Psyllid ID: psy11980


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-
MRKLAVPRTNPYLFGIKSAPGGNRTRGLLNEDDAVGEKTVPGHLCKGCYRIFTSQGYMLLSYKSKEEEKQICTYIKVCGRVFNRKDNLREHLRAHAGETKRKKKFKCDKCEKQFYGLTLLRIHERLHAEKLYECDICKNRFPSSGAMKKHRRKHTGERPYECKEVCGRVFNRKDNLREHLRAHAGETKRKKKFKCDKCEKQFYGLTLLRIHERLHGLIERTCYARFAAKETLNRHMKTHSGVKPHVCEYCEKAFIQASQLKAHMFHHTGENGHTCELCNKTFNRKARLELHMKYIHEGADPYQCDICRKTFIRKEDLTRHCLLHTGVKPHKCPICTKGFTMKSSLKIHLLTHTKEPPKSCEVCGRAFIRQDCLIRHLRQKHRSHLDEVLAQGDKKKLEAQLLAAAATELTSVLEDGEEEGDEGEENLLRCSKCKVTFYCSKQHQTLDWKAHKINCNILSNQSATNNTSLANNTPQVAQIQNQFPLSNQYFHEGSSENEIANSTVQYLNPSLFQNNTPNQLVDTAGTSRAPGPSNMNTQYGLYSDIPILNENNGQNNLTNMHLDTNVVVVPPFHHTNNDRVHSDIMIEKMCHNVIRDMDQYGLCVLDDFLGPERDMHLDTNVVVVPPFHHTNNDRVHSDMIENVIRDMDQYGLCVVDNFLGPERGMAVLHEVLGMYHSGVFKDGQLVSNKSTNKQDLKTIRGDQITWIDGRETYCSNIGRLISEVDAIIMRANRMVNNGRMGDFVINGRTKQNGGLLRIFPEGGGDKVADIEPMFDRILFFWSDRRNPHEAMVACYPGHGSHYVKHVDNPNRDGRCITAIYYLNRDWDIKVS
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccHHHHccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccccccHHHHHHHHHHHHHHcccccccEEEcccccccccccccccEEEEcccccccccccHHHHHHHHHHHccccccEEEEcccccccHHHHHHHHHHHcccccccccEEEEcccccccccccccccEEEEEcccccccccHHHHHHHHHHHHHHccccccccccccEEEEccccccccEEEEcccccccccccccccccEEEEEEcccccccccEEEEEcccccccccccccccccccEEEEEEEEccccccccc
cccccccccccccccccccEEccccHHHHHEEEcccccccccEEcccccccEccccHHHHHHHccccccccccccccccccEccccHHHHHHHHcccccccccccEccccccEEccccHHHEHHHHcccccEEccccccEEccHHHHHHHHHHHHccccEEcccccccEEcccccHHHHEEEcccccccccccccccccccEccccHHHEHEcEccccccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHcccccEEccccccEEccHHHHHHHHHHHccccccEcccccccccccccccccEEcccccEHEHHHHcHcccccccccccHccHHHHHHHcHcHHcccccccEcccccccEEccccHHEEEEEccccccccccccccccccccccccccccccEEccccHHHHHHHHcccccccEccccccccccccccccccHHHHHHHccccccccccccccEEEccccccccccccHHHHHHHHHHHHHHHHHHHcccEEEHccccccccccccccEEEEccccccccccccHHHHHHHHHHHHHcccEEEEcccccHHcHHHHHHHHcHHcccccccccEEEcccccccccHcccccEEEEEccccccccHHHHHHHHHHHHHHHHHHHHcccccccEEEEccccccccEEEEccccccccccccccHHHHEEEEEccccccccEEEEEcccccccEEEEcccccccccEEEEEEEEcccccEEEc
mrklavprtnpylfgiksapggnrtrgllneddavgektvpghlckgcyriFTSQGymllsykskEEEKQICTYIKVCGRVFNRKDNLREHLRAHAgetkrkkkfkcdkcekqfyGLTLLRIHERLHaeklyecdicknrfpssgamkkhrrkhtgerpyeckevCGRVFNRKDNLREHLRAHAgetkrkkkfkcdkcekqfygLTLLRIHERLHGLIERTCYARFAAKETLNRHmkthsgvkphvCEYCEKAFIQASQLKAHmfhhtgenghtceLCNKTFNRKARLELHMKYIhegadpyqcdicrktfirkedltrhcllhtgvkphkcpictkgftmksSLKIHLLthtkeppkscevcgrafirqdCLIRHLRQKHRSHLDEVLAQGDKKKLEAQLLAAAATELTSVledgeeegdegeenllrcskckvtfycskqhqtldwkahkincnilsnqsatnntslanntpqvaqiqnqfplsnqyfhegsseneiANSTvqylnpslfqnntpnqlvdtagtsrapgpsnmntqyglysdipilnenngqnnltnmhldtnvvvvppfhhtnndrvhsDIMIEKMCHNVIRDmdqyglcvlddflgperdmhldtnvvvvppfhhtnndrvhSDMIENVIRDMdqyglcvvdnflgpergMAVLHEVLGMyhsgvfkdgqlvsnkstnkqdlktirgdqitwidgrETYCSNIGRLISEVDAIIMRANRMvnngrmgdfvingrtkqnggllrifpegggdkvadiePMFDRILFFwsdrrnpheamvacypghgshyvkhvdnpnrdgrcITAIYYLnrdwdikvs
mrklavprtnpylfgiksapggnrtRGLLNEDDAVgektvpghlckgCYRIFTSQGYMLLSYKSKEEEKQICTYIKVCGRVFNRKDNLREHLrahagetkrkkkfkcdkceKQFYGLTLLRIHERLHAEKLYECDIcknrfpssgamkkhrrkhtgerpyeckevcgrvfnrkdnLREHlrahagetkrkkkfkcdkceKQFYGLTLLRIHERLHGLIERTCYARFAAKETLNRHMKTHSGVKPHVCEYCEKAFIQASQLKAHMFHHTGENGHTCELCNKTFNRKARLELHMKYIhegadpyqCDICRKTFIRKEDLTRhcllhtgvkphkcpicTKGFTMKSSLKIHLLThtkeppksceVCGRAFIRQDCLIRHLRQKHRSHLDEVLAQGDKKKLEAQLLAAAATELTSVLEDGEEEGDEGEENLLRCSKCKVTFYCSKQHQTLDWKAHKINCNILSNQSATNNTSLANNTPQVAQIQNQFPLSNQYFHEGSSENEIANSTVQYLNPSLFQNNTPNQLVDTAGTSRAPGPSNMNTQYGLYSDIPILNENNGQNNLTNMHLDTNVVVVPPFHHTNNDRVHSDIMIEKMCHNVIRDMDQYGLCVLDDFLGPERDMHLDTNVVVVPPFHHTNNDRVHSDMIENVIRDMDQYGLCVVDNFLGPERGMAVLHEVLGMYHSGVfkdgqlvsnkstnkqdlktirgdqitwidgrETYCSNIGRLISEVDAIIMRANRMVNNGRMGDFVINGRTKQNGGLLRIFPEGGGDKVADIEPMFDRILFFWSDRRNPHEAMVACYPGHGSHYVKHVDNPNRDGRCITAIyylnrdwdikvs
MRKLAVPRTNPYLFGIKSAPGGNRTRGLLNEDDAVGEKTVPGHLCKGCYRIFTSQGYMLLSYKSKEEEKQICTYIKVCGRVFNRKDNLREHLRAHAGETkrkkkfkcdkcekQFYGLTLLRIHERLHAEKLYECDICKNRFPSSGAMKKHRRKHTGERPYECKEVCGRVFNRKDNLREHLRAHAGETkrkkkfkcdkcekQFYGLTLLRIHERLHGLIERTCYARFAAKETLNRHMKTHSGVKPHVCEYCEKAFIQASQLKAHMFHHTGENGHTCELCNKTFNRKARLELHMKYIHEGADPYQCDICRKTFIRKEDLTRHCLLHTGVKPHKCPICTKGFTMKSSLKIHLLTHTKEPPKSCEVCGRAFIRQDCLIRHLRQKHRSHLDEVLAQGDKKKleaqllaaaateltSVLedgeeegdegeeNLLRCSKCKVTFYCSKQHQTLDWKAHKINCNIlsnqsatnntslanntPQVAQIQNQFPLSNQYFHEGSSENEIANSTVQYLNPSLFQNNTPNQLVDTAGTSRAPGPSNMNTQYGLYSDIPILnenngqnnltnMHLDTNVVVVPPFHHTNNDRVHSDIMIEKMCHNVIRDMDQYGLCVLDDFLGPERDMHLDTNVVVVPPFHHTNNDRVHSDMIENVIRDMDQYGLCVVDNFLGPERGMAVLHEVLGMYHSGVFKDGQLVSNKSTNKQDLKTIRGDQITWIDGRETYCSNIGRLISEVDAIIMRANRMVNNGRMGDFVINGRTKQNGGLLRIFPEGGGDKVADIEPMFDRILFFWSDRRNPHEAMVACYPGHGSHYVKHVDNPNRDGRCITAIYYLNRDWDIKVS
***********YLFGI****************DAVGEKTVPGHLCKGCYRIFTSQGYMLLSYKSKEEEKQICTYIKVCGRVFNRKDNLREHLRAHA*****KKKFKCDKCEKQFYGLTLLRIHERLHAEKLYECDICKNRF******************YECKEVCGRVFNRKDNLR**L**********KKFKCDKCEKQFYGLTLLRIHERLHGLIERTCYARFAAKETLNRHMKTHSGVKPHVCEYCEKAFIQASQLKAHMFHHTGENGHTCELCNKTFNRKARLELHMKYIHEGADPYQCDICRKTFIRKEDLTRHCLLHTGVKPHKCPICTKGFTMKSSLKIHLLTHTKEPPKSCEVCGRAFIRQDCLIRHLRQKHRSHLDEVL***********LLA***********************LLRCSKCKVTFYCSKQHQTLDWKAHKINCNILS******************************************************************************QYGLYSDIPILNENNGQNNLTNMHLDTNVVVVPPFHHTNNDRVHSDIMIEKMCHNVIRDMDQYGLCVLDDFLGPERDMHLDTNVVVVPPFHHTNNDRVHSDMIENVIRDMDQYGLCVVDNFLGPERGMAVLHEVLGMYHSGVFKDGQLVS*******DLKTIRGDQITWIDGRETYCSNIGRLISEVDAIIMRANRMVNNGRMGDFVINGRTKQNGGLLRIFPEGGGDKVADIEPMFDRILFFWSDRRNPHEAMVACYPGHGSHYVKHVDNPNRDGRCITAIYYLNRDWDI***
MRKLAVPRTNPYLFGIKSAPGGNRTRGLLNEDDAVGEKTVPGHLCKGCYRIFTSQGYMLLSYKSKEEEKQICTYIKVCGRVFNRKDNLREHLRAHAGETKRKKKFKCDKCEKQFYGLTLLRIHERLHAEKLYECDICKNRFPSSGAMKKHRRKHTGERPYECKEVCGRVFNRKDNLREHLRAHAGETKRKKKFKCDKCEKQFYGLTLLRIHERLHGLIERTCYARFAAKETLNRHMKTHSGVKPHVCEYCEKAFIQASQLKAHMFHHTGENGHTCELCNKTFNRKARLELHMKYIHEGADPYQCDICRKTFIRKEDLTRHCLLHTGVKPHKCPICTKGFTMKSSLKIHLLTHTKEPPKSCEVCGRAFIRQDCLIRHLRQKHRSHLDEVLAQGDKKKLEAQLLAAAATELTSVLEDGEEEGDEGEENLLRCSKCKVTFYCSKQHQTLDWKAHKINCNILSNQSATNNTSLANNTPQVAQIQNQFPLSNQYFHEGSSENEIANSTVQYLNPSLFQNNTPNQL***************NTQYGLYSDIPILNENNGQNNLTNMHLDTNVVVVPPFHHTNNDRVHSDIMIEKMCHNVIRDMDQYGLCVLDDFLGPERDMHLDTNVVVVPPFHHTNNDRVHSDMIENVIRDMDQYGLCVVDNFLGPERGMAVLHEVLGMYHSGVFKDGQL************TIRGDQITWIDGRETYCSNIGRLISEVDAIIMRANRMVNNGRMGDFVINGRTKQNGGLLRIFPEGGGDKVADIEPMFDRILFFWSDRRNPHEAMVACYPGHGSHYVKHVDNPNRDGRCITAIYYLNRDWDIKV*
MRKLAVPRTNPYLFGIKSAPGGNRTRGLLNEDDAVGEKTVPGHLCKGCYRIFTSQGYMLLSYKSKEEEKQICTYIKVCGRVFNRKDNLREHLRAHA*********KCDKCEKQFYGLTLLRIHERLHAEKLYECDICKNRFPSS**************PYECKEVCGRVFNRKDNLREHLRAHA*********KCDKCEKQFYGLTLLRIHERLHGLIERTCYARFAAKETLNRHMKTHSGVKPHVCEYCEKAFIQASQLKAHMFHHTGENGHTCELCNKTFNRKARLELHMKYIHEGADPYQCDICRKTFIRKEDLTRHCLLHTGVKPHKCPICTKGFTMKSSLKIHLLTHTKEPPKSCEVCGRAFIRQDCLIRHLRQKHRSHLDEVLAQGDKKKLEAQLLAAAATELTSVL************NLLRCSKCKVTFYCSKQHQTLDWKAHKINCNILSNQSATNNTSLANNTPQVAQIQNQFPLSNQYFHEGSSENEIANSTVQYLNPSLFQNNTPNQLVDTAGTSRAPGPSNMNTQYGLYSDIPILNENNGQNNLTNMHLDTNVVVVPPFHHTNNDRVHSDIMIEKMCHNVIRDMDQYGLCVLDDFLGPERDMHLDTNVVVVPPFHHTNNDRVHSDMIENVIRDMDQYGLCVVDNFLGPERGMAVLHEVLGMYHSGVFKDGQLVSNKSTNKQDLKTIRGDQITWIDGRETYCSNIGRLISEVDAIIMRANRMVNNGRMGDFVINGRTKQNGGLLRIFPEGGGDKVADIEPMFDRILFFWSDRRNPHEAMVACYPGHGSHYVKHVDNPNRDGRCITAIYYLNRDWDIKVS
*****VPRTNPYLFGIKSAPGGNRTRGLLNEDDAVGEKTVPGHLCKGCYRIFTSQGYMLLSYKSKEEEKQICTYIKVCGRVFNRKDNLREHLRAHAGETKRKKKFKCDKCEKQFYGLTLLRIHERLHAEKLYECDICKNRFPSSGAMKKHRRKHTGERPYECKEVCGRVFNRKDNLREHLRAHAGETKRKKKFKCDKCEKQFYGLTLLRIHERLHGLIERTCYARFAAKETLNRHMKTHSGVKPHVCEYCEKAFIQASQLKAHMFHHTGENGHTCELCNKTFNRKARLELHMKYIHEGADPYQCDICRKTFIRKEDLTRHCLLHTGVKPHKCPICTKGFTMKSSLKIHLLTHTKEPPKSCEVCGRAFIRQDCLIRHLRQKHRSHLDEVLAQGDKKKLEAQLLAAAATELTSVLEDGEEEGDEGEENLLRCSKCKVTFYCSKQHQTLDWKAHKINCNILSNQSATNNTSLANNTPQVAQIQNQFPLSNQYFHEGSSENEIANSTVQYLNPSLFQNNTPNQLVDTAGTSRAPGPSNMNTQYGLYSDIPILNENNGQNNLTNMHLDTNVVVVPPFHHTNNDRVHSDIMIEKMCHNVIRDMDQYGLCVLDDFLGPERDMHLDTNVVVVPPFHHTNNDRVHSDMIENVIRDMDQYGLCVVDNFLGPERGMAVLHEVLGMYHSGVFKDGQLVSNKSTNKQDLKTIRGDQITWIDGRETYCSNIGRLISEVDAIIMRANRMVNNGRMGDFVINGRTKQNGGLLRIFPEGGGDKVADIEPMFDRILFFWSDRRNPHEAMVACYPGHGSHYVKHVDNPNRDGRCITAIYYLNRDWDIKVS
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRKLAVPRTNPYLFGIKSAPGGNRTRGLLNEDDAVGEKTVPGHLCKGCYRIFTSQGYMLLSYKSKEEEKQICTYIKVCGRVFNRKDNLREHLRAHAGETKRKKKFKCDKCEKQFYGLTLLRIHERLHAEKLYECDICKNRFPSSGAMKKHRRKHTGERPYECKEVCGRVFNRKDNLREHLRAHAGETKRKKKFKCDKCEKQFYGLTLLRIHERLHGLIERTCYARFAAKETLNRHMKTHSGVKPHVCEYCEKAFIQASQLKAHMFHHTGENGHTCELCNKTFNRKARLELHMKYIHEGADPYQCDICRKTFIRKEDLTRHCLLHTGVKPHKCPICTKGFTMKSSLKIHLLTHTKEPPKSCEVCGRAFIRQDCLIRHLRQKHRSHLDEVLAQGDKKKLEAQLLAAAATELTSVLEDGEEEGDEGEENLLRCSKCKVTFYCSKQHQTLDWKAHKINCNILSNQSATNNTSLANNTPQVAQIQNQFPLSNQYFHEGSSENEIANSTVQYLNPSLFQNNTPNQLVDTAGTSRAPGPSNMNTQYGLYSDIPILNENNGQNNLTNMHLDTNVVVVPPFHHTNNDRVHSDIMIEKMCHNVIRDMDQYGLCVLDDFLGPERDMHLDTNVVVVPPFHHTNNDRVHSDMIENVIRDMDQYGLCVVDNFLGPERGMAVLHEVLGMYHSGVFKDGQLVSNKSTNKQDLKTIRGDQITWIDGRETYCSNIGRLISEVDAIIMRANRMVNNGRMGDFVINGRTKQNGGLLRIFPEGGGDKVADIEPMFDRILFFWSDRRNPHEAMVACYPGHGSHYVKHVDNPNRDGRCITAIYYLNRDWDIKVS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query831 2.2.26 [Sep-21-2011]
A0JNB1787 Zinc finger protein 227 O no N/A 0.411 0.434 0.370 5e-58
Q6ZMW2699 Zinc finger protein 782 O yes N/A 0.350 0.416 0.411 2e-57
P10076861 Zinc finger protein 26 OS no N/A 0.388 0.375 0.385 7e-57
Q3ZCX4644 Zinc finger protein 568 O no N/A 0.350 0.451 0.411 8e-57
Q86WZ6799 Zinc finger protein 227 O no N/A 0.387 0.403 0.380 9e-57
Q0VAW7879 Zinc finger protein 112 O no N/A 0.389 0.368 0.372 3e-56
Q9UJU3913 Zinc finger protein 112 O no N/A 0.413 0.376 0.359 3e-55
Q8IYB9648 Zinc finger protein 595 O no N/A 0.347 0.445 0.417 5e-55
A2T812754 Zinc finger protein 287 O N/A N/A 0.350 0.385 0.401 6e-55
Q9HBT7754 Zinc finger protein 287 O no N/A 0.350 0.385 0.401 7e-55
>sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 Back     alignment and function desciption
 Score =  226 bits (576), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 134/362 (37%), Positives = 188/362 (51%), Gaps = 20/362 (5%)

Query: 22  GNRTRGLLNEDDAVGEKTVPGHLCKGCYRIFTSQGYMLLSYKSKEEEKQICTYIKVCGRV 81
           G+ T  +++     GEK    + C+ C + F+         +   EEK      + CG+ 
Sbjct: 322 GSSTGLIIHYRTHTGEKP---YRCEACGKCFSQSSNFQCHQRVHTEEKPY--KCEECGKG 376

Query: 82  FNRKDNLREHLRAHAGETKRKKKFKCDKCEKQFYGLTLLRIHERLH-AEKLYECDICKNR 140
           F    NLR H R H GE    K +KC++C K F       IH+R+H  EK Y+CD+C   
Sbjct: 377 FGWSVNLRVHQRVHRGE----KPYKCEECGKGFTQAAHYHIHQRVHTGEKPYKCDVCGKG 432

Query: 141 FPSSGAMKKHRRKHTGERPYECKEVCGRVFNRKDNLREHLRAHAGETKRKKKFKCDKCEK 200
           F  +  +  HRR HTGE+PY C E CG+ F R  +L  H R H GE    K + C +C K
Sbjct: 433 FSHNSPLICHRRVHTGEKPYRC-EACGKGFTRNTDLHIHFRVHTGE----KPYTCKECGK 487

Query: 201 QFYGLTLLRIHERLHGLIER----TCYARFAAKETLNRHMKTHSGVKPHVCEYCEKAFIQ 256
            F   + L++H+ +H   +R    TC   F+    L  H + H+G KP+ C+ C K F  
Sbjct: 488 GFSQASNLQVHQNVHTGEKRFKCETCGKGFSQSSKLQTHQRVHTGEKPYRCDVCGKDFSY 547

Query: 257 ASQLKAHMFHHTGENGHTCELCNKTFNRKARLELHMKYIHEGADPYQCDICRKTFIRKED 316
           +S LK H   HTGE  +TCE C K F+ ++ L  H + +H G  PY+C+ C K+F +  D
Sbjct: 548 SSNLKLHQVIHTGEKPYTCEACGKGFSWRSNLHAHQR-VHSGEKPYKCEACDKSFSQAID 606

Query: 317 LTRHCLLHTGVKPHKCPICTKGFTMKSSLKIHLLTHTKEPPKSCEVCGRAFIRQDCLIRH 376
              H  +HTG KP+KC +C KGF+  S L+ H   HT E P  C+VCG+ F      I H
Sbjct: 607 FRVHQRVHTGEKPYKCGVCGKGFSQSSGLQSHQRVHTGEKPYKCDVCGKGFRYSSQFIYH 666

Query: 377 LR 378
            R
Sbjct: 667 QR 668




May be involved in transcriptional regulation.
Bos taurus (taxid: 9913)
>sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 Back     alignment and function description
>sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 Back     alignment and function description
>sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 Back     alignment and function description
>sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=2 SV=1 Back     alignment and function description
>sp|Q0VAW7|ZN112_MOUSE Zinc finger protein 112 OS=Mus musculus GN=Znf112 PE=2 SV=2 Back     alignment and function description
>sp|Q9UJU3|ZN112_HUMAN Zinc finger protein 112 OS=Homo sapiens GN=ZNF112 PE=2 SV=2 Back     alignment and function description
>sp|Q8IYB9|ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens GN=ZNF595 PE=2 SV=1 Back     alignment and function description
>sp|A2T812|ZN287_PONPY Zinc finger protein 287 OS=Pongo pygmaeus GN=ZNF287 PE=3 SV=1 Back     alignment and function description
>sp|Q9HBT7|ZN287_HUMAN Zinc finger protein 287 OS=Homo sapiens GN=ZNF287 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query831
193582612655 PREDICTED: zinc finger protein 91-like i 0.413 0.525 0.468 1e-91
189239429682 PREDICTED: similar to AGAP003111-PA [Tri 0.389 0.475 0.474 4e-85
242018590519 zinc finger protein, putative [Pediculus 0.357 0.572 0.453 7e-80
383854291624 PREDICTED: protein suppressor of hairy w 0.350 0.466 0.477 2e-77
340714198643 PREDICTED: protein suppressor of hairy w 0.393 0.508 0.461 1e-76
350417428639 PREDICTED: protein suppressor of hairy w 0.393 0.511 0.461 2e-76
380025357639 PREDICTED: zinc finger protein 808-like 0.364 0.474 0.454 2e-76
66508951627 PREDICTED: protein suppressor of hairy w 0.363 0.481 0.452 3e-76
427783301717 Putative gonadotropin inducible transcri 0.341 0.396 0.475 6e-76
427792191593 Putative gonadotropin inducible transcri 0.341 0.478 0.475 1e-75
>gi|193582612|ref|XP_001944230.1| PREDICTED: zinc finger protein 91-like isoform 1 [Acyrthosiphon pisum] gi|328723343|ref|XP_003247820.1| PREDICTED: zinc finger protein 91-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  344 bits (882), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 186/397 (46%), Positives = 241/397 (60%), Gaps = 53/397 (13%)

Query: 78  CGRVFNRKDNLREH-LRAHAGETKRKKKFKCDKCEKQFYGLTLLRIHERLHAEKL--YEC 134
           CG  F  K N+  H L  H  +        C  C+        L  H   HA  L  Y C
Sbjct: 157 CGNFFKLKVNMERHQLMVHCYD----DILNCPTCDFNCKDKETLSQHLYAHAGTLKPYSC 212

Query: 135 DICKNRFPSSGAMKKHRRKHTG----ERPYECKEVCGRVFNRKDNLREHLRAHAGETKRK 190
            +C   F     + +H  + TG    E+P    +VCG+VFNRKDNLREHLRAHAG+TK+K
Sbjct: 213 PVCFTSFSRKYHLVRHNMQ-TGCDGSEKPKFPCQVCGKVFNRKDNLREHLRAHAGQTKKK 271

Query: 191 KKFKCDKCEKQFYGLTLLRIHERLH------------------GLIER------------ 220
           + + C+ C K+F G  LL +H R H                  G +++            
Sbjct: 272 RTYNCEYCNKEFVGSALLTVHRRSHLGYRPYQCDLCVKRFPSSGAMKKHRRIHTGERPYE 331

Query: 221 --TCYARFAAKETLNRHMKTHSGVKPHVCEYCEKAFIQASQLKAHMFHHTGENGHTCELC 278
              C+A+FAAKETLNRH+KTH+ +KPH CE+C K FIQ SQL+AH+FHHTGENG TC++C
Sbjct: 332 CQQCFAKFAAKETLNRHIKTHTALKPHSCEFCGKTFIQISQLRAHLFHHTGENGFTCDIC 391

Query: 279 NKTFNRKARLELHMKYIHEGADPYQCDICRKTFIRKEDLTRHCLLHTGVKPHKCPICTKG 338
            K+FNR++RL LH +YIHEGA P+ C +C K  +RKED+ RH ++H+G+K H CPIC K 
Sbjct: 392 GKSFNRRSRLTLHTRYIHEGAQPFMCTVCNKALLRKEDVQRHNIVHSGIKAHACPICDKR 451

Query: 339 FTMKSSLKIHLLTHTKEPPKSCEVCGRAFIRQDCLIRHLRQKHRSHLDEVLAQGDKKKLE 398
           F MKSSLKIHLLTHTKEPP++C+ CGRAFIRQDCL+RH+R KHR  L E++A  +KKKLE
Sbjct: 452 FAMKSSLKIHLLTHTKEPPRACDECGRAFIRQDCLLRHMRSKHRDMLAEIMADAEKKKLE 511

Query: 399 AQLLAAA---------ATELTSVLEDGEEEGDEGEEN 426
           AQL             + E+ +  E  +E  DE E+N
Sbjct: 512 AQLSGVGKKDKNDQNDSDEIDNDREGDDESIDELEDN 548




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|189239429|ref|XP_974808.2| PREDICTED: similar to AGAP003111-PA [Tribolium castaneum] gi|270009621|gb|EFA06069.1| hypothetical protein TcasGA2_TC008904 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|242018590|ref|XP_002429757.1| zinc finger protein, putative [Pediculus humanus corporis] gi|212514769|gb|EEB17019.1| zinc finger protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|383854291|ref|XP_003702655.1| PREDICTED: protein suppressor of hairy wing-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|340714198|ref|XP_003395618.1| PREDICTED: protein suppressor of hairy wing-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350417428|ref|XP_003491418.1| PREDICTED: protein suppressor of hairy wing-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|380025357|ref|XP_003696441.1| PREDICTED: zinc finger protein 808-like [Apis florea] Back     alignment and taxonomy information
>gi|66508951|ref|XP_397205.2| PREDICTED: protein suppressor of hairy wing [Apis mellifera] Back     alignment and taxonomy information
>gi|427783301|gb|JAA57102.1| Putative gonadotropin inducible transcription factor gonadotropin inducible transcription factor [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|427792191|gb|JAA61547.1| Putative gonadotropin inducible transcription factor gonadotropin inducible transcription factor, partial [Rhipicephalus pulchellus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query831
RGD|1587759669 LOC687219 "similar to zinc fin 0.393 0.488 0.377 9.9e-58
UNIPROTKB|I3LQ98462 ZFP2 "Uncharacterized protein" 0.350 0.629 0.388 2.9e-55
UNIPROTKB|F1MX341053 F1MX34 "Uncharacterized protei 0.407 0.321 0.373 7.1e-55
UNIPROTKB|E1BKB3606 ZNF568 "Uncharacterized protei 0.383 0.526 0.369 1.3e-54
UNIPROTKB|E1BMX9674 ZNF605 "Uncharacterized protei 0.424 0.523 0.343 1.4e-54
UNIPROTKB|F1RI74675 ZNF605 "Uncharacterized protei 0.393 0.484 0.354 1.8e-54
UNIPROTKB|F1M3Z8629 F1M3Z8 "Uncharacterized protei 0.418 0.553 0.364 2.6e-54
ZFIN|ZDB-GENE-120703-48448 si:dkey-8o9.5 "si:dkey-8o9.5" 0.369 0.685 0.359 2.9e-54
UNIPROTKB|A0JNB1787 ZNF227 "Zinc finger protein 22 0.410 0.433 0.349 3.4e-54
ZFIN|ZDB-GENE-110913-164572 si:dkey-257e4.5 "si:dkey-257e4 0.389 0.566 0.347 3.7e-54
RGD|1587759 LOC687219 "similar to zinc finger protein 84 (HPF2)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
 Score = 572 (206.4 bits), Expect = 9.9e-58, Sum P(2) = 9.9e-58
 Identities = 132/350 (37%), Positives = 173/350 (49%)

Query:    45 CKGCYRIFTSQGYMLLSYKSKEEEKQICTYIKVCGRVFNRKDNLREHLRAHAGETXXXXX 104
             C  C + F  + Y L+ ++S+   ++       C + F  K +L  H   H+GE      
Sbjct:   303 CVECSKTFYCKSY-LIRHQSRTHSREKPYECTECTKTFYCKSDLTRHQTTHSGEKPFECN 361

Query:   105 XXXXXXXXQFYGLTLLRIHERLHAE-KLYECDICKNRFPSSGAMKKHRRKHTGERPYECK 163
                      FY  + L  H++ H +   YEC  C+  F S  ++ +H R HTGE+PYEC 
Sbjct:   362 ECSKT----FYYKSDLANHQKTHTDDNPYECKECRKTFCSKSSLNQHHRIHTGEKPYECN 417

Query:   164 EVCGRVFNRKDNLREHLR-AHAGETXXXXXXXXXXXXXQFYGLTLLRIHERLHGLIER-- 220
             E C + FN K NL EH R  H  E               FY  + L  H+R H  +ER  
Sbjct:   418 E-CKKSFNSKSNLTEHQRRTHTREKPYECSECWKS----FYCRSELTNHQRTH-TVERFY 471

Query:   221 ---TCYARFAAKETLNRHMKTHSGVKPHVCEYCEKAFIQASQLKAHMFHHTGENGHTCEL 277
                 C   F  K  LN+H +TH+G KP+ C+ C KAF   S L  H   HTGE    C+ 
Sbjct:   472 ECKECRKNFYCKSNLNQHQRTHTGEKPYECKDCNKAFYCKSNLNQHQRTHTGEKPFACKD 531

Query:   278 CNKTFNRKARLELHMKYIHEGADPYQCDICRKTFIRKEDLTRHCLLHTGVKPHKCPICTK 337
             C+K F  K+ L  H K IH G  PY+C+ CRKTF +K DLTRH   HTG KP++C  C+K
Sbjct:   532 CSKAFYCKSSLVKHQK-IHSGEKPYECEECRKTFFQKSDLTRHQRTHTGEKPYECTDCSK 590

Query:   338 GFTMKSSLKIHLLTHTKEPPKSCEVCGRAFIRQDCLIRHLRQKHRSHLDE 387
              F  KS+L  H  THT E P  CE C  AF  +  L  H     R+H DE
Sbjct:   591 TFYCKSNLNQHRRTHTHEKPYECEECREAFYSKSELTEH----QRTHTDE 636


GO:0003676 "nucleic acid binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
UNIPROTKB|I3LQ98 ZFP2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1MX34 F1MX34 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E1BKB3 ZNF568 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E1BMX9 ZNF605 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1RI74 ZNF605 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1M3Z8 F1M3Z8 "Uncharacterized protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-120703-48 si:dkey-8o9.5 "si:dkey-8o9.5" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|A0JNB1 ZNF227 "Zinc finger protein 227" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-164 si:dkey-257e4.5 "si:dkey-257e4.5" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.14.11LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query831
smart00702165 smart00702, P4Hc, Prolyl 4-hydroxylase alpha subun 6e-10
pfam0175339 pfam01753, zf-MYND, MYND finger 6e-09
PHA00733128 PHA00733, PHA00733, hypothetical protein 7e-06
COG5048467 COG5048, COG5048, FOG: Zn-finger [General function 1e-05
pfam1346526 pfam13465, zf-H2C2_2, Zinc-finger double domain 2e-04
COG5048467 COG5048, COG5048, FOG: Zn-finger [General function 4e-04
COG5048467 COG5048, COG5048, FOG: Zn-finger [General function 0.001
pfam1346526 pfam13465, zf-H2C2_2, Zinc-finger double domain 0.001
pfam1364093 pfam13640, 2OG-FeII_Oxy_3, 2OG-Fe(II) oxygenase su 0.001
pfam1346526 pfam13465, zf-H2C2_2, Zinc-finger double domain 0.002
COG3751252 COG3751, EGL-9, Predicted proline hydroxylase [Pos 0.002
smart00702165 smart00702, P4Hc, Prolyl 4-hydroxylase alpha subun 0.003
>gnl|CDD|214780 smart00702, P4Hc, Prolyl 4-hydroxylase alpha subunit homologues Back     alignment and domain information
 Score = 58.6 bits (142), Expect = 6e-10
 Identities = 27/111 (24%), Positives = 39/111 (35%), Gaps = 8/111 (7%)

Query: 715 SNIGRLISEVDAIIMRANRMVNNGRMGDFVINGRTKQNGGLLRIFPEGGGDKVAD-IEPM 773
           +   +L+ E + +  R   +       +       +Q+ G          D V + I   
Sbjct: 3   AECQKLLEEAEPLGWRG-EVTRGIGNPNETSQ--YRQSNGTW--LELLERDLVIERIRQR 57

Query: 774 FDRIL-FFWSDRRNPHEAMVACYPGHGSHYVKHVDNPNRDGRCITAIYYLN 823
               L        +  +A VA Y G G HY  HVDN     R  T I YLN
Sbjct: 58  LADFLGLLAGLPLSAEDAQVARY-GPGGHYGPHVDNFLYGDRIATFILYLN 107


Mammalian enzymes catalyse hydroxylation of collagen, for example. Prokaryotic enzymes might catalyse hydroxylation of antibiotic peptides. These are 2-oxoglutarate-dependent dioxygenases, requiring 2-oxoglutarate and dioxygen as cosubstrates and ferrous iron as a cofactor. Length = 165

>gnl|CDD|201954 pfam01753, zf-MYND, MYND finger Back     alignment and domain information
>gnl|CDD|177301 PHA00733, PHA00733, hypothetical protein Back     alignment and domain information
>gnl|CDD|227381 COG5048, COG5048, FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>gnl|CDD|222150 pfam13465, zf-H2C2_2, Zinc-finger double domain Back     alignment and domain information
>gnl|CDD|227381 COG5048, COG5048, FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>gnl|CDD|227381 COG5048, COG5048, FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>gnl|CDD|222150 pfam13465, zf-H2C2_2, Zinc-finger double domain Back     alignment and domain information
>gnl|CDD|222280 pfam13640, 2OG-FeII_Oxy_3, 2OG-Fe(II) oxygenase superfamily Back     alignment and domain information
>gnl|CDD|222150 pfam13465, zf-H2C2_2, Zinc-finger double domain Back     alignment and domain information
>gnl|CDD|226274 COG3751, EGL-9, Predicted proline hydroxylase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|214780 smart00702, P4Hc, Prolyl 4-hydroxylase alpha subunit homologues Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 831
KOG1074|consensus958 99.96
KOG3710|consensus280 99.94
KOG2462|consensus279 99.94
KOG3608|consensus467 99.93
KOG2462|consensus279 99.91
KOG1074|consensus958 99.91
KOG3608|consensus467 99.88
KOG3623|consensus1007 99.86
KOG3623|consensus1007 99.84
KOG3576|consensus267 99.62
KOG3576|consensus267 99.6
KOG3710|consensus280 99.56
COG3751252 EGL-9 Predicted proline hydroxylase [Posttranslati 99.29
PLN03086567 PRLI-interacting factor K; Provisional 99.25
PLN03086567 PRLI-interacting factor K; Provisional 99.06
PHA00733128 hypothetical protein 99.03
PHA00733128 hypothetical protein 98.87
KOG3993|consensus500 98.78
PHA0276855 hypothetical protein; Provisional 98.71
smart00702178 P4Hc Prolyl 4-hydroxylase alpha subunit homologues 98.67
KOG3993|consensus500 98.65
PHA0276855 hypothetical protein; Provisional 98.62
PRK05467226 Fe(II)-dependent oxygenase superfamily protein; Pr 98.46
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.34
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.24
PF13640100 2OG-FeII_Oxy_3: 2OG-Fe(II) oxygenase superfamily; 98.21
PHA0061644 hypothetical protein 98.02
PHA0073279 hypothetical protein 97.99
PHA0061644 hypothetical protein 97.95
COG3751252 EGL-9 Predicted proline hydroxylase [Posttranslati 97.95
PHA0073279 hypothetical protein 97.9
KOG3844|consensus 476 97.82
smart00702178 P4Hc Prolyl 4-hydroxylase alpha subunit homologues 97.69
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.62
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.53
KOG1146|consensus 1406 97.32
PRK05467226 Fe(II)-dependent oxygenase superfamily protein; Pr 97.17
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.11
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.07
PF1366170 2OG-FeII_Oxy_4: 2OG-Fe(II) oxygenase superfamily 97.06
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.05
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.04
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 96.94
COG5189423 SFP1 Putative transcriptional repressor regulating 96.94
KOG2231|consensus669 96.72
COG5189423 SFP1 Putative transcriptional repressor regulating 96.72
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 96.7
KOG2231|consensus669 96.62
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 96.59
PLN00052310 prolyl 4-hydroxylase; Provisional 96.5
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 96.35
KOG1146|consensus 1406 96.32
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.09
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 95.93
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 95.83
smart0035526 ZnF_C2H2 zinc finger. 95.41
PRK04860160 hypothetical protein; Provisional 95.3
COG5236493 Uncharacterized conserved protein, contains RING Z 95.28
smart0035526 ZnF_C2H2 zinc finger. 95.23
PF13640100 2OG-FeII_Oxy_3: 2OG-Fe(II) oxygenase superfamily; 95.06
PRK04860160 hypothetical protein; Provisional 94.77
COG5048467 FOG: Zn-finger [General function prediction only] 94.34
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 94.27
KOG2785|consensus390 93.8
KOG2785|consensus390 93.78
COG5048467 FOG: Zn-finger [General function prediction only] 93.6
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 93.48
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 93.46
KOG2482|consensus423 93.33
COG5236493 Uncharacterized conserved protein, contains RING Z 92.27
KOG2482|consensus423 92.25
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 91.27
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 90.57
COG3128229 PiuC Uncharacterized iron-regulated protein [Funct 89.71
KOG2893|consensus341 88.8
KOG2893|consensus341 88.6
PLN02997325 flavonol synthase 88.24
KOG4173|consensus253 87.57
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 87.25
TIGR02408277 ectoine_ThpD ectoine hydroxylase. Both ectoine and 87.02
PLN02704335 flavonol synthase 86.99
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 86.86
PLN02912348 oxidoreductase, 2OG-Fe(II) oxygenase family protei 85.95
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 85.15
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 84.66
KOG4173|consensus253 84.25
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 84.16
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 82.92
COG404965 Uncharacterized protein containing archaeal-type C 82.2
PLN02216357 protein SRG1 81.9
PLN02639337 oxidoreductase, 2OG-Fe(II) oxygenase family protei 81.82
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 81.54
PF0175337 zf-MYND: MYND finger; InterPro: IPR002893 Zinc fin 80.76
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 80.5
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 80.09
>KOG1074|consensus Back     alignment and domain information
Probab=99.96  E-value=6e-30  Score=283.07  Aligned_cols=243  Identities=26%  Similarity=0.479  Sum_probs=163.1

Q ss_pred             ccccCcCCCcCCChHHHHHHHHHhcCCCccccccccCccccCchhHHHHHhhhcCcccCCCccccC---cccccccCchh
Q psy11980        131 LYECDICKNRFPSSGAMKKHRRKHTGERPYECKEVCGRVFNRKDNLREHLRAHAGETKRKKKFKCD---KCEKQFYGLTL  207 (831)
Q Consensus       131 ~~~C~~C~k~F~~~~~L~~H~~~h~~~~~~~C~~~C~~~f~~~~~L~~H~~~h~~~~~~~~~~~C~---~C~k~f~~~~~  207 (831)
                      +.+|-+|.+.....+.|+.|.++|+||+||+|+ +||+.|.++.+|+.|+-.|.....-+.+|.|+   .|.+.|.+...
T Consensus       605 PNqCiiC~rVlSC~saLqmHyrtHtGERPFkCK-iCgRAFtTkGNLkaH~~vHka~p~~R~q~ScP~~~ic~~kftn~V~  683 (958)
T KOG1074|consen  605 PNQCIICLRVLSCPSALQMHYRTHTGERPFKCK-ICGRAFTTKGNLKAHMSVHKAKPPARVQFSCPSTFICQKKFTNAVT  683 (958)
T ss_pred             ccceeeeeecccchhhhhhhhhcccCcCccccc-cccchhccccchhhcccccccCccccccccCCchhhhccccccccc
Confidence            578999999999999999999999999999998 99999999999999999998877767889999   99999999999


Q ss_pred             hhhhhhhcccccccccccccchHHhhhhcccCCCCCccccccchhhhcChhhHHhhhhcc----------------cccC
Q psy11980        208 LRIHERLHGLIERTCYARFAAKETLNRHMKTHSGVKPHVCEYCEKAFIQASQLKAHMFHH----------------TGEN  271 (831)
Q Consensus       208 L~~H~~~h~~~c~~C~~~f~~~~~L~~H~~~h~~~k~~~C~~C~k~f~~~~~L~~H~~~H----------------~~~k  271 (831)
                      |..|+++|..--.--+-.-.  .         ...-.-+|..|.+.|.....+..++..|                +.+.
T Consensus       684 lpQhIriH~~~~~s~g~~a~--e---------~~~~adq~~~~qk~~~~a~~f~~~~se~~~~~s~~~~~~~~~t~t~~~  752 (958)
T KOG1074|consen  684 LPQHIRIHLGGQISNGGTAA--E---------GILAADQCSSCQKTFSDARSFSQQISEQPSPESEPDEQMDERTETEEL  752 (958)
T ss_pred             ccceEEeecCCCCCCCcccc--c---------ccchhcccchhhhcccccccchhhhhccCCcccCCccccccccccccc
Confidence            99999998621000000000  0         0000123444444444444444333322                2222


Q ss_pred             ----CccCcccccccccchHHHhhhh----------------------hcccCCCCc-cCcccccccCChhHHH----HH
Q psy11980        272 ----GHTCELCNKTFNRKARLELHMK----------------------YIHEGADPY-QCDICRKTFIRKEDLT----RH  320 (831)
Q Consensus       272 ----~~~C~~C~k~F~~~~~L~~H~~----------------------~~H~~~k~~-~C~~C~k~F~~~~~L~----~H  320 (831)
                          +..+..|+..+.....+..+-.                      ..++.+++. .+..|+..-...-...    .-
T Consensus       753 ~~tp~~~e~~~~~~~~~e~~i~~~g~te~asa~~~~vg~~s~~~~~~~~~~T~~k~~~~~~~~~~~~~~~v~~~pvl~~~  832 (958)
T KOG1074|consen  753 DVTPPPPENSCGRELEGEMAISVRGSTEEASANLDEVGTVSAAGEAGEEDDTSEKPTQASSFPGEILAPSVNMDPVLWNQ  832 (958)
T ss_pred             ccCCCccccccccccCcccccccccchhhhhcChhhhcCccccchhhhhcccCCCCcccccCCCcCCccccccCchhhcc
Confidence                3445555555544433332211                      123445555 5555554332221100    00


Q ss_pred             H--------------hhhcC------------------------CCCccCCCCCCccCChhHHHHHhhhccCCCCccccc
Q psy11980        321 C--------------LLHTG------------------------VKPHKCPICTKGFTMKSSLKIHLLTHTKEPPKSCEV  362 (831)
Q Consensus       321 ~--------------~~H~~------------------------~k~~~C~~C~k~F~~~~~L~~H~~~H~~~~py~C~~  362 (831)
                      .              .++.+                        ...+.|..|++.|...+.|..|+++|+++|||.|.+
T Consensus       833 ~~~~l~eg~~t~~n~~t~~~~~~sv~qs~~~p~l~p~l~~~~pvnn~h~C~vCgk~FsSSsALqiH~rTHtg~KPF~C~f  912 (958)
T KOG1074|consen  833 ETSMLNEGLATKTNEITPEGPADSVIQSGGVPTLEPSLGRPGPVNNAHVCNVCGKQFSSSAALEIHMRTHTGPKPFFCHF  912 (958)
T ss_pred             cccccccccccccccccCCCcchhhhhhccccccCCCCCCCCcccchhhhccchhcccchHHHHHhhhcCCCCCCccchh
Confidence            0              00000                        012789999999999999999999999999999999


Q ss_pred             ccccccChhHHHHHHHHhccCch
Q psy11980        363 CGRAFIRQDCLIRHLRQKHRSHL  385 (831)
Q Consensus       363 C~~~F~~~~~L~~H~r~~H~~~~  385 (831)
                      |++.|..+.+|+.||.+|+...+
T Consensus       913 C~~aFttrgnLKvHMgtH~w~q~  935 (958)
T KOG1074|consen  913 CEEAFTTRGNLKVHMGTHMWVQP  935 (958)
T ss_pred             hhhhhhhhhhhhhhhccccccCC
Confidence            99999999999999999887543



>KOG3710|consensus Back     alignment and domain information
>KOG2462|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG2462|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3710|consensus Back     alignment and domain information
>COG3751 EGL-9 Predicted proline hydroxylase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>smart00702 P4Hc Prolyl 4-hydroxylase alpha subunit homologues Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PRK05467 Fe(II)-dependent oxygenase superfamily protein; Provisional Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PF13640 2OG-FeII_Oxy_3: 2OG-Fe(II) oxygenase superfamily; PDB: 3DKQ_B 3GZE_D 3HQR_A 2Y34_A 2G1M_A 2G19_A 3OUI_A 3OUJ_A 2HBU_A 2Y33_A Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>COG3751 EGL-9 Predicted proline hydroxylase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>KOG3844|consensus Back     alignment and domain information
>smart00702 P4Hc Prolyl 4-hydroxylase alpha subunit homologues Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PRK05467 Fe(II)-dependent oxygenase superfamily protein; Provisional Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF13661 2OG-FeII_Oxy_4: 2OG-Fe(II) oxygenase superfamily Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PLN00052 prolyl 4-hydroxylase; Provisional Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF13640 2OG-FeII_Oxy_3: 2OG-Fe(II) oxygenase superfamily; PDB: 3DKQ_B 3GZE_D 3HQR_A 2Y34_A 2G1M_A 2G19_A 3OUI_A 3OUJ_A 2HBU_A 2Y33_A Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>COG3128 PiuC Uncharacterized iron-regulated protein [Function unknown] Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>PLN02997 flavonol synthase Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>TIGR02408 ectoine_ThpD ectoine hydroxylase Back     alignment and domain information
>PLN02704 flavonol synthase Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>PLN02912 oxidoreductase, 2OG-Fe(II) oxygenase family protein Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>PLN02216 protein SRG1 Back     alignment and domain information
>PLN02639 oxidoreductase, 2OG-Fe(II) oxygenase family protein Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>PF01753 zf-MYND: MYND finger; InterPro: IPR002893 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query831
3ouh_A237 Phd2-R127 With Jnj41536014 Length = 237 5e-38
3hqr_A246 Phd2:mn:nog:hif1-Alpha Substrate Complex Length = 2 5e-38
2g1m_A246 Cellular Oxygen Sensing: Crystal Structure Of Hypox 6e-38
2g19_A244 Cellular Oxygen Sensing: Crystal Structure Of Hypox 6e-38
2hbt_A247 Crystal Structure Of Hif Prolyl Hydroxylase Egln-1 7e-38
3oui_A213 Phd2-R717 With 40787422 Length = 213 8e-38
2y33_A252 S-Nitrosylated Phd2 (Gsno Soaked) In Complex With Z 8e-37
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 3e-31
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 1e-26
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 2e-12
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 5e-15
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 1e-14
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 1e-13
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 2e-13
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 4e-13
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 6e-13
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 6e-13
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 7e-13
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 2e-12
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 3e-12
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 1e-11
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 6e-10
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 2e-11
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 4e-11
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 8e-06
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 2e-10
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 4e-10
2csh_A110 Solution Structure Of Tandem Repeat Of The Zf-C2h2 8e-10
1tf6_A190 Co-crystal Structure Of Xenopus Tfiiia Zinc Finger 9e-10
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 3e-09
2wbu_A90 Crystal Structure Of The Zinc Finger Domain Of Klf4 6e-09
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 8e-09
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 1e-08
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 4e-07
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 2e-08
2gli_A155 Five-Finger GliDNA COMPLEX Length = 155 2e-08
2gli_A155 Five-Finger GliDNA COMPLEX Length = 155 2e-05
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 6e-08
2lt7_A133 Solution Nmr Structure Of Kaiso Zinc Finger Dna Bin 1e-07
2lt7_A133 Solution Nmr Structure Of Kaiso Zinc Finger Dna Bin 9e-06
2adr_A60 Adr1 Dna-Binding Domain From Saccharomyces Cerevisi 1e-07
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 2e-07
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 6e-07
1f2i_G73 Cocrystal Structure Of Selected Zinc Finger Dimer B 4e-07
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 1e-06
1llm_C88 Crystal Structure Of A Zif23-Gcn4 Chimera Bound To 3e-06
1x6e_A72 Solution Structures Of The C2h2 Type Zinc Finger Do 1e-05
1x6e_A72 Solution Structures Of The C2h2 Type Zinc Finger Do 1e-05
2el5_A42 Solution Structure Of The 18th Zf-C2h2 Domain From 2e-05
1x6h_A86 Solution Structures Of The C2h2 Type Zinc Finger Do 9e-05
4gzn_C60 Mouse Zfp57 Zinc Fingers In Complex With Methylated 1e-04
1tf3_A92 Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures 2e-04
1tf3_A92 Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures 7e-04
>pdb|3OUH|A Chain A, Phd2-R127 With Jnj41536014 Length = 237 Back     alignment and structure

Iteration: 1

Score = 156 bits (394), Expect = 5e-38, Method: Compositional matrix adjust. Identities = 84/192 (43%), Positives = 112/192 (58%), Gaps = 47/192 (24%) Query: 640 IENVIRDMDQYGLCVVDNFLGPERGMAVLHEVLGMYHSGVFKDGQLVSNKSTNKQDLKTI 699 +E ++ M+++G+CVVD+FLG E G + EV ++ +G F DGQLVS KS + +D I Sbjct: 16 LEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKD---I 72 Query: 700 RGDQITWIDGRETYCSNIGRLISEVDAIIMRANRMVNNGRMGDFVINGRTKQNGGLLRIF 759 RGD+ITWI+G+E C IG L+S +D +I N G++G + INGRTK Sbjct: 73 RGDKITWIEGKEPGCETIGLLMSSMDDLIRHCN-----GKLGSYKINGRTK--------- 118 Query: 760 PEGGGDKVADIEPMFDRILFFWSDRRNPHEAMVACYPGHGSHYVKHVDNPNRDGRCITAI 819 AMVACYPG+G+ YV+HVDNPN DGRC+T I Sbjct: 119 ------------------------------AMVACYPGNGTGYVRHVDNPNGDGRCVTCI 148 Query: 820 YYLNRDWDIKVS 831 YYLN+DWD KVS Sbjct: 149 YYLNKDWDAKVS 160
>pdb|3HQR|A Chain A, Phd2:mn:nog:hif1-Alpha Substrate Complex Length = 246 Back     alignment and structure
>pdb|2G1M|A Chain A, Cellular Oxygen Sensing: Crystal Structure Of Hypoxia- Inducible Factor Prolyl Hydroxylase (Phd2) Length = 246 Back     alignment and structure
>pdb|2G19|A Chain A, Cellular Oxygen Sensing: Crystal Structure Of Hypoxia- Inducible Factor Prolyl Hydroxylase (Phd2) Length = 244 Back     alignment and structure
>pdb|2HBT|A Chain A, Crystal Structure Of Hif Prolyl Hydroxylase Egln-1 In Complex With A Biologically Active Inhibitor Length = 247 Back     alignment and structure
>pdb|3OUI|A Chain A, Phd2-R717 With 40787422 Length = 213 Back     alignment and structure
>pdb|2Y33|A Chain A, S-Nitrosylated Phd2 (Gsno Soaked) In Complex With Zn(Ii) And Un9 Length = 252 Back     alignment and structure
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|2CSH|A Chain A, Solution Structure Of Tandem Repeat Of The Zf-C2h2 Domains Of Human Zinc Finger Protein 297b Length = 110 Back     alignment and structure
>pdb|1TF6|A Chain A, Co-crystal Structure Of Xenopus Tfiiia Zinc Finger Domain Bound To The 5s Ribosomal Rna Gene Internal Control Region Length = 190 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 Back     alignment and structure
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 Back     alignment and structure
>pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|2LT7|A Chain A, Solution Nmr Structure Of Kaiso Zinc Finger Dna Binding Domain In Complex With Kaiso Binding Site Dna Length = 133 Back     alignment and structure
>pdb|2LT7|A Chain A, Solution Nmr Structure Of Kaiso Zinc Finger Dna Binding Domain In Complex With Kaiso Binding Site Dna Length = 133 Back     alignment and structure
>pdb|2ADR|A Chain A, Adr1 Dna-Binding Domain From Saccharomyces Cerevisiae, Nmr, 25 Structures Length = 60 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|1F2I|G Chain G, Cocrystal Structure Of Selected Zinc Finger Dimer Bound To Dna Length = 73 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|1LLM|C Chain C, Crystal Structure Of A Zif23-Gcn4 Chimera Bound To Dna Length = 88 Back     alignment and structure
>pdb|1X6E|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Zinc Finger Protein 24 Length = 72 Back     alignment and structure
>pdb|1X6E|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Zinc Finger Protein 24 Length = 72 Back     alignment and structure
>pdb|2EL5|A Chain A, Solution Structure Of The 18th Zf-C2h2 Domain From Human Zinc Finger Protein 268 Length = 42 Back     alignment and structure
>pdb|1X6H|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Transcriptional Repressor Ctcf Length = 86 Back     alignment and structure
>pdb|4GZN|C Chain C, Mouse Zfp57 Zinc Fingers In Complex With Methylated Dna Length = 60 Back     alignment and structure
>pdb|1TF3|A Chain A, Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures Length = 92 Back     alignment and structure
>pdb|1TF3|A Chain A, Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures Length = 92 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query831
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 5e-55
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 4e-48
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 4e-43
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-35
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 8e-34
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 4e-29
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 4e-16
1tf6_A190 Protein (transcription factor IIIA); complex (tran 2e-44
1tf6_A190 Protein (transcription factor IIIA); complex (tran 9e-39
1tf6_A190 Protein (transcription factor IIIA); complex (tran 5e-30
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 7e-34
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-33
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 6e-33
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 4e-32
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 6e-32
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 3e-28
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 5e-33
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 5e-33
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 1e-30
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 1e-30
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 3e-27
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 1e-06
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 4e-32
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 7e-32
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-31
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 1e-28
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-27
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 5e-05
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 9e-32
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 2e-30
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 2e-29
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 6e-29
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 2e-31
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 1e-26
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 9e-25
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 3e-23
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 7e-21
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 8e-14
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 3e-29
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 3e-26
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 3e-26
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 8e-23
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 1e-20
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 5e-10
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 3e-29
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-28
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 3e-28
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-27
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 5e-24
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 5e-17
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 3e-28
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 4e-26
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 5e-25
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 4e-24
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 7e-22
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 8e-22
2hbt_A247 EGL nine homolog 1; prolyl hydroxylase, hypoxia in 9e-28
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 1e-23
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 4e-21
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 3e-19
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 9e-19
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 1e-18
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 3e-13
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 8e-04
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 1e-23
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 8e-20
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 4e-19
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 4e-19
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 3e-17
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-16
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 8e-06
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 2e-23
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 4e-23
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 6e-23
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 2e-22
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 2e-22
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 7e-20
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 2e-19
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 1e-09
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 3e-23
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 4e-23
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 5e-23
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 4e-21
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 7e-21
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 3e-20
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 1e-06
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 5e-23
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 8e-23
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 4e-22
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 1e-17
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 4e-16
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 1e-14
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 1e-21
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 3e-21
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 1e-20
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-20
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 3e-19
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-16
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 5e-14
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 2e-21
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 1e-20
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 2e-20
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 3e-20
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 3e-18
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 2e-15
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 1e-07
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 7e-21
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 7e-21
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-20
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-18
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 2e-18
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 4e-17
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-06
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 4e-19
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 1e-17
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 4e-17
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 2e-16
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 2e-16
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 1e-15
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 2e-15
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 3e-13
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 7e-05
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 5e-19
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 6e-19
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 8e-19
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 4e-14
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 7e-14
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 4e-11
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 2e-05
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 1e-18
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 9e-18
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 4e-17
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 9e-16
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 1e-15
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 8e-15
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 2e-11
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 2e-04
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 1e-18
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 3e-17
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 9e-17
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 1e-14
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 5e-12
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 5e-06
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 2e-18
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-16
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 2e-16
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 3e-16
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 5e-15
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-13
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 5e-18
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 3e-17
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 2e-16
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 6e-15
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 7e-15
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 2e-13
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 4e-10
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 3e-07
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 6e-18
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 3e-16
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 3e-16
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 6e-16
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 9e-14
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 6e-13
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 3e-10
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 6e-09
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-04
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 1e-17
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 1e-16
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 2e-16
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 2e-14
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 4e-14
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 7e-14
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 2e-13
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 1e-16
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 7e-13
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 1e-12
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 4e-11
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 1e-08
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 5e-08
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 9e-07
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 9e-16
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 6e-15
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 2e-14
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 1e-12
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 7e-09
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 3e-07
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 4e-07
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 4e-15
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 6e-14
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 1e-13
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 3e-11
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 4e-11
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 8e-11
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 2e-09
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 3e-08
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 1e-13
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 2e-12
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 7e-09
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 9e-08
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 2e-07
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 5e-07
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 7e-07
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-13
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-09
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-08
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-07
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-07
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-05
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-13
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-09
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-08
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-07
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-07
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-05
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-05
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 7e-13
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-08
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-08
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 9e-08
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-06
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-05
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 9e-13
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-08
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 5e-08
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-07
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-07
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 7e-06
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-04
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-12
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-08
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-07
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-07
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-07
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-05
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-04
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-12
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-08
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-08
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-07
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-07
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-05
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-04
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-12
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-08
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-07
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-07
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-06
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 9e-06
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-04
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-12
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-08
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-08
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-08
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-07
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-05
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 2e-12
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 1e-11
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 3e-11
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 4e-11
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 1e-10
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 3e-09
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 2e-05
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 3e-05
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 1e-04
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-12
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-08
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-08
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-07
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-07
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-05
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-04
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-12
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 5e-08
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-07
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-07
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-07
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-04
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-04
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 2e-12
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 5e-08
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 7e-08
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 8e-08
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 1e-06
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 2e-05
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-12
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-08
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-08
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 5e-08
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-07
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-05
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-12
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 6e-09
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-08
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 9e-08
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-07
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-05
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-12
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-08
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-08
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-07
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-07
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-05
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-04
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-12
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-08
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-08
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-08
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-07
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-05
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-12
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-08
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-08
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-07
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-07
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-05
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-04
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-12
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-08
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-08
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 9e-08
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-06
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-05
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-04
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 4e-12
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 2e-08
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 9e-08
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 2e-07
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 1e-06
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 6e-06
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 2e-04
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 6e-04
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-12
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-08
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-08
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-08
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-07
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-05
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-12
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-08
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-08
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-07
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-07
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-05
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 7e-04
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-12
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-08
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-07
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-07
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-07
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-05
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-04
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-12
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-10
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-08
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-08
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-07
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-05
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-12
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-08
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-08
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-08
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-07
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-05
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-04
2epa_A72 Krueppel-like factor 10; transforming growth facto 4e-12
2epa_A72 Krueppel-like factor 10; transforming growth facto 8e-12
2epa_A72 Krueppel-like factor 10; transforming growth facto 1e-11
2epa_A72 Krueppel-like factor 10; transforming growth facto 3e-10
2epa_A72 Krueppel-like factor 10; transforming growth facto 9e-10
2epa_A72 Krueppel-like factor 10; transforming growth facto 1e-06
2epa_A72 Krueppel-like factor 10; transforming growth facto 3e-04
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-12
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-08
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-08
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-08
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-08
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-04
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-04
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-12
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-09
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-08
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-08
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-08
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-05
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-12
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-08
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-08
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-07
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-07
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-05
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-04
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-12
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-08
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 8e-08
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 9e-08
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-07
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-05
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-04
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-12
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-09
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-08
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-07
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-07
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-04
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-04
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-12
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-08
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-08
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-07
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-07
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-05
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-12
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-08
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-08
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-07
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-07
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-05
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-04
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-12
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-09
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-08
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-08
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-08
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-05
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-12
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-08
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-08
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-08
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-08
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-05
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-04
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-12
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-09
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-08
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-08
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-08
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-05
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-05
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-12
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-08
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-08
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-07
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-06
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-05
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-04
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-12
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-08
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 8e-08
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-07
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-07
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-04
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-04
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-12
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-09
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-08
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-08
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-07
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-05
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 7e-12
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 9e-09
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-08
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 7e-08
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-07
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-05
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-04
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-12
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-09
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-08
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-08
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-08
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-05
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-04
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-12
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-08
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-08
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-08
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-07
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-05
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 7e-12
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 6e-08
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 1e-07
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 2e-07
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 5e-07
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 3e-05
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 8e-12
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-08
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-07
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 3e-07
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 5e-07
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-04
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 8e-12
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-08
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-08
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-08
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 9e-07
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 9e-06
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 6e-05
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-12
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-08
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-08
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-07
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-06
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-05
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-04
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 8e-12
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-08
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 8e-08
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-07
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-06
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 8e-05
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 7e-04
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 8e-12
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-09
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-08
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 8e-08
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-07
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-04
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-12
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-08
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-08
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-07
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-07
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-05
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-12
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-08
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-08
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-07
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-06
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-05
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-04
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-12
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-08
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-08
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-08
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-08
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-05
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 9e-12
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 1e-08
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 9e-08
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 3e-07
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 4e-07
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 3e-05
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 1e-04
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 1e-11
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 8e-09
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 9e-09
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 3e-08
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 4e-08
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 4e-05
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-11
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-09
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-08
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-08
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-07
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 6e-05
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-04
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-11
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-10
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-08
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-08
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-08
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-05
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-05
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-11
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-08
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-08
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-08
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-07
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-04
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-04
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-11
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-08
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-08
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-08
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-07
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-11
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-08
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-08
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-07
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-06
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 9e-05
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-11
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-08
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-08
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-08
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-07
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-05
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-11
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-09
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-08
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-07
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-07
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-05
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-04
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-11
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-08
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-08
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-07
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-06
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-05
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-04
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-11
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-08
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-08
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-07
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-07
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-04
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 1e-11
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 2e-07
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 1e-06
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 3e-04
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 4e-04
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 1e-11
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 4e-08
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 6e-06
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 2e-05
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 6e-04
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-11
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 9e-08
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-07
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-07
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-07
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-05
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-04
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 9e-04
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-11
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-08
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-08
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-08
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-08
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-05
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-11
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-10
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-08
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-07
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-07
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-05
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-11
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-09
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-08
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-07
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-07
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-05
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-05
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-11
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-08
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-08
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-08
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-07
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-05
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-11
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-09
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-08
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-07
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-07
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-05
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-11
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-09
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 8e-08
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-07
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-07
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-05
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-11
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-08
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-08
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-08
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 7e-07
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 9e-05
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-11
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-08
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-08
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-08
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-08
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-05
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-04
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-11
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-09
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-08
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-08
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-08
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-05
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 2e-11
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 1e-08
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 4e-08
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 3e-07
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 7e-07
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 1e-05
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-11
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-08
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-08
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-08
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-07
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-05
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-11
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-09
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-09
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-08
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-07
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-05
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-11
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-08
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-08
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-07
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-07
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-04
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 3e-11
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 5e-09
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 1e-08
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 7e-08
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 2e-07
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 9e-06
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 2e-05
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-11
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-08
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-08
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-08
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-07
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-05
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-05
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-11
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-08
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-08
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-07
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-06
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-05
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-04
2d8q_A70 BLU protein, zinc finger MYND domain containing pr 3e-11
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-11
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-08
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-08
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-08
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-07
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-05
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-04
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 4e-11
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 1e-10
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 5e-09
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 3e-08
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 2e-07
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 3e-04
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 4e-04
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 5e-11
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 5e-08
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 1e-07
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 1e-07
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 3e-06
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 1e-04
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 5e-11
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 2e-08
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 2e-08
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 2e-07
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 5e-07
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 4e-05
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 2e-04
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 5e-11
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-08
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-07
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-07
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-07
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-05
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 5e-04
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 8e-11
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 2e-09
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 7e-08
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 5e-07
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 6e-07
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 1e-06
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 1e-06
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 9e-06
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 9e-05
2dj8_A60 Protein CBFA2T1; zinc finger MYND domain, protein 9e-11
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-10
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-08
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-08
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-07
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-05
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-04
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-04
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-10
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 3e-10
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 3e-08
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-07
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 4e-06
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 1e-04
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 6e-04
2jw6_A52 Deformed epidermal autoregulatory factor 1 homolo; 2e-10
2od1_A60 Protein CBFA2T1; zinc finger, cross-braced topolog 2e-10
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-10
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 3e-07
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 3e-07
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 5e-07
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-06
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 9e-06
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 7e-05
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-10
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 3e-10
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 1e-08
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 1e-08
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-05
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-05
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 4e-04
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-10
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-09
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-08
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-06
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-06
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-04
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-04
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 4e-10
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 4e-10
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 1e-08
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 2e-08
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 9e-08
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 1e-07
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 1e-06
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-10
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-09
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 8e-08
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-07
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-07
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-05
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-05
2odd_A64 Protein CBFA2T1; MYND zinc finger, cross-braced to 5e-10
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 1e-09
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 6e-06
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 2e-05
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 3e-05
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 3e-05
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 2e-09
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 8e-08
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 5e-07
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 4e-05
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 4e-05
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 2e-09
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 2e-07
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 1e-06
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 2e-06
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 1e-05
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 2e-04
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 6e-09
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 7e-08
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 2e-06
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 3e-05
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 7e-04
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 2e-08
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 2e-05
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 4e-05
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 7e-08
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 1e-06
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 3e-05
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 4e-04
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 1e-07
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 3e-07
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 8e-07
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 9e-07
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-07
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 6e-05
1ard_A29 Yeast transcription factor ADR1; transcription reg 6e-05
1ard_A29 Yeast transcription factor ADR1; transcription reg 9e-05
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 1e-04
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 1e-04
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 2e-04
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
 Score =  187 bits (477), Expect = 5e-55
 Identities = 80/217 (36%), Positives = 111/217 (51%), Gaps = 30/217 (13%)

Query: 141 FPSSGAMKKHRRKHTGERPYECKEVCGRVFNRKDNLREHLRAHAGETKRKKKFKCDKCEK 200
              S +         GE+PY C E CG+ F+R D+L EH R H GE    K +KC +C K
Sbjct: 3   EFGSSSSVAQAALEPGEKPYACPE-CGKSFSRSDHLAEHQRTHTGE----KPYKCPECGK 57

Query: 201 QFYGLTLLRIHERLHGLIERTCYARFAAKETLNRHMKTHSGVKPHVCEYCEKAFIQASQL 260
                                    F+ K+ L RH +TH+G KP+ C  C K+F Q + L
Sbjct: 58  ------------------------SFSDKKDLTRHQRTHTGEKPYKCPECGKSFSQRANL 93

Query: 261 KAHMFHHTGENGHTCELCNKTFNRKARLELHMKYIHEGADPYQCDICRKTFIRKEDLTRH 320
           +AH   HTGE  + C  C K+F++ A L  H +  H G  PY+C  C K+F R+++L  H
Sbjct: 94  RAHQRTHTGEKPYACPECGKSFSQLAHLRAHQR-THTGEKPYKCPECGKSFSREDNLHTH 152

Query: 321 CLLHTGVKPHKCPICTKGFTMKSSLKIHLLTHTKEPP 357
              HTG KP+KCP C K F+ + +L +H  THT +  
Sbjct: 153 QRTHTGEKPYKCPECGKSFSRRDALNVHQRTHTGKKT 189


>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2hbt_A EGL nine homolog 1; prolyl hydroxylase, hypoxia inducible factor, HIF, 2- oxoglutarate, oxygenase, oxidoreductase; HET: UN9; 1.60A {Homo sapiens} PDB: 2hbu_A* 2g1m_A* 3hqu_A* 3hqr_A* 2y33_A* 2y34_A* 2g19_A* 3ouj_A* 3ouh_A* 3oui_A* Length = 247 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2d8q_A BLU protein, zinc finger MYND domain containing protein 10; zmynd10, ZF-MYND, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.85.1.1 PDB: 2dan_A Length = 70 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>2dj8_A Protein CBFA2T1; zinc finger MYND domain, protein MTG8, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.85.1.1 Length = 60 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2jw6_A Deformed epidermal autoregulatory factor 1 homolo; zinc binding domain, transcription, alternative splicing, DI mutation, DNA-binding; NMR {Homo sapiens} SCOP: g.85.1.1 Length = 52 Back     alignment and structure
>2od1_A Protein CBFA2T1; zinc finger, cross-braced topology, metal binding protein; NMR {Homo sapiens} Length = 60 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2odd_A Protein CBFA2T1; MYND zinc finger, cross-braced topology, poly-proline, proline-tryptophan interaction, metal binding protein; NMR {Homo sapiens} Length = 64 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Length = 37 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Length = 29 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Length = 29 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Length = 31 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 102 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 45 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query831
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 100.0
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.98
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.95
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.94
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.92
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.89
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.89
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.86
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.86
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.85
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.85
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.84
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.84
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.84
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.83
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.83
2hbt_A247 EGL nine homolog 1; prolyl hydroxylase, hypoxia in 99.81
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.73
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.71
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.71
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.71
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.71
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.71
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.7
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.69
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.69
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.69
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.69
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.67
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.65
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.65
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.63
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.62
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.61
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.61
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.61
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.6
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.59
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.55
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.54
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.54
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.54
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.53
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.52
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.49
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.47
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.47
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.47
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.47
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.45
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.43
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.43
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.42
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.42
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.4
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.4
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.39
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.39
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.38
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.37
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.37
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.36
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.36
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.36
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.35
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.35
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.34
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.3
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.3
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.29
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.28
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.27
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.27
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.26
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.26
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.25
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.25
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.21
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.2
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.19
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.17
3kt7_A 633 PKHD-type hydroxylase TPA1; double-stranded beta h 99.16
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.13
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.08
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.08
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.07
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.07
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.06
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.06
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.06
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.06
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.06
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.06
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.06
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.06
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.06
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.06
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.05
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.05
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.05
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.05
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.05
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.05
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.05
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.05
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.05
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.05
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.04
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.04
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.04
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.04
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.04
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.04
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.04
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.04
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.04
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.03
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.03
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.03
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.03
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.03
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.02
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.02
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.02
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.02
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.02
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.01
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.01
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.01
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.0
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.99
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 98.99
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.99
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 98.98
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.97
2epa_A72 Krueppel-like factor 10; transforming growth facto 98.93
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.93
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.93
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.93
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.93
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.93
2epa_A72 Krueppel-like factor 10; transforming growth facto 98.93
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.92
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.92
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 98.92
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.92
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.92
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.92
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.91
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.91
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.91
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.91
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.91
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.91
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.91
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.91
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.91
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.91
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.91
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.91
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.91
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.9
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.9
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.9
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 98.9
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.9
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.9
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.9
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.9
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 98.9
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.9
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.9
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.9
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.9
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.9
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.9
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.9
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.9
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.9
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.9
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.89
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.89
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 98.89
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.89
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.89
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.89
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.89
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.89
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.89
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.89
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.89
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.89
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.89
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.89
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.89
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.88
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.88
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.88
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.88
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.88
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.88
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.88
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 98.88
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.88
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.87
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.87
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.87
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.87
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.87
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.87
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 98.86
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.86
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.86
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.86
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.86
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.86
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.86
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.86
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.86
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.86
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.85
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.85
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.84
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.84
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.84
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.84
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 98.84
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.83
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.83
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.82
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.81
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.81
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.8
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.79
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.78
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.78
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.77
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.76
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.76
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.76
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.75
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.75
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.75
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.75
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.74
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.74
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.74
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.74
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.74
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.74
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.74
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.74
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.74
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.73
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.73
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.73
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.73
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.73
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.72
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.72
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.72
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.72
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.71
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.71
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.71
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.71
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.71
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.71
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.69
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.69
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.69
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.69
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.69
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.69
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.68
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.68
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.68
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.67
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.67
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.67
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.65
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.65
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.65
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.64
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.64
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.64
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.63
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.62
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.62
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.59
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.58
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.58
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.56
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.55
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.53
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.51
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.45
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.44
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.4
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.38
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.36
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.33
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.33
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.32
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.31
3itq_A216 Prolyl 4-hydroxylase, alpha subunit domain protei; 98.28
2jig_A224 Prolyl-4 hydroxylase; hydrolase; HET: PD2; 1.85A { 98.28
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.26
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.25
2hbt_A247 EGL nine homolog 1; prolyl hydroxylase, hypoxia in 98.24
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.23
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.22
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.2
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.18
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.16
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.16
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.15
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.15
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.14
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.13
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.11
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.1
3dkq_A243 PKHD-type hydroxylase SBAL_3634; putative oxygenas 98.1
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.08
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.08
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.07
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.05
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.05
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.04
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.01
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.01
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.01
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.0
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 97.98
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 97.96
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.93
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 97.93
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 97.91
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 97.9
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 97.85
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 97.84
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 97.84
1ard_A29 Yeast transcription factor ADR1; transcription reg 97.81
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 97.81
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.78
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.77
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 97.76
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 97.75
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 97.74
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.74
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 97.74
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.73
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 97.72
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 97.7
1ard_A29 Yeast transcription factor ADR1; transcription reg 97.69
3itq_A216 Prolyl 4-hydroxylase, alpha subunit domain protei; 97.68
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 97.68
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 97.67
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 96.84
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 97.66
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.66
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 97.66
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 96.83
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.64
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 97.64
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 97.64
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.62
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.61
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 97.58
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.58
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.57
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 96.68
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.52
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 96.66
3kt7_A 633 PKHD-type hydroxylase TPA1; double-stranded beta h 97.5
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 96.57
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.42
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 96.53
2rg4_A216 Uncharacterized protein; rhodobacterales, oceanico 97.21
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.2
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.16
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.0
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 96.46
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 95.82
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 95.54
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 95.5
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 94.81
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 94.28
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 94.08
2jig_A224 Prolyl-4 hydroxylase; hydrolase; HET: PD2; 1.85A { 93.76
3dkq_A243 PKHD-type hydroxylase SBAL_3634; putative oxygenas 93.6
2e72_A49 POGO transposable element with ZNF domain; zinc fi 92.21
2e72_A49 POGO transposable element with ZNF domain; zinc fi 90.76
3nnf_A 344 CURA; non-HAEM Fe(II)/alpha-ketoglutarate-dependen 86.32
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 86.32
3emr_A310 ECTD; double stranded beta helix, oxidoreductase; 82.35
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 80.23
2elu_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 80.19
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
Probab=100.00  E-value=6.2e-34  Score=285.05  Aligned_cols=184  Identities=37%  Similarity=0.679  Sum_probs=143.1

Q ss_pred             chhHHHHHhhhcCcccCCCccccCcccccccCchhhhhhhhhcccccccccccccchHHhhhhcccCCCCCccccccchh
Q psy11980        173 KDNLREHLRAHAGETKRKKKFKCDKCEKQFYGLTLLRIHERLHGLIERTCYARFAAKETLNRHMKTHSGVKPHVCEYCEK  252 (831)
Q Consensus       173 ~~~L~~H~~~h~~~~~~~~~~~C~~C~k~f~~~~~L~~H~~~h~~~c~~C~~~f~~~~~L~~H~~~h~~~k~~~C~~C~k  252 (831)
                      ...|..|++.|.++    ++|.|+.|++.|.+...|..                        |++.|.++++|.|+.|++
T Consensus         6 ~~~l~~h~~~~~~~----~~~~C~~C~~~f~~~~~l~~------------------------H~~~h~~~~~~~C~~C~~   57 (190)
T 2i13_A            6 SSSSVAQAALEPGE----KPYACPECGKSFSRSDHLAE------------------------HQRTHTGEKPYKCPECGK   57 (190)
T ss_dssp             -----------------------------CCSSHHHHH------------------------GGGCC---CCEECTTTCC
T ss_pred             hccchhhhhhcCCC----CCCcCCCCccccCCHHHHHH------------------------HHHHcCCCCCccCCCcCc
Confidence            35677888888776    78999999888866555554                        555667788999999999


Q ss_pred             hhcChhhHHhhhhcccccCCccCcccccccccchHHHhhhhhcccCCCCccCcccccccCChhHHHHHHhhhcCCCCccC
Q psy11980        253 AFIQASQLKAHMFHHTGENGHTCELCNKTFNRKARLELHMKYIHEGADPYQCDICRKTFIRKEDLTRHCLLHTGVKPHKC  332 (831)
Q Consensus       253 ~f~~~~~L~~H~~~H~~~k~~~C~~C~k~F~~~~~L~~H~~~~H~~~k~~~C~~C~k~F~~~~~L~~H~~~H~~~k~~~C  332 (831)
                      .|.+...|..|++.|+++++|.|+.|++.|.+...|..|++ .|.++++|.|+.|++.|.+...|..|++.|+++++|.|
T Consensus        58 ~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~-~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C  136 (190)
T 2i13_A           58 SFSDKKDLTRHQRTHTGEKPYKCPECGKSFSQRANLRAHQR-THTGEKPYACPECGKSFSQLAHLRAHQRTHTGEKPYKC  136 (190)
T ss_dssp             EESSHHHHHHHHHHHHCCCCEECTTTCCEESCHHHHHHHHH-HHHTCCCEECTTTCCEESSHHHHHHHHHHHHCCCCEEC
T ss_pred             hhCCHHHHHHHHHhcCCCCCccCcccCCccCCHHHHHHHHH-hcCCCCCCcCCCCCCccCCHHHHHHHHHHhCCCCCeEC
Confidence            99999999999999999999999999999999999999998 78889999999999999999999999999999999999


Q ss_pred             CCCCCccCChhHHHHHhhhccCCCCcccccccccccChhHHHHHHHHhccCch
Q psy11980        333 PICTKGFTMKSSLKIHLLTHTKEPPKSCEVCGRAFIRQDCLIRHLRQKHRSHL  385 (831)
Q Consensus       333 ~~C~k~F~~~~~L~~H~~~H~~~~py~C~~C~~~F~~~~~L~~H~r~~H~~~~  385 (831)
                      ++|++.|.+...|..|+++|++++||.|++|++.|.++..|..|+++|+++++
T Consensus       137 ~~C~~~f~~~~~L~~H~~~H~~~~~~~C~~C~~~f~~~~~L~~H~~~H~~~k~  189 (190)
T 2i13_A          137 PECGKSFSREDNLHTHQRTHTGEKPYKCPECGKSFSRRDALNVHQRTHTGKKT  189 (190)
T ss_dssp             TTTCCEESCHHHHHHHHHHHHCCCCEECTTTCCEESSHHHHHHHHTTC-----
T ss_pred             CCCCcccCCHHHHHHHHHhcCCCCCeECCCCCCccCCHHHHHHHHHhcCCCCC
Confidence            99999999999999999999999999999999999999999999999988754



>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2hbt_A EGL nine homolog 1; prolyl hydroxylase, hypoxia inducible factor, HIF, 2- oxoglutarate, oxygenase, oxidoreductase; HET: UN9; 1.60A {Homo sapiens} PDB: 2hbu_A* 2g1m_A* 3hqu_A* 3hqr_A* 2y33_A* 2y34_A* 2g19_A* 3ouj_A* 3ouh_A* 3oui_A* Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3kt7_A PKHD-type hydroxylase TPA1; double-stranded beta helix fold, dioxygenase, iron, mRNP complex, prolyl hydroxylase; HET: AKG; 1.77A {Saccharomyces cerevisiae} PDB: 3kt1_A 3kt4_A 3mgu_A Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>3itq_A Prolyl 4-hydroxylase, alpha subunit domain protei; double-stranded beta helix, alpha-keto dependent non-heme iron oxygenase; 1.40A {Bacillus anthracis str} Back     alignment and structure
>2jig_A Prolyl-4 hydroxylase; hydrolase; HET: PD2; 1.85A {Chlamydomonas reinhardtii} PDB: 3gze_A 2v4a_A 2jij_A Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2hbt_A EGL nine homolog 1; prolyl hydroxylase, hypoxia inducible factor, HIF, 2- oxoglutarate, oxygenase, oxidoreductase; HET: UN9; 1.60A {Homo sapiens} PDB: 2hbu_A* 2g1m_A* 3hqu_A* 3hqr_A* 2y33_A* 2y34_A* 2g19_A* 3ouj_A* 3ouh_A* 3oui_A* Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3dkq_A PKHD-type hydroxylase SBAL_3634; putative oxygenase, structural genomics, JOI for structural genomics, JCSG; 2.26A {Shewanella baltica OS155} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>3itq_A Prolyl 4-hydroxylase, alpha subunit domain protei; double-stranded beta helix, alpha-keto dependent non-heme iron oxygenase; 1.40A {Bacillus anthracis str} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>3kt7_A PKHD-type hydroxylase TPA1; double-stranded beta helix fold, dioxygenase, iron, mRNP complex, prolyl hydroxylase; HET: AKG; 1.77A {Saccharomyces cerevisiae} PDB: 3kt1_A 3kt4_A 3mgu_A Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2rg4_A Uncharacterized protein; rhodobacterales, oceanicola granulosus HTCC2516, Q2CBJ1_9RHO structural genomics, PSI-2; 1.90A {Oceanicola granulosus} PDB: 3bvc_A Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>2jig_A Prolyl-4 hydroxylase; hydrolase; HET: PD2; 1.85A {Chlamydomonas reinhardtii} PDB: 3gze_A 2v4a_A 2jij_A Back     alignment and structure
>3dkq_A PKHD-type hydroxylase SBAL_3634; putative oxygenase, structural genomics, JOI for structural genomics, JCSG; 2.26A {Shewanella baltica OS155} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3nnf_A CURA; non-HAEM Fe(II)/alpha-ketoglutarate-dependent enzymes, catal cryptic chlorination, biosynthetic protein; HET: AKG; 2.20A {Lyngbya majuscula} PDB: 3nnj_A 3nnl_A* 3nnm_A Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>3emr_A ECTD; double stranded beta helix, oxidoreductase; HET: MSE; 1.85A {Virgibacillus salexigens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>2elu_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2elw_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 831
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 8e-10
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 8e-09
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 1e-08
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 1e-06
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 2e-05
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 2e-04
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 3e-04
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 1e-09
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 3e-09
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 2e-08
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 6e-08
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 1e-07
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 3e-06
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 6e-06
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 9e-05
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 3e-04
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 1e-09
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 4e-09
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 2e-07
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 7e-06
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 3e-04
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 0.002
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 1e-08
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 3e-08
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 9e-08
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 4e-05
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 3e-04
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 3e-04
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 0.001
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 0.004
d2jw6a138 g.85.1.1 (A:503-540) Zinc finger MYND domain-conta 1e-08
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 2e-08
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 3e-08
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 3e-08
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 1e-07
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 2e-07
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 1e-06
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 0.002
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 0.003
d2dana147 g.85.1.1 (A:8-54) Zinc finger MYND domain-containi 2e-08
d2dj8a147 g.85.1.1 (A:8-54) Zinc finger MYND domain-containi 2e-08
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 4e-08
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 1e-06
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 3e-06
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 1e-04
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 0.002
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 0.002
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 0.002
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 0.002
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 4e-08
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 7e-08
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 1e-07
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-05
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 5e-05
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-04
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 0.002
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 1e-06
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 2e-06
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 4e-06
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 9e-06
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 2e-04
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 1e-06
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 6e-06
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 4e-05
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 7e-04
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 0.004
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 2e-06
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 5e-06
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 1e-05
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 2e-05
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 3e-04
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 4e-04
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 4e-04
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 0.002
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 2e-06
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 9e-06
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 1e-05
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 4e-05
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 3e-04
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 3e-06
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 7e-05
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 4e-04
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 0.004
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 3e-06
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 2e-05
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 4e-05
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 0.001
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 8e-06
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 1e-05
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 3e-05
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 9e-06
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 1e-05
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 5e-05
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 5e-05
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 1e-04
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 1e-05
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 6e-05
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 2e-04
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 0.002
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 2e-05
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 2e-04
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 5e-04
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 0.002
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 4e-05
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 5e-05
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 7e-05
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 2e-04
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 1e-04
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 2e-04
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 0.001
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 0.001
d1ubdc428 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger 5e-04
d1ubdc428 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger 0.001
d1ubdc428 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger 0.002
d1ubdc228 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger 6e-04
d1njqa_37 g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale c 0.001
d2dmda226 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {H 0.003
d2dmda226 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {H 0.004
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 24
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 52.2 bits (126), Expect = 8e-10
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 154 HTGERPYECKEVCGRVFNRKDNLREHLRAHAGE 186
           H+GE+PY C E CG+ F+R   L +H R H GE
Sbjct: 2   HSGEKPYGCVE-CGKAFSRSSILVQHQRVHTGE 33


>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2jw6a1 g.85.1.1 (A:503-540) Zinc finger MYND domain-containing protein 2, MTG8 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2dana1 g.85.1.1 (A:8-54) Zinc finger MYND domain-containing protein 10, ZMYND10 {Human (Homo sapiens) [TaxId: 9606]} Length = 47 Back     information, alignment and structure
>d2dj8a1 g.85.1.1 (A:8-54) Zinc finger MYND domain-containing protein 2, MTG8 {Human (Homo sapiens) [TaxId: 9606]} Length = 47 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 37 Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query831
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.5
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.47
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.04
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.03
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.97
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.93
d2cota238 Zinc finger and SCAN domain-containing protein 16, 98.93
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.91
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.9
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.89
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.87
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.87
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.87
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.79
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.75
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.72
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.71
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.7
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.7
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.66
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.63
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.63
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.61
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.58
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.54
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.48
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.45
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.43
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.42
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.36
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.36
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.27
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.2
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.13
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.11
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.09
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.97
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.96
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 97.96
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.91
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.9
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.81
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.72
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.68
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.61
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.59
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.57
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.5
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.41
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.41
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.38
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.33
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.26
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.25
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.21
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.16
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.11
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.04
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.93
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 96.92
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.84
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 96.72
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 96.7
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.65
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 96.62
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 96.58
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 96.53
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.43
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 96.36
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.33
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.19
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 96.03
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 95.99
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 95.97
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.96
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 95.85
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 95.4
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.33
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.3
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 95.27
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.07
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 94.98
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 94.87
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 94.68
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 94.65
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 94.63
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 93.58
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 93.51
d2jw6a138 Zinc finger MYND domain-containing protein 2, MTG8 93.4
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 93.36
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 92.85
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 92.66
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 92.47
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 92.0
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 91.49
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 90.75
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 89.96
d2dana147 Zinc finger MYND domain-containing protein 10, ZMY 89.42
d2dj8a147 Zinc finger MYND domain-containing protein 2, MTG8 89.08
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 88.3
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 87.84
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 87.82
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 87.04
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 86.66
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 84.41
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 84.34
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 82.96
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 81.32
d1y0jb136 U-shaped transcription factor, different fingers { 81.04
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 80.97
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 80.89
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 80.85
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 80.77
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.50  E-value=4.8e-15  Score=111.80  Aligned_cols=53  Identities=34%  Similarity=0.609  Sum_probs=33.9

Q ss_pred             CCCccCCCCCCccCChhHHHHHhhhccCCCCcccccccccccChhHHHHHHHHh
Q psy11980        327 VKPHKCPICTKGFTMKSSLKIHLLTHTKEPPKSCEVCGRAFIRQDCLIRHLRQK  380 (831)
Q Consensus       327 ~k~~~C~~C~k~F~~~~~L~~H~~~H~~~~py~C~~C~~~F~~~~~L~~H~r~~  380 (831)
                      ||||+|. ||++|..+..|..|+++|++++||.|++||++|.+.+.|..|+++|
T Consensus         1 EK~y~C~-Cgk~F~~~~~l~~H~~~Ht~ekpy~C~~C~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           1 DKLYPCQ-CGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             CCCEECT-TSCEESSHHHHHHHHHHHSCCCSEECTTTSCEESSSHHHHHHHTTT
T ss_pred             CcCCCCC-CCCeECCHHHhHHHhhccccccCCcCCCcCCEecCHHHHHHHHhcC
Confidence            4566663 6666666666666666666666666666666666666666666543



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jw6a1 g.85.1.1 (A:503-540) Zinc finger MYND domain-containing protein 2, MTG8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2dana1 g.85.1.1 (A:8-54) Zinc finger MYND domain-containing protein 10, ZMYND10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dj8a1 g.85.1.1 (A:8-54) Zinc finger MYND domain-containing protein 2, MTG8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure