHHHhCCCeEEeeEEEEEEEccHHHHHHHHHHHHhcCcEEeccccC---------------------
Confidence            56799999999999999999999999999999999999999999999999999865320                     


Q ss_pred             hhhhccceEEeeeeecceeecCchHHHHHHhcccCCCcceeccCchhhhhhhhhhhhhhccCceeEEEEecccccCCcH-
Q psy11837         99 VRTLSSGRSHFSMEFLCFKQVSSQNEAQAVRNITGFDPVIIAEAPLSELLGYCQRVRTLSSGRSHFSMEFLCFKQVSSQ-  177 (192)
Q Consensus        99 L~s~T~G~g~~~~~~~~y~~~p~~~~~~i~~~~~~~~~~i~a~~P~~~~~~y~~~lrs~T~G~g~~~~~~~~y~~v~~~-  177 (192)
                           .|                           ....+|+|++|++||++|+++|||+|+|+|+|+|+|+||++||++ 
T Consensus       761 -----~g---------------------------~~~~~I~a~vP~aE~fgy~~~LRs~T~G~g~~~~~F~~y~~vp~~~  808 (842)
T 1n0u_A          761 -----PG---------------------------TPLFTVKAYLPVNESFGFTGELRQATGGQAFPQMVFDHWSTLGSDP  808 (842)
T ss_dssp             ----------------------------------CCCEEEEEEEEGGGCTTHHHHHHHHTTTCCEEEEEEEEEEECCSCT
T ss_pred             -----CC---------------------------CceEEEEEEcChHHhhhhHHHHHhhCCCCceEEEEeccceeCCCCc
Confidence                 00                           134689999999999999999999999999999999999999987 


Q ss_pred             -----HHHHHH---HHhCCCCC
Q psy11837        178 -----NEAQAV---RNITGFDP  191 (192)
Q Consensus       178 -----~~~~~~---~~~~~~~~  191 (192)
                           ++++++   |.||||++
T Consensus       809 ~~~~~~a~~~~~~~R~rKGl~~  830 (842)
T 1n0u_A          809 LDPTSKAGEIVLAARKRHGMKE  830 (842)
T ss_dssp             TCTTSHHHHHHHHHHHHTTCCS
T ss_pred             cchhhHHHHHHHHHHHhCCCCC
Confidence                 788776   89999975
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Back     alignment and structure
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Back     alignment and structure
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Back     alignment and structure
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>4fn5_A EF-G 1, elongation factor G 1; translation, translation-antibiotic compl; HET: 0UO; 2.90A {Pseudomonas aeruginosa} Back     alignment and structure
>3j25_A Tetracycline resistance protein TETM; antibiotic resistance, translation; HET: GCP; 7.20A {Enterococcus faecalis} Back     alignment and structure
>4fn5_A EF-G 1, elongation factor G 1; translation, translation-antibiotic compl; HET: 0UO; 2.90A {Pseudomonas aeruginosa} Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Back     alignment and structure
>3j25_A Tetracycline resistance protein TETM; antibiotic resistance, translation; HET: GCP; 7.20A {Enterococcus faecalis} Back     alignment and structure
>3e3x_A BIPA; MCSG,PSI2, structural genomics, protein struct initiative, midwest center for structural genomics, GTP-BIN nucleotide-binding; HET: MLZ MLY; 1.95A {Vibrio parahaemolyticus} Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Back     alignment and structure
>3e3x_A BIPA; MCSG,PSI2, structural genomics, protein struct initiative, midwest center for structural genomics, GTP-BIN nucleotide-binding; HET: MLZ MLY; 1.95A {Vibrio parahaemolyticus} Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Back     alignment and structure
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Back     alignment and structure
>2cve_A Hypothetical protein TTHA1053; COG1739, UPF0029, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: TLA; 1.60A {Thermus thermophilus} SCOP: d.14.1.11 d.58.11.2 Back     alignment and structure
>1vi7_A Hypothetical protein YIGZ; structural genomics, unknown function; 2.80A {Escherichia coli} SCOP: d.14.1.11 d.58.11.2 Back     alignment and structure
>3lh2_S 4E10_1VI7A_S0_002_N (T88); epitope-scaffold, immune system; 2.65A {Artificial gene} Back     alignment and structure
>2wbm_A MTHSBDS, ribosome maturation protein SDO1 homolog; shwachman-bodian-diamond syndrome protein; 1.75A {Methanothermobacter thermautotrophicusorganism_taxid} Back     alignment and structure
>1t95_A Hypothetical protein AF0491; shwachman-bodian-diamond syndrome protein orthologue, unknown function; 1.90A {Archaeoglobus fulgidus} SCOP: a.5.8.1 d.235.1.2 d.58.11.3 PDB: 1p9q_C Back     alignment and structure
>2kdo_A Ribosome maturation protein SBDS; SBDS protein, protein structure, RNA-interacting protein mutation, phosphoprotein, ribosome biogenesis; NMR {Homo sapiens} PDB: 2l9n_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 192
d2bv3a589 d.58.11.1 (A:600-688) Elongation factor G (EF-G) { 5e-22
d2bv3a589 d.58.11.1 (A:600-688) Elongation factor G (EF-G) { 2e-07
d2dy1a596 d.58.11.1 (A:570-665) Elongation factor G (EF-G) { 2e-19
d2dy1a596 d.58.11.1 (A:570-665) Elongation factor G (EF-G) { 1e-05
d1n0ua5117 d.58.11.1 (A:726-842) Elongation factor 2 (eEF-2) 4e-14
>d2bv3a5 d.58.11.1 (A:600-688) Elongation factor G (EF-G) {Thermus thermophilus [TaxId: 274]} Length = 89 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: EF-G C-terminal domain-like
family: EF-G/eEF-2 domains III and V
domain: Elongation factor G (EF-G)
species: Thermus thermophilus [TaxId: 274]

 Score = 83.3 bits (206), Expect = 5e-22
 Identities = 30/89 (33%), Positives = 55/89 (61%), Gaps = 1/89 (1%)

Query: 40  ILLEPYMYLEIISDEQYVHGILADLSRRRADIRSVEDRGSSKVIIAEAPLSELLGYCQRV 99
           ++LEP M +E+ + E+Y+  ++ DL+ RR  I  +E RG+++VI A  PL+E+ GY   +
Sbjct: 1   VILEPIMRVEVTTPEEYMGDVIGDLNARRGQILGMEPRGNAQVIRAFVPLAEMFGYATDL 60

Query: 100 RTLSSGRSHFSMEFLCFKQVSSQNEAQAV 128
           R+ + GR  F M F  +++V  +   + +
Sbjct: 61  RSKTQGRGSFVMFFDHYQEV-PKQVQEKL 88
>d2bv3a5 d.58.11.1 (A:600-688) Elongation factor G (EF-G) {Thermus thermophilus [TaxId: 274]} Length = 89 Back     information, alignment and structure
>d2dy1a5 d.58.11.1 (A:570-665) Elongation factor G (EF-G) {Thermus thermophilus, EF-G-2 [TaxId: 274]} Length = 96 Back     information, alignment and structure
>d2dy1a5 d.58.11.1 (A:570-665) Elongation factor G (EF-G) {Thermus thermophilus, EF-G-2 [TaxId: 274]} Length = 96 Back     information, alignment and structure
>d1n0ua5 d.58.11.1 (A:726-842) Elongation factor 2 (eEF-2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 117 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query192
d2bv3a589 Elongation factor G (EF-G) {Thermus thermophilus [ 99.87
d2dy1a596 Elongation factor G (EF-G) {Thermus thermophilus, 99.87
d1n0ua5117 Elongation factor 2 (eEF-2) {Baker's yeast (Saccha 99.82
d2dy1a596 Elongation factor G (EF-G) {Thermus thermophilus, 99.77
d2bv3a589 Elongation factor G (EF-G) {Thermus thermophilus [ 99.74
d1n0ua5117 Elongation factor 2 (eEF-2) {Baker's yeast (Saccha 98.64
d2dy1a3115 Elongation factor G (EF-G), domain IV {Thermus the 97.81
d2bv3a3121 Elongation factor G (EF-G), domain IV {Thermus the 97.62
d1vi7a271 Hypothetical protein YigZ, C-terminal domain {Esch 97.62
d1n0ua3165 Elongation factor 2 (eEF-2), domain IV {Baker's ye 96.11
d1t95a373 Hypothetical protein AF0491, C-terminal domain {Ar 94.12
d2dy1a3115 Elongation factor G (EF-G), domain IV {Thermus the 93.27
d1vi7a271 Hypothetical protein YigZ, C-terminal domain {Esch 81.67
d1nh8a274 ATP phosphoribosyltransferase (ATP-PRTase, HisG), 81.62
>d2bv3a5 d.58.11.1 (A:600-688) Elongation factor G (EF-G) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: EF-G C-terminal domain-like
family: EF-G/eEF-2 domains III and V
domain: Elongation factor G (EF-G)
species: Thermus thermophilus [TaxId: 274]

Probab=99.87  E-value=2e-22  Score=138.59  Aligned_cols=88  Identities=35%  Similarity=0.659  Sum_probs=84.1

Q ss_pred             eeeeeeEEEEEEecCCchhhHHHHHhhcCceeeeeeecCCeEEEEEeecchhhcchhhhhhhhccceEEeeeeecceeec
Q psy11837         40 ILLEPYMYLEIISDEQYVHGILADLSRRRADIRSVEDRGSSKVIIAEAPLSELLGYCQRVRTLSSGRSHFSMEFLCFKQV  119 (192)
Q Consensus        40 ~l~EPv~~v~I~vp~~~~g~V~~~l~~rrg~i~~~~~~~~~~~i~~~vP~~~~~~~~~~L~s~T~G~g~~~~~~~~y~~~  119 (192)
                      +++||+++++|.+|+++.|.|+++|++|||.+.++...++...|++.+|+++++||..+||+.|+|+|.|+++|+||+++
T Consensus         1 VllEPi~~~~I~~p~e~~g~v~~~l~~rrg~i~~~~~~~~~~~i~a~iP~~e~~g~~~~Lrs~T~G~g~~~~~f~~y~~v   80 (89)
T d2bv3a5           1 VILEPIMRVEVTTPEEYMGDVIGDLNARRGQILGMEPRGNAQVIRAFVPLAEMFGYATDLRSKTQGRGSFVMFFDHYQEV   80 (89)
T ss_dssp             EEEEEEEEEEEEEEGGGHHHHHHHHHTTTCEEEEEEEETTEEEEEEEEEGGGCTTHHHHHHHTTTTCCEEEEEEEEEEEC
T ss_pred             CEECcEEEEEEEECHHHHHHHHHHHHHcCCccccCCcccccEEEEEECCHHHHhhHHHhhhhcCCCCEEEEEEecCcccC
Confidence            47999999999999999999999999999999999888889999999999999999999999999999999999999999


Q ss_pred             CchHHHHH
Q psy11837        120 SSQNEAQA  127 (192)
Q Consensus       120 p~~~~~~i  127 (192)
                      |++.++++
T Consensus        81 p~~~~~~i   88 (89)
T d2bv3a5          81 PKQVQEKL   88 (89)
T ss_dssp             CHHHHHHC
T ss_pred             CHhHHhcc
Confidence            99887664
>d2dy1a5 d.58.11.1 (A:570-665) Elongation factor G (EF-G) {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1n0ua5 d.58.11.1 (A:726-842) Elongation factor 2 (eEF-2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dy1a5 d.58.11.1 (A:570-665) Elongation factor G (EF-G) {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d2bv3a5 d.58.11.1 (A:600-688) Elongation factor G (EF-G) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1n0ua5 d.58.11.1 (A:726-842) Elongation factor 2 (eEF-2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dy1a3 d.14.1.1 (A:455-569) Elongation factor G (EF-G), domain IV {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d2bv3a3 d.14.1.1 (A:479-599) Elongation factor G (EF-G), domain IV {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vi7a2 d.58.11.2 (A:138-208) Hypothetical protein YigZ, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n0ua3 d.14.1.1 (A:561-725) Elongation factor 2 (eEF-2), domain IV {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t95a3 d.58.11.3 (A:162-234) Hypothetical protein AF0491, C-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2dy1a3 d.14.1.1 (A:455-569) Elongation factor G (EF-G), domain IV {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1vi7a2 d.58.11.2 (A:138-208) Hypothetical protein YigZ, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nh8a2 d.58.5.3 (A:211-284) ATP phosphoribosyltransferase (ATP-PRTase, HisG), regulatory C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure