Psyllid ID: psy12043

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140---
MPCIIQSILNSKLVSYLTADIGVKWYDPVLQWDPKKYGDIKQIYLAPQEVWQPDLSTFNSAGGNDVSPFGETYHIASSDGLISWVPPCQFQVYCRLDLTYWPFDSQVCELILGSWVYDGNNIDFHFEDGNWRMNGDASEFKIK
ccEEEEEEEEcEEEEEEEEEEEEEEEccccEEcccccccccEEEEcccccccccEEEEEcccccccccEEEEEEEEccccEEEEEccEEEEEEEEEEEEEEcccccEEEEEEEcccccccEEEEEEEcccEEEcccccEEEEc
cccHHHEEEcccHccEEEEEHHHHHHHccccccHHHccccEEEEccccHcccccEEEEEcccccEEEEEEEEEEEEEEccEEEEccccEEEcccEEEEEEEccccccEEEEEcEEEEcccEEEEEEEcccEccccccccEEEc
MPCIIQSILNSKLVSYLTAdigvkwydpvlqwdpkkygdikqiylapqevwqpdlstfnsaggndvspfgetyhiassdgliswvppcqfqvycrldltywpfdsQVCELILGswvydgnnidfhfedgnwrmngdasefkik
MPCIIQSILNSKLVSYLTADIGVKWYDPVLQWDPKKYGDIKQIYLAPQEVWQPDLSTFNSAGGNDVSPFGETYHIASSDGLISWVPPCQFQVYCRLDLTYWPFDSQVCELILGSWVYDGNNIDFHFEdgnwrmngdasefkik
MPCIIQSILNSKLVSYLTADIGVKWYDPVLQWDPKKYGDIKQIYLAPQEVWQPDLSTFNSAGGNDVSPFGETYHIASSDGLISWVPPCQFQVYCRLDLTYWPFDSQVCELILGSWVYDGNNIDFHFEDGNWRMNGDASEFKIK
**CIIQSILNSKLVSYLTADIGVKWYDPVLQWDPKKYGDIKQIYLAPQEVWQPDLSTFNSAGGNDVSPFGETYHIASSDGLISWVPPCQFQVYCRLDLTYWPFDSQVCELILGSWVYDGNNIDFHFEDGNWR***********
MPCIIQSILNSKLVSYLTADIGVKWYDPVLQWDPKKYGDIKQIYLAPQEVWQPDLSTFNSAGGNDVSPFGETYHIASSDGLISWVPPCQFQVYCRLDLTYWPFDSQVCELILGSWVYDGNNIDFHFEDGNWRMNGDASEFKI*
MPCIIQSILNSKLVSYLTADIGVKWYDPVLQWDPKKYGDIKQIYLAPQEVWQPDLSTFNSAGGNDVSPFGETYHIASSDGLISWVPPCQFQVYCRLDLTYWPFDSQVCELILGSWVYDGNNIDFHFEDGNWRMNGDASEFKIK
**CIIQSILNSKLVSYLTADIGVKWYDPVLQWDPKKYGDIKQIYLAPQEVWQPDLSTFNSAGGNDVSPFGETYHIASSDGLISWVPPCQFQVYCRLDLTYWPFDSQVCELILGSWVYDGNNIDFHFEDGNWRMNGDASEFKIK
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPCIIQSILNSKLVSYLTADIGVKWYDPVLQWDPKKYGDIKQIYLAPQEVWQPDLSTFNSAGGNDVSPFGETYHIASSDGLISWVPPCQFQVYCRLDLTYWPFDSQVCELILGSWVYDGNNIDFHFEDGNWRMNGDASEFKIK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query143 2.2.26 [Sep-21-2011]
Q27218 507 Acetylcholine receptor su yes N/A 0.720 0.203 0.423 9e-21
P48181 493 Acetylcholine receptor su no N/A 0.720 0.208 0.403 1e-20
P48182 575 Acetylcholine receptor su no N/A 0.720 0.179 0.375 8e-20
Q98880 456 Acetylcholine receptor su yes N/A 0.909 0.285 0.340 5e-19
P22456 457 Acetylcholine receptor su N/A N/A 0.909 0.284 0.340 8e-19
Q93149 487 Acetylcholine receptor su no N/A 0.741 0.217 0.364 1e-18
P05377 457 Acetylcholine receptor su N/A N/A 0.811 0.253 0.386 1e-18
P09479 456 Acetylcholine receptor su yes N/A 0.909 0.285 0.340 2e-18
Q8BMN3 464 Neuronal acetylcholine re yes N/A 0.762 0.234 0.338 2e-18
P12391 464 Neuronal acetylcholine re yes N/A 0.762 0.234 0.338 2e-18
>sp|Q27218|ACH7_CAEEL Acetylcholine receptor subunit beta-type lev-1 OS=Caenorhabditis elegans GN=lev-1 PE=1 SV=1 Back     alignment and function desciption
 Score = 99.0 bits (245), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 44/104 (42%), Positives = 64/104 (61%), Gaps = 1/104 (0%)

Query: 23  VKWYDPVLQWDPKKYGDIKQIYLAPQEVWQPDLSTFNSAGGNDVSPFGETYHIASSDGLI 82
           +KW D  L+WDP+ Y +I QI +AP++VW PD+  FN+A GN    F     I S+ G +
Sbjct: 93  MKWDDFQLKWDPRDYANITQIRVAPEKVWLPDIVLFNNADGNYEVSFMCNVLILST-GTV 151

Query: 83  SWVPPCQFQVYCRLDLTYWPFDSQVCELILGSWVYDGNNIDFHF 126
            WVPP  ++  C +D+ ++PFD Q+C L  GSW Y+ + I   F
Sbjct: 152 LWVPPAIYKSSCIIDVEFFPFDDQLCSLTFGSWTYNRDEIKLDF 195
Acetylcholine receptor.
Caenorhabditis elegans (taxid: 6239)
>sp|P48181|ACH2_CAEEL Acetylcholine receptor subunit beta-type unc-29 OS=Caenorhabditis elegans GN=unc-29 PE=2 SV=2 Back     alignment and function description
>sp|P48182|ACR2_CAEEL Acetylcholine receptor subunit beta-type acr-2 OS=Caenorhabditis elegans GN=acr-2 PE=2 SV=1 Back     alignment and function description
>sp|Q98880|ACHA_DANRE Acetylcholine receptor subunit alpha OS=Danio rerio GN=chrna1 PE=2 SV=1 Back     alignment and function description
>sp|P22456|ACHAA_XENLA Acetylcholine receptor subunit alpha-1-A OS=Xenopus laevis GN=chrna1-a PE=2 SV=1 Back     alignment and function description
>sp|Q93149|ACR3_CAEEL Acetylcholine receptor subunit beta-type acr-3 OS=Caenorhabditis elegans GN=acr-3 PE=2 SV=1 Back     alignment and function description
>sp|P05377|ACHAB_XENLA Acetylcholine receptor subunit alpha-1-B OS=Xenopus laevis GN=chrna1-b PE=2 SV=1 Back     alignment and function description
>sp|P09479|ACHA_CHICK Acetylcholine receptor subunit alpha OS=Gallus gallus GN=CHRNA1 PE=1 SV=1 Back     alignment and function description
>sp|Q8BMN3|ACHB3_MOUSE Neuronal acetylcholine receptor subunit beta-3 OS=Mus musculus GN=Chrnb3 PE=2 SV=1 Back     alignment and function description
>sp|P12391|ACHB3_RAT Neuronal acetylcholine receptor subunit beta-3 OS=Rattus norvegicus GN=Chrnb3 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query143
242007176 374 Acetylcholine receptor protein subunit a 0.699 0.267 0.51 4e-25
307203082 401 Neuronal acetylcholine receptor subunit 0.769 0.274 0.427 2e-23
242015231159 Acetylcholine receptor protein subunit a 0.650 0.584 0.526 3e-23
157954021 438 nicotinic acetylcholine receptor alpha 1 0.790 0.257 0.424 5e-22
227439271 313 nicotinic acetylcholine receptor a10 sub 0.790 0.361 0.424 6e-22
328698662 420 PREDICTED: acetylcholine receptor subuni 0.713 0.242 0.421 2e-21
307188901 281 Acetylcholine receptor subunit alpha-lik 0.699 0.355 0.45 4e-21
170032347 406 neuronal acetylcholine receptor subunit 0.727 0.256 0.423 8e-21
312381685 761 hypothetical protein AND_05955 [Anophele 0.853 0.160 0.363 9e-21
393909923 509 nicotinic acetylcholine receptor non-alp 0.797 0.223 0.406 1e-20
>gi|242007176|ref|XP_002424418.1| Acetylcholine receptor protein subunit alpha-type acr-16 precursor, putative [Pediculus humanus corporis] gi|212507818|gb|EEB11680.1| Acetylcholine receptor protein subunit alpha-type acr-16 precursor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  119 bits (298), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 69/100 (69%)

Query: 25  WYDPVLQWDPKKYGDIKQIYLAPQEVWQPDLSTFNSAGGNDVSPFGETYHIASSDGLISW 84
           W D  L+W+P  YGD+K+I+LA  EVWQPD+  +NSA G+ +  +G T  IA  +G + W
Sbjct: 37  WEDEKLKWNPSSYGDMKEIHLADHEVWQPDVFPYNSATGSTIDHYGNTNLIAYFNGTVIW 96

Query: 85  VPPCQFQVYCRLDLTYWPFDSQVCELILGSWVYDGNNIDF 124
           VPP  FQV+C++D T WPFDSQ C L +GSW Y+G  +D 
Sbjct: 97  VPPSIFQVFCQMDFTNWPFDSQTCSLKIGSWTYNGEQVDL 136

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|307203082|gb|EFN82262.1| Neuronal acetylcholine receptor subunit alpha-10 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|242015231|ref|XP_002428272.1| Acetylcholine receptor protein subunit alpha, putative [Pediculus humanus corporis] gi|212512847|gb|EEB15534.1| Acetylcholine receptor protein subunit alpha, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|157954021|ref|NP_001103247.1| nicotinic acetylcholine receptor alpha 10 subunit precursor [Tribolium castaneum] gi|154810991|gb|ABS86914.1| nicotinic acetylcholine receptor subunit alpha10 [Tribolium castaneum] gi|270006358|gb|EFA02806.1| nicotinic acetylcholine receptor subunit alpha10 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|227439271|gb|ACP31313.1| nicotinic acetylcholine receptor a10 subunit splice variant [Tribolium castaneum] Back     alignment and taxonomy information
>gi|328698662|ref|XP_001945064.2| PREDICTED: acetylcholine receptor subunit alpha-type acr-16-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|307188901|gb|EFN73450.1| Acetylcholine receptor subunit alpha-like 2 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|170032347|ref|XP_001844043.1| neuronal acetylcholine receptor subunit alpha-4 [Culex quinquefasciatus] gi|167872329|gb|EDS35712.1| neuronal acetylcholine receptor subunit alpha-4 [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|312381685|gb|EFR27375.1| hypothetical protein AND_05955 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|393909923|gb|EFO28037.2| nicotinic acetylcholine receptor non-alpha subunit [Loa loa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query143
WB|WBGene00000050 461 acr-11 [Caenorhabditis elegans 0.930 0.288 0.364 2.4e-20
UNIPROTKB|E1BRV4 352 CHRNA1 "Acetylcholine receptor 0.825 0.335 0.371 2.7e-20
FB|FBgn0037212 568 nAcRalpha-80B "nicotinic Acety 0.860 0.216 0.366 3.5e-20
UNIPROTKB|E1BT92 374 CHRNA1 "Acetylcholine receptor 0.825 0.315 0.371 3.9e-20
WB|WBGene00006765 493 unc-29 [Caenorhabditis elegans 0.713 0.206 0.409 6.4e-20
ZFIN|ZDB-GENE-980526-137 456 chrna1 "cholinergic receptor, 0.811 0.254 0.378 8.3e-20
UNIPROTKB|G5E9G9269 CHRNA1 "Acetylcholine receptor 0.972 0.516 0.326 9.2e-20
UNIPROTKB|P09479 456 CHRNA1 "Acetylcholine receptor 0.825 0.258 0.371 1.1e-19
UNIPROTKB|F1P208 467 CHRNA1 "Acetylcholine receptor 0.825 0.252 0.371 1.2e-19
FB|FBgn0032151 523 nAcRalpha-30D "nicotinic Acety 0.776 0.212 0.376 1.3e-19
WB|WBGene00000050 acr-11 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
 Score = 246 (91.7 bits), Expect = 2.4e-20, P = 2.4e-20
 Identities = 54/148 (36%), Positives = 83/148 (56%)

Query:     5 IQSILN----SKLVSYLTADIGVKWYDPVLQWDPKKYGDIKQIYL--APQEVWQPDLSTF 58
             +Q IL+    +++VS + A +   W+D  LQW+PKKYG I+ I    +   +W+PD+  +
Sbjct:    59 LQQILDVDEKNQIVS-VNAWLSYTWFDHKLQWEPKKYGGIQDIRFPGSSDHIWKPDVLLY 117

Query:    59 NSAGGNDVSPFGE---TYHIASSDGLISWVPPCQFQVYCRLDLTYWPFDSQVCELILGSW 115
             NSA  +  S F     TYH     G + W+PP   +  C+LD+T++PFD QVCE+  GSW
Sbjct:   118 NSAAEDFDSTFKSNLLTYHT----GTVVWIPPGVLKFVCQLDVTWFPFDDQVCEMKFGSW 173

Query:   116 VYDGNNIDFHFEDG-NWRMNGDASEFKI 142
              + G  ID   +D  N   + D S + +
Sbjct:   174 TFHGYAIDLQIDDDTNGTQSMDLSTYLV 201
GO:0004889 "acetylcholine-activated cation-selective channel activity" evidence=IEA
GO:0005216 "ion channel activity" evidence=IEA
GO:0006811 "ion transport" evidence=IEA
GO:0016021 "integral to membrane" evidence=IEA
GO:0045211 "postsynaptic membrane" evidence=IEA
GO:0016020 "membrane" evidence=IEA
GO:0005230 "extracellular ligand-gated ion channel activity" evidence=IEA
GO:0006810 "transport" evidence=IEA
GO:0007268 "synaptic transmission" evidence=IMP
GO:0045202 "synapse" evidence=IC
GO:0015464 "acetylcholine receptor activity" evidence=ISS
UNIPROTKB|E1BRV4 CHRNA1 "Acetylcholine receptor subunit alpha" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
FB|FBgn0037212 nAcRalpha-80B "nicotinic Acetylcholine Receptor alpha 80B" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|E1BT92 CHRNA1 "Acetylcholine receptor subunit alpha" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
WB|WBGene00006765 unc-29 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-980526-137 chrna1 "cholinergic receptor, nicotinic, alpha polypeptide 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|G5E9G9 CHRNA1 "Acetylcholine receptor subunit alpha" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P09479 CHRNA1 "Acetylcholine receptor subunit alpha" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1P208 CHRNA1 "Acetylcholine receptor subunit alpha" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
FB|FBgn0032151 nAcRalpha-30D "nicotinic Acetylcholine Receptor alpha 30D" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query143
pfam02931215 pfam02931, Neur_chan_LBD, Neurotransmitter-gated i 1e-32
TIGR00860 459 TIGR00860, LIC, Cation transporter family protein 2e-16
>gnl|CDD|217293 pfam02931, Neur_chan_LBD, Neurotransmitter-gated ion-channel ligand binding domain Back     alignment and domain information 
 Score =  114 bits (287), Expect = 1e-32
 Identities = 40/107 (37%), Positives = 57/107 (53%)

Query: 24  KWYDPVLQWDPKKYGDIKQIYLAPQEVWQPDLSTFNSAGGNDVSPFGETYHIASSDGLIS 83
           +W D  L WDP+ YG I  + L   ++W+PD+  +N A G        T      DG + 
Sbjct: 56  QWTDERLAWDPEDYGGITSLRLPSDKIWKPDIVLYNKADGIHDITTPNTNVRVYPDGTVL 115

Query: 84  WVPPCQFQVYCRLDLTYWPFDSQVCELILGSWVYDGNNIDFHFEDGN 130
           W PP  ++  C +DLTY+PFD Q C L  GSW Y+G  +D  ++D  
Sbjct: 116 WSPPAIYKSSCPMDLTYFPFDQQNCSLKFGSWTYNGEEVDLRWKDDT 162

This family is the extracellular ligand binding domain of these ion channels. This domain forms a pentameric arrangement in the known structure. Length = 215
>gnl|CDD|233155 TIGR00860, LIC, Cation transporter family protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 143
KOG3646|consensus 486 100.0
KOG3645|consensus 449 100.0
TIGR00860 459 LIC Cation transporter family protein. selective w 100.0
PF02931217 Neur_chan_LBD: Neurotransmitter-gated ion-channel 100.0
KOG3643|consensus 459 99.97
KOG3644|consensus 457 99.94
KOG3642|consensus 466 99.89
>KOG3646|consensus Back     alignment and domain information 
Probab=100.00  E-value=5e-40  Score=255.51  Aligned_cols=142  Identities=34%  Similarity=0.740  Sum_probs=129.9

Q ss_pred             CceEEEEeec---eeEEEEEeeeeeeEEEcCCceeCCCCCCCeeEEEECCCCcccCCccccccCCCCCCCCCcceEEEEe
Q psy12043          1 MPCIIQSILN---SKLVSYLTADIGVKWYDPVLQWDPKKYGDIKQIYLAPQEVWQPDLSTFNSAGGNDVSPFGETYHIAS   77 (143)
Q Consensus         1 ~~v~i~~i~~---~~~~~~~~~~l~~~W~D~rL~w~p~~~~~i~~i~~~~~~iW~Pdi~~~n~~~~~~~~~~~~~~v~v~   77 (143)
                      +++++|||++   +.+...+++|++++|+|.+|+|||++||||+.+++|.++||+||+.+||+++.+ ......+++.++
T Consensus        56 ~~~~lqQIidVDEKnQvl~~naWl~y~W~D~~LrW~pseygnI~dvR~p~~~iWkPDVLLYNSade~-FDsTy~tN~Vv~  134 (486)
T KOG3646|consen   56 LGVFLQQIIDVDEKNQVLSVNAWLQYQWNDYKLRWDPSEYGNITDIRFPGGNIWKPDVLLYNSADEQ-FDSTYKTNYVVY  134 (486)
T ss_pred             eeeeEeccCCCcccccchhhhhhhheeehhhhhccCHHHhCCceeeccCCccccCCceecccccccc-CCCcceeeEEEc
Confidence            4688999987   447788999999999999999999999999999999999999999999999842 334568999999


Q ss_pred             eCCeEEEecCcEEEEEecccccccCCccceEEEEEeccccCCCeEEEE-------------eecCcEEEEeeeEeEEeC
Q psy12043         78 SDGLISWVPPCQFQVYCRLDLTYWPFDSQVCELILGSWVYDGNNIDFH-------------FEDGNWRMNGDASEFKIK  143 (143)
Q Consensus        78 ~~G~V~~~~~~~~~~~C~~~~~~fPfD~q~C~l~f~s~~y~~~~v~l~-------------~~n~EW~l~~~~~~~~~~  143 (143)
                      ++|.|.|.||.+++++|.+|.+.||||.|.|.++||||+|+|..++|+             .+||||+|++.++...+|
T Consensus       135 ~tG~v~~vPPGIfk~sCkiDItwFPFD~Q~C~mKFGSWTY~G~~lDL~~~~~~g~~Dls~yi~NGEW~Ll~~pakr~~~  213 (486)
T KOG3646|consen  135 STGSVLWVPPGIFKSSCKIDITWFPFDDQVCYLKFGSWTYAGILLDLRIDDEDGGIDLSTYIPNGEWDLLGTPAKREEK  213 (486)
T ss_pred             cCCeeeecCCceeeeeeEEEEEEecccccEEEEEeeeEEEcceeeeeeeccccCCcchhhcccCCceeeccccccceee
Confidence            999999999999999999999999999999999999999999988876             689999999999876654

>KOG3645|consensus Back     alignment and domain information
>TIGR00860 LIC Cation transporter family protein Back     alignment and domain information
>PF02931 Neur_chan_LBD: Neurotransmitter-gated ion-channel ligand binding domain ion channel family signature gamma-aminobutyric acid (GABA) receptor signature nicotinic acetylcholine receptor signature; InterPro: IPR006202 Neurotransmitter ligand-gated ion channels are transmembrane receptor-ion channel complexes that open transiently upon binding of specific ligands, allowing rapid transmission of signals at chemical synapses [, ] Back     alignment and domain information
>KOG3643|consensus Back     alignment and domain information
>KOG3644|consensus Back     alignment and domain information
>KOG3642|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query143
4aq5_A 461 Gating Movement In Acetylcholine Receptor Analysed 3e-18
2bg9_A 370 Refined Structure Of The Nicotinic Acetylcholine Re 3e-18
2qc1_B212 Crystal Structure Of The Extracellular Domain Of Th 2e-17
4afg_A230 Capitella Teleta Achbp In Complex With Varenicline 2e-14
2bg9_B 370 Refined Structure Of The Nicotinic Acetylcholine Re 3e-13
4aq5_B 493 Gating Movement In Acetylcholine Receptor Analysed 5e-13
2bg9_C 369 Refined Structure Of The Nicotinic Acetylcholine Re 2e-12
4aq5_C 522 Gating Movement In Acetylcholine Receptor Analysed 5e-12
2bg9_E 370 Refined Structure Of The Nicotinic Acetylcholine Re 6e-10
4aq5_E 488 Gating Movement In Acetylcholine Receptor Analysed 6e-10
2ymd_A212 Crystal Structure Of A Mutant Binding Protein (5htb 1e-07
2xnt_A236 Acetylcholine Binding Protein (Achbp) As Template F 4e-07
2xz6_A217 Mtset-Modified Y53c Mutant Of Aplysia Achbp Length 4e-07
2xz5_A217 Mmts-Modified Y53c Mutant Of Aplysia Achbp In Compl 5e-07
2br7_A217 Crystal Structure Of Acetylcholine-Binding Protein 5e-07
2yme_A205 Crystal Structure Of A Mutant Binding Protein (5htb 6e-07
2byn_A227 Crystal Structure Of Apo Achbp From Aplysia Califor 6e-07
3pmz_A227 Crystal Structure Of The Complex Of Acetylcholine B 6e-07
2wn9_A228 Crystal Structure Of Aplysia Achbp In Complex With 6e-07
2x00_D227 Crystal Structure Of A-Achbp In Complex With Gymnod 7e-07
2pgz_A230 Crystal Structure Of Cocaine Bound To An Ach-bindin 7e-07
2byp_A214 Crystal Structure Of Aplysia Californica Achbp In C 7e-07
3gua_A217 Sulfates Bound In The Vestibule Of Achbp Length = 2 8e-07
3sq6_A204 Crystal Structures Of The Ligand Binding Domain Of 8e-07
3t4m_A230 Ac-Achbp Ligand Binding Domain Mutated To Human Alp 4e-06
4aod_A205 Biomphalaria Glabrata Acetylcholine-Binding Protein 3e-05
4ilc_A 320 The Glic Pentameric Ligand-gated Ion Channel In Com 3e-05
4il9_A 320 The Pentameric Ligand-gated Ion Channel Glic A237f 3e-05
2xq9_A 317 Pentameric Ligand Gated Ion Channel Glic Mutant E22 3e-05
3tlt_A 321 The Glic Pentameric Ligand-Gated Ion Channel H11'f 3e-05
3tlw_A 321 The Glic Pentameric Ligand-Gated Ion Channel Loop2- 3e-05
3tls_A 321 The Glic Pentameric Ligand-Gated Ion Channel E19'p 3e-05
3ei0_A 317 Structure Of The E221a Mutant Of The Gloebacter Vio 3e-05
3p4w_A 318 Structure Of Desflurane Bound To A Pentameric Ligan 3e-05
3lsv_A 317 Structure Of The A237f Mutant Of The Pentameric Lig 3e-05
3ehz_A 317 X-Ray Structure Of The Pentameric Ligand Gated Ion 3e-05
3tlv_A 321 The Glic Pentameric Ligand-Gated Ion Channel Loop2- 3e-05
3eam_A 317 An Open-Pore Structure Of A Bacterial Pentameric Li 3e-05
3uu3_A 321 The Glic Pentameric Ligand-Gated Ion Channel Loop2- 3e-05
3tlu_A 321 The Glic Pentameric Ligand-Gated Ion Channel Loop2- 3e-05
3sh1_A230 Ac-Achbp Ligand Binding Domain Mutated To Human Alp 4e-05
3sio_A230 Ac-Achbp Ligand Binding Domain (Not Including Beta 4e-05
>pdb|4AQ5|A Chain A, Gating Movement In Acetylcholine Receptor Analysed By Time- Resolved Electron Cryo-Microscopy (Closed Class) Length = 461 Back     alignment and structure 
Iteration: 1

 Score = 87.4 bits (215), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 45/122 (36%), Positives = 61/122 (50%), Gaps = 12/122 (9%)
Query: 24  KWYDPVLQWDPKKYGDIKQIYLAPQEVWQPDLSTFNSAGGNDVSPFGETYHIASSDGLIS 83
           +W D  L+W+P  YG IK+I L   +VW PDL  +N+A G D +    T  +    G I 
Sbjct: 83  QWIDVRLRWNPADYGGIKKIRLPSDDVWLPDLVLYNNADG-DFAIVHMTKLLLDYTGKIM 141
Query: 84  WVPPCQFQVYCRLDLTYWPFDSQVCELILGSWVYDGNNIDFH-----------FEDGNWR 132
           W PP  F+ YC + +T++PFD Q C + LG W YDG  +               E G W 
Sbjct: 142 WTPPAIFKSYCEIIVTHFPFDQQNCTMKLGIWTYDGTKVSISPESDRPDLSTFMESGEWV 201
Query: 133 MN 134
           M 
Sbjct: 202 MK 203
>pdb|2BG9|A Chain A, Refined Structure Of The Nicotinic Acetylcholine Receptor At 4a Resolution. Length = 370 Back     alignment and structure
>pdb|2QC1|B Chain B, Crystal Structure Of The Extracellular Domain Of The Nicotinic Acetylcholine Receptor 1 Subunit Bound To Alpha-Bungarotoxin At 1.9 A Resolution Length = 212 Back     alignment and structure
>pdb|4AFG|A Chain A, Capitella Teleta Achbp In Complex With Varenicline Length = 230 Back     alignment and structure
>pdb|2BG9|B Chain B, Refined Structure Of The Nicotinic Acetylcholine Receptor At 4a Resolution Length = 370 Back     alignment and structure
>pdb|4AQ5|B Chain B, Gating Movement In Acetylcholine Receptor Analysed By Time- Resolved Electron Cryo-Microscopy (Closed Class) Length = 493 Back     alignment and structure
>pdb|2BG9|C Chain C, Refined Structure Of The Nicotinic Acetylcholine Receptor At 4a Resolution Length = 369 Back     alignment and structure
>pdb|4AQ5|C Chain C, Gating Movement In Acetylcholine Receptor Analysed By Time- Resolved Electron Cryo-Microscopy (Closed Class) Length = 522 Back     alignment and structure
>pdb|2BG9|E Chain E, Refined Structure Of The Nicotinic Acetylcholine Receptor At 4a Resolution Length = 370 Back     alignment and structure
>pdb|4AQ5|E Chain E, Gating Movement In Acetylcholine Receptor Analysed By Time- Resolved Electron Cryo-Microscopy (Closed Class) Length = 488 Back     alignment and structure
>pdb|2YMD|A Chain A, Crystal Structure Of A Mutant Binding Protein (5htbp-achbp) In Complex With Serotonin (5-hydroxytryptamine) Length = 212 Back     alignment and structure
>pdb|2XNT|A Chain A, Acetylcholine Binding Protein (Achbp) As Template For Hierarchical In Silico Screening Procedures To Identify Structurally Novel Ligands For The Nicotinic Receptors Length = 236 Back     alignment and structure
>pdb|2XZ6|A Chain A, Mtset-Modified Y53c Mutant Of Aplysia Achbp Length = 217 Back     alignment and structure
>pdb|2XZ5|A Chain A, Mmts-Modified Y53c Mutant Of Aplysia Achbp In Complex With Acetylcholine Length = 217 Back     alignment and structure
>pdb|2BR7|A Chain A, Crystal Structure Of Acetylcholine-Binding Protein (Achbp) From Aplysia Californica In Complex With Hepes Length = 217 Back     alignment and structure
>pdb|2YME|A Chain A, Crystal Structure Of A Mutant Binding Protein (5htbp-achbp) In Complex With Granisetron Length = 205 Back     alignment and structure
>pdb|2BYN|A Chain A, Crystal Structure Of Apo Achbp From Aplysia Californica Length = 227 Back     alignment and structure
>pdb|3PMZ|A Chain A, Crystal Structure Of The Complex Of Acetylcholine Binding Protein And D-Tubocurarine Length = 227 Back     alignment and structure
>pdb|2WN9|A Chain A, Crystal Structure Of Aplysia Achbp In Complex With 4-0h- Dmxba Length = 228 Back     alignment and structure
>pdb|2X00|D Chain D, Crystal Structure Of A-Achbp In Complex With Gymnodimine A Length = 227 Back     alignment and structure
>pdb|2PGZ|A Chain A, Crystal Structure Of Cocaine Bound To An Ach-binding Protein Length = 230 Back     alignment and structure
>pdb|2BYP|A Chain A, Crystal Structure Of Aplysia Californica Achbp In Complex With Alpha-Conotoxin Imi Length = 214 Back     alignment and structure
>pdb|3GUA|A Chain A, Sulfates Bound In The Vestibule Of Achbp Length = 217 Back     alignment and structure
>pdb|3SQ6|A Chain A, Crystal Structures Of The Ligand Binding Domain Of A Pentameric Alpha7 Nicotinic Receptor Chimera With Its Agonist Epibatidine Length = 204 Back     alignment and structure
>pdb|3T4M|A Chain A, Ac-Achbp Ligand Binding Domain Mutated To Human Alpha-7 Nachr (Intermediate) Length = 230 Back     alignment and structure
>pdb|4AOD|A Chain A, Biomphalaria Glabrata Acetylcholine-Binding Protein Type 1 (Bgachbp1) Length = 205 Back     alignment and structure
>pdb|4ILC|A Chain A, The Glic Pentameric Ligand-gated Ion Channel In Complex With Sulfates Length = 320 Back     alignment and structure
>pdb|4IL9|A Chain A, The Pentameric Ligand-gated Ion Channel Glic A237f In Complex With Bromide Length = 320 Back     alignment and structure
>pdb|2XQ9|A Chain A, Pentameric Ligand Gated Ion Channel Glic Mutant E221a In Complex With Tetraethylarsonium (Teas) Length = 317 Back     alignment and structure
>pdb|3TLT|A Chain A, The Glic Pentameric Ligand-Gated Ion Channel H11'f Mutant In A Locally-Closed Conformation (Lc1 Subtype) Length = 321 Back     alignment and structure
>pdb|3TLW|A Chain A, The Glic Pentameric Ligand-Gated Ion Channel Loop2-21' Oxidized Mutant In A Locally-Closed Conformation (Lc2 Subtype) Length = 321 Back     alignment and structure
>pdb|3TLS|A Chain A, The Glic Pentameric Ligand-Gated Ion Channel E19'p Mutant In A Locally-Closed Conformation (Lc2 Subtype) Length = 321 Back     alignment and structure
>pdb|3EI0|A Chain A, Structure Of The E221a Mutant Of The Gloebacter Violaceus Pentameric Ligand Gated Ion Channnel (Glic) Length = 317 Back     alignment and structure
>pdb|3P4W|A Chain A, Structure Of Desflurane Bound To A Pentameric Ligand-Gated Ion Channel, Glic Length = 318 Back     alignment and structure
>pdb|3LSV|A Chain A, Structure Of The A237f Mutant Of The Pentameric Ligand Gated Channel From Gloeobacter Violaceus Length = 317 Back     alignment and structure
>pdb|3EHZ|A Chain A, X-Ray Structure Of The Pentameric Ligand Gated Ion Channel Of Gloebacter Violaceus (Glic) In A Presumptive Open Conformation Length = 317 Back     alignment and structure
>pdb|3TLV|A Chain A, The Glic Pentameric Ligand-Gated Ion Channel Loop2-22' Oxidized Mutant In A Locally-Closed Conformation (Lc3 Subtype) Length = 321 Back     alignment and structure
>pdb|3EAM|A Chain A, An Open-Pore Structure Of A Bacterial Pentameric Ligand- Gated Ion Channel Length = 317 Back     alignment and structure
>pdb|3UU3|A Chain A, The Glic Pentameric Ligand-Gated Ion Channel Loop2-20' Oxidized Mutant In A Locally-Closed Conformation (Lc1 Subtype) Length = 321 Back     alignment and structure
>pdb|3TLU|A Chain A, The Glic Pentameric Ligand-Gated Ion Channel Loop2-24' Oxidized Mutant In A Locally-Closed Conformation (Lc1 Subtype) Length = 321 Back     alignment and structure
>pdb|3SH1|A Chain A, Ac-Achbp Ligand Binding Domain Mutated To Human Alpha-7 Nachr Length = 230 Back     alignment and structure
>pdb|3SIO|A Chain A, Ac-Achbp Ligand Binding Domain (Not Including Beta 9-10 Linker) Mutated To Human Alpha-7 Nachr Length = 230 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query143
2qc1_B212 Acetylcholine receptor subunit alpha; nicotinic ac 2e-36
2bg9_A 370 Acetylcholine receptor protein, alpha chain; ION c 3e-35
2bg9_C 369 Acetylcholine receptor protein, delta chain; ION c 2e-34
2bg9_E 370 Acetylcholine receptor protein, gamma chain; ION c 3e-34
2bg9_B 370 Acetylcholine receptor protein, beta chain; ION ch 6e-34
3sq6_A204 ACHBP, neuronal acetylcholine receptor subunit alp 6e-33
4aq5_A 461 Acetylcholine receptor subunit alpha; membrane pro 2e-32
4aq5_C 522 Acetylcholine receptor delta subunit; membrane pro 2e-32
2wn9_A228 Soluble acetylcholine receptor; 4-0H-DMXBA, acetyl 2e-31
4aq5_B 493 Acetylcholine receptor beta subunit; membrane prot 2e-31
4aq5_E 488 Acetylcholine receptor gamma subunit; membrane pro 5e-31
4afh_A230 ACHBP; acetylcholine-binding protein, nicotinic re 3e-29
1uw6_A211 Acetylcholine-binding protein; pentamer, IGG fold, 2e-28
2bj0_A203 Acetylcholine-binding protein; 3D-structure, glyco 1e-26
3tlw_A 321 GLR4197 protein, GLIC; Cys-loop receptor family, m 1e-24
3igq_A201 GLR4197 protein; plgic Cys-loop, membrane protein, 2e-24
3rhw_A 347 Avermectin-sensitive glutamate-gated chloride CHA 1e-21
3rqw_A 322 ELIC pentameric ligand gated ION channel from ERW 6e-20
>2qc1_B Acetylcholine receptor subunit alpha; nicotinic acetylcholine receptor, glycosylated protein, beta sandwich, Cys-loop, buried hydrophilic residues; HET: NAG MAN; 1.94A {Mus musculus} PDB: 1l4w_B 1ljz_B Length = 212 Back     alignment and structure
 Score =  123 bits (310), Expect = 2e-36
 Identities = 36/105 (34%), Positives = 63/105 (60%), Gaps = 1/105 (0%)

Query: 24  KWYDPVLQWDPKKYGDIKQIYLAPQEVWQPDLSTFNSAGGNDVSPFGETYHIASSDGLIS 83
           +W D  L+W+P  YG +K+I++  +++W+PD+  +N+A G+       T  +    G I+
Sbjct: 60  QWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDVVLYNNADGDFAIVK-FTKVLLDYTGHIT 118

Query: 84  WVPPCQFQVYCRLDLTYWPFDSQVCELILGSWVYDGNNIDFHFED 128
           W PP  F+ YC + +T++PFD Q C + LG+  YDG+ +  + E 
Sbjct: 119 WTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTRTYDGSAVAINPES 163
>2bg9_A Acetylcholine receptor protein, alpha chain; ION channel/receptor, ION channel, electron microscopy, ION transport, postsynaptic membrane; 4.00A {Torpedo marmorata} Length = 370 Back     alignment and structure
>2bg9_C Acetylcholine receptor protein, delta chain; ION channel/receptor, ION channel, electron microscopy, ION transport, postsynaptic membrane; 4.00A {Torpedo marmorata} Length = 369 Back     alignment and structure
>2bg9_E Acetylcholine receptor protein, gamma chain; ION channel/receptor, ION channel, electron microscopy, ION transport, postsynaptic membrane; 4.00A {Torpedo marmorata} Length = 370 Back     alignment and structure
>2bg9_B Acetylcholine receptor protein, beta chain; ION channel/receptor, ION channel, electron microscopy, ION transport, postsynaptic membrane; 4.00A {Torpedo marmorata} Length = 370 Back     alignment and structure
>3sq6_A ACHBP, neuronal acetylcholine receptor subunit alpha-7, acetylcholine-binding protein; nicotinic receptor; HET: EPJ NAG; 2.80A {Homo sapiens} PDB: 3sq9_A* Length = 204 Back     alignment and structure
>4aq5_A Acetylcholine receptor subunit alpha; membrane protein, freeze-trapping, asymmetric gating, allost mechanism; 6.20A {Torpedo marmorata} PDB: 4aq9_A Length = 461 Back     alignment and structure
>4aq5_C Acetylcholine receptor delta subunit; membrane protein, freeze-trapping, asymmetric gating, allost mechanism; 6.20A {Torpedo marmorata} PDB: 4aq9_C Length = 522 Back     alignment and structure
>2wn9_A Soluble acetylcholine receptor; 4-0H-DMXBA, acetylcholine binding protein; HET: ZY5 NAG BMA MAN; 1.75A {Aplysia californica} PDB: 2wnj_A* 2wzy_A* 2x00_A* 3peo_A* 2pgz_A* 2ph9_A* 4dbm_A* 3c84_A* 2byq_A* 2byr_A* 2bys_A* 2wnc_A* 2wnl_A* 3c79_A* 2byn_A* 3pmz_A* 2x00_D* 2xnv_A* 2xnt_A* 2xnu_A* ... Length = 228 Back     alignment and structure
>4aq5_B Acetylcholine receptor beta subunit; membrane protein, freeze-trapping, asymmetric gating, allost mechanism; 6.20A {Torpedo marmorata} PDB: 4aq9_B Length = 493 Back     alignment and structure
>4aq5_E Acetylcholine receptor gamma subunit; membrane protein, freeze-trapping, asymmetric gating, allost mechanism; 6.20A {Torpedo marmorata} PDB: 4aq9_E Length = 488 Back     alignment and structure
>4afh_A ACHBP; acetylcholine-binding protein, nicotinic receptor, ION chann; HET: NAG BMA MAN L0B; 1.88A {Capitella teleta} PDB: 4afg_A* Length = 230 Back     alignment and structure
>1uw6_A Acetylcholine-binding protein; pentamer, IGG fold, nicotine, glycoprotein; HET: NCT; 2.2A {Lymnaea stagnalis} SCOP: b.96.1.1 PDB: 1i9b_A* 1ux2_A* 3u8l_A* 1yi5_A 1uv6_A* 3u8k_A* 3u8j_B* 3u8m_A* 3u8n_A* 2zju_A* 2zjv_A* Length = 211 Back     alignment and structure
>2bj0_A Acetylcholine-binding protein; 3D-structure, glycoprotein, glycprotein, IGG fold, immunoglobulin domain, pentamer, signal; HET: CXS; 2.0A {Bulinus truncatus} Length = 203 Back     alignment and structure
>3tlw_A GLR4197 protein, GLIC; Cys-loop receptor family, membrane protein, transport protei; HET: LMT; 2.60A {Gloeobacter violaceus} PDB: 3uu4_A* 3uub_A* 3tlv_A* 3uu6_A* 3uu5_A* 3uu3_A* 3tlu_A* 3uu8_A* 3tls_A* 3tlt_A* 3p4w_A* 3p50_A* 3eam_A* 3ehz_A 2xq4_A 2xq5_A 2xq6_A 2xq3_A 2xq8_A 2xqa_A ... Length = 321 Back     alignment and structure
>3igq_A GLR4197 protein; plgic Cys-loop, membrane protein, transport protein; 2.30A {Gloeobacter violaceus} Length = 201 Back     alignment and structure
>3rhw_A Avermectin-sensitive glutamate-gated chloride CHA alpha; membrane protein, transport protein, Cys-loop receptor, LIGA ION channel, neurotransmitter receptor; HET: NAG IVM LMT UND; 3.26A {Caenorhabditis elegans} PDB: 3ri5_A* 3ria_A* 3rif_A* Length = 347 Back     alignment and structure
>3rqw_A ELIC pentameric ligand gated ION channel from ERW chrysanthemi; membrane, transport protein; HET: ACH MES; 2.91A {Dickeya dadantii} PDB: 3rqu_A* 3uq4_A 3uq5_A 3uq7_A 2vl0_A 2yks_A Length = 322 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query143
4aoe_A205 Acetylcholine-binding protein type 2; ligand gated 100.0
4aod_A205 Acetylcholine-binding protein type 1; ligand gated 100.0
3sq6_A204 ACHBP, neuronal acetylcholine receptor subunit alp 100.0
2qc1_B212 Acetylcholine receptor subunit alpha; nicotinic ac 100.0
3igq_A201 GLR4197 protein; plgic Cys-loop, membrane protein, 100.0
2bg9_C 369 Acetylcholine receptor protein, delta chain; ION c 100.0
4aq5_A 461 Acetylcholine receptor subunit alpha; membrane pro 100.0
2bg9_A 370 Acetylcholine receptor protein, alpha chain; ION c 100.0
2bg9_B 370 Acetylcholine receptor protein, beta chain; ION ch 100.0
3tlw_A 321 GLR4197 protein, GLIC; Cys-loop receptor family, m 100.0
2bg9_E 370 Acetylcholine receptor protein, gamma chain; ION c 100.0
4afh_A230 ACHBP; acetylcholine-binding protein, nicotinic re 100.0
4aq5_C 522 Acetylcholine receptor delta subunit; membrane pro 100.0
2wn9_A228 Soluble acetylcholine receptor; 4-0H-DMXBA, acetyl 100.0
2bj0_A203 Acetylcholine-binding protein; 3D-structure, glyco 100.0
3rhw_A 347 Avermectin-sensitive glutamate-gated chloride CHA 100.0
4aq5_E 488 Acetylcholine receptor gamma subunit; membrane pro 100.0
1uw6_A211 Acetylcholine-binding protein; pentamer, IGG fold, 100.0
4aq5_B 493 Acetylcholine receptor beta subunit; membrane prot 100.0
3rqw_A 322 ELIC pentameric ligand gated ION channel from ERW 99.97
>4aoe_A Acetylcholine-binding protein type 2; ligand gated ION channel, LGI Cys-loop receptor, ACHBP, ACHR, acetylcholin receptor; 5.80A {Biomphalaria glabrata} Back     alignment and structure
Probab=100.00  E-value=8.2e-42  Score=247.32  Aligned_cols=136  Identities=18%  Similarity=0.407  Sum_probs=121.6

Q ss_pred             eEEEEeec---eeEEEEEeeeeeeEEEcCCceeCCCCCCCeeEEEECCCCcccCCccccccCCCCCCCCCcceEEEEeeC
Q psy12043          3 CIIQSILN---SKLVSYLTADIGVKWYDPVLQWDPKKYGDIKQIYLAPQEVWQPDLSTFNSAGGNDVSPFGETYHIASSD   79 (143)
Q Consensus         3 v~i~~i~~---~~~~~~~~~~l~~~W~D~rL~w~p~~~~~i~~i~~~~~~iW~Pdi~~~n~~~~~~~~~~~~~~v~v~~~   79 (143)
                      +.|++|++   ..+.+++++|+++.|+|+||+||| +|+|++.+.+++++||+||++++|+++.  ........+.|+++
T Consensus        35 l~l~~i~~vde~~q~~~~~~wl~~~W~D~rL~W~~-~~~~i~~i~v~~~~IW~PDi~l~N~~~~--~~~~~~~~v~v~~~  111 (205)
T 4aoe_A           35 YSLQDIYTADVGTDQVELGLWLVISWKDRSLSWSN-ECTTFNELTLPSKYIWLPHIEVYNSIGK--PGIHSDQLVRVYKD  111 (205)
T ss_dssp             EEEEEEEEEETTTTEEEEEEEEEEEEECCCCCCSC-CCSCCCEEEEEGGGSCCCCCEETTBSSC--CEECSCCEEEEETT
T ss_pred             EEEEEeeeEcccCCEEEEEEEEEEEEECCccccCC-cCCCccEEEeCHHHhccccEEEeccccc--cccccceEEEEeCC
Confidence            34555554   568889999999999999999998 7999999999999999999999998863  33345788999999


Q ss_pred             CeEEEecCcEEEEEecccccccCCccceEEEEEeccccCCCeEEEE----------eecCcEEEEeeeEeEEe
Q psy12043         80 GLISWVPPCQFQVYCRLDLTYWPFDSQVCELILGSWVYDGNNIDFH----------FEDGNWRMNGDASEFKI  142 (143)
Q Consensus        80 G~V~~~~~~~~~~~C~~~~~~fPfD~q~C~l~f~s~~y~~~~v~l~----------~~n~EW~l~~~~~~~~~  142 (143)
                      |+|.|.+|++++++|+|+ ..||||+|+|.|+||||+|++.+|+|.          .+||||+|+++++....
T Consensus       112 G~V~~~~~~~~~s~C~~d-~~fPfD~Q~C~l~fgSw~y~~~~l~l~~~~~~dl~~~~~n~EW~l~~~~~~r~~  183 (205)
T 4aoe_A          112 GTVTFVPQYTIRFSCALE-NVTTEQGAACTLKFGPWTYDVRDLVLDESQQVDLTTYAGGERFQLIEAKQKVNK  183 (205)
T ss_dssp             SEEEECCEEEEEEECCCT-TSSSSSCEEEEEEEECSSCCTTTEEEECSSSCBCTTSCTTCSEEEEEEEEEEEE
T ss_pred             cEEEEeCcEEEEEecccC-cCCCccCCeEEEEEECccCChheEEEecCcccchhccccCCcEEEEeeEEEEEE
Confidence            999999999999999999 889999999999999999999999997          68999999999887654
>4aod_A Acetylcholine-binding protein type 1; ligand gated ION channel, LGI Cys-loop receptor, ACHBP, ACHR, acetylcholine receptor; 6.00A {Biomphalaria glabrata} Back     alignment and structure
>3sq6_A ACHBP, neuronal acetylcholine receptor subunit alpha-7, acetylcholine-binding protein; nicotinic receptor; HET: EPJ NAG; 2.80A {Homo sapiens} SCOP: b.96.1.1 PDB: 3sq9_A* Back     alignment and structure
>2qc1_B Acetylcholine receptor subunit alpha; nicotinic acetylcholine receptor, glycosylated protein, beta sandwich, Cys-loop, buried hydrophilic residues; HET: NAG MAN; 1.94A {Mus musculus} PDB: 1l4w_B 1ljz_B Back     alignment and structure
>3igq_A GLR4197 protein; plgic Cys-loop, membrane protein, transport protein; 2.30A {Gloeobacter violaceus} Back     alignment and structure
>2bg9_C Acetylcholine receptor protein, delta chain; ION channel/receptor, ION channel, electron microscopy, ION transport, postsynaptic membrane; 4.00A {Torpedo marmorata} Back     alignment and structure
>4aq5_A Acetylcholine receptor subunit alpha; membrane protein, freeze-trapping, asymmetric gating, allost mechanism; 6.20A {Torpedo marmorata} PDB: 4aq9_A Back     alignment and structure
>2bg9_A Acetylcholine receptor protein, alpha chain; ION channel/receptor, ION channel, electron microscopy, ION transport, postsynaptic membrane; 4.00A {Torpedo marmorata} Back     alignment and structure
>2bg9_B Acetylcholine receptor protein, beta chain; ION channel/receptor, ION channel, electron microscopy, ION transport, postsynaptic membrane; 4.00A {Torpedo marmorata} Back     alignment and structure
>3tlw_A GLR4197 protein, GLIC; Cys-loop receptor family, membrane protein, transport protei; HET: LMT; 2.60A {Gloeobacter violaceus} PDB: 3uu4_A* 3uub_A* 3tlv_A* 3uu6_A* 3uu5_A* 3uu3_A* 3tlu_A* 3uu8_A* 3tls_A* 3tlt_A* 3p4w_A* 3p50_A* 3eam_A* 4f8h_A* 2xq4_A 2xq5_A 2xq6_A 2xq3_A 2xq8_A 2xqa_A ... Back     alignment and structure
>2bg9_E Acetylcholine receptor protein, gamma chain; ION channel/receptor, ION channel, electron microscopy, ION transport, postsynaptic membrane; 4.00A {Torpedo marmorata} Back     alignment and structure
>4afh_A ACHBP; acetylcholine-binding protein, nicotinic receptor, ION chann; HET: NAG BMA MAN L0B; 1.88A {Capitella teleta} PDB: 4afg_A* 4b5d_A* Back     alignment and structure
>4aq5_C Acetylcholine receptor delta subunit; membrane protein, freeze-trapping, asymmetric gating, allost mechanism; 6.20A {Torpedo marmorata} PDB: 4aq9_C Back     alignment and structure
>2wn9_A Soluble acetylcholine receptor; 4-0H-DMXBA, acetylcholine binding protein; HET: ZY5 NAG BMA MAN; 1.75A {Aplysia californica} PDB: 2wnj_A* 2wzy_A* 2x00_A* 3peo_A* 2pgz_A* 2ph9_A* 4dbm_A* 3c84_A* 2byq_A* 2byr_A* 2bys_A* 2wnc_A* 2wnl_A* 3c79_A* 2byn_A* 3pmz_A* 2x00_D* 2xnv_A* 2xnt_A* 2xnu_A* ... Back     alignment and structure
>2bj0_A Acetylcholine-binding protein; 3D-structure, glycoprotein, glycprotein, IGG fold, immunoglobulin domain, pentamer, signal; HET: CXS; 2.0A {Bulinus truncatus} Back     alignment and structure
>3rhw_A Avermectin-sensitive glutamate-gated chloride CHA alpha; membrane protein, transport protein, Cys-loop receptor, LIGA ION channel, neurotransmitter receptor; HET: NAG IVM LMT UND; 3.26A {Caenorhabditis elegans} PDB: 3ri5_A* 3ria_A* 3rif_A* Back     alignment and structure
>4aq5_E Acetylcholine receptor gamma subunit; membrane protein, freeze-trapping, asymmetric gating, allost mechanism; 6.20A {Torpedo marmorata} PDB: 4aq9_E Back     alignment and structure
>1uw6_A Acetylcholine-binding protein; pentamer, IGG fold, nicotine, glycoprotein; HET: NCT; 2.2A {Lymnaea stagnalis} SCOP: b.96.1.1 PDB: 1i9b_A* 1ux2_A* 3u8l_A* 1yi5_A 1uv6_A* 3u8k_A* 3u8j_B* 3u8m_A* 3u8n_A* 2zju_A* 2zjv_A* Back     alignment and structure
>4aq5_B Acetylcholine receptor beta subunit; membrane protein, freeze-trapping, asymmetric gating, allost mechanism; 6.20A {Torpedo marmorata} PDB: 4aq9_B Back     alignment and structure
>3rqw_A ELIC pentameric ligand gated ION channel from ERW chrysanthemi; membrane, transport protein; HET: ACH MES; 2.91A {Dickeya dadantii} PDB: 2yn6_A* 3rqu_A* 3uq4_A 3uq5_A 3uq7_A 2vl0_A 2yks_A 4a97_A* 4a96_A* 2yoe_A* 4a98_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 143
d1uw6a_208 b.96.1.1 (A:) Acetylcholine binding protein (ACHBP 6e-14
>d1uw6a_ b.96.1.1 (A:) Acetylcholine binding protein (ACHBP) {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]} Length = 208 Back     information, alignment and structure

class: All beta proteins
fold: Nicotinic receptor ligand binding domain-like
superfamily: Nicotinic receptor ligand binding domain-like
family: Nicotinic receptor ligand binding domain-like
domain: Acetylcholine binding protein (ACHBP)
species: Great pond snail (Lymnaea stagnalis) [TaxId: 6523]

 Score = 63.6 bits (154), Expect = 6e-14
 Identities = 22/107 (20%), Positives = 39/107 (36%), Gaps = 5/107 (4%)

Query: 24  KWYDPVLQWDPKKYGDIKQIYLAPQEVWQPDLSTFNSAGGNDVSPFGETYHIASSDGLIS 83
            W D  L W+     D   + +    +W PDL+ +N+    +V           SDG + 
Sbjct: 58  TWSDRTLAWNSSHSPDQ--VSVPISSLWVPDLAAYNAISKPEVLTP--QLARVVSDGEVL 113

Query: 84  WVPPCQFQVYCRLDLTYWPFDSQVCELILGSWVYDGNNIDFHFEDGN 130
           ++P  + +  C +           C + +GSW +    I       N
Sbjct: 114 YMPSIRQRFSCDVSGVDTESG-ATCRIKIGSWTHHSREISVDPTTEN 159

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query143
d1uw6a_208 Acetylcholine binding protein (ACHBP) {Great pond 100.0
>d1uw6a_ b.96.1.1 (A:) Acetylcholine binding protein (ACHBP) {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]} Back     information, alignment and structure
class: All beta proteins
fold: Nicotinic receptor ligand binding domain-like
superfamily: Nicotinic receptor ligand binding domain-like
family: Nicotinic receptor ligand binding domain-like
domain: Acetylcholine binding protein (ACHBP)
species: Great pond snail (Lymnaea stagnalis) [TaxId: 6523]

Probab=100.00  E-value=8.8e-37  Score=219.80  Aligned_cols=131  Identities=15%  Similarity=0.303  Sum_probs=114.4

Q ss_pred             EeeceeEEEEEeeeeeeEEEcCCceeCCCCCCCeeEEEECCCCcccCCccccccCCCCCCCCCcceEEEEeeCCeEEEec
Q psy12043          7 SILNSKLVSYLTADIGVKWYDPVLQWDPKKYGDIKQIYLAPQEVWQPDLSTFNSAGGNDVSPFGETYHIASSDGLISWVP   86 (143)
Q Consensus         7 ~i~~~~~~~~~~~~l~~~W~D~rL~w~p~~~~~i~~i~~~~~~iW~Pdi~~~n~~~~~~~~~~~~~~v~v~~~G~V~~~~   86 (143)
                      .+.+..+++.+++|+++.|+|+||+|||++|+++  +.++.++||+||++++|+++.  ........+.|+++|+|.|.+
T Consensus        41 ~vde~~q~~~~~~~~~~~W~D~rL~Wnp~~~~~~--~~v~~~~iW~PDi~l~n~~~~--~~~~~~~~~~v~~~G~V~~~~  116 (208)
T d1uw6a_          41 EVNEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQ--VSVPISSLWVPDLAAYNAISK--PEVLTPQLARVVSDGEVLYMP  116 (208)
T ss_dssp             EEETTTTEEEEEEEEEEEEECGGGCCCCTTSCSE--EEEEGGGSCCCCEEETTBCSC--CEECSCCEEEEETTSEEEECC
T ss_pred             eecccCCEEEEEEEEEEEEECCccccccccCCce--eccchhccccccEEEEEEccc--cccccceEEEEEeCCcEEEEe
Confidence            3444678899999999999999999999998864  677889999999999998773  233456789999999999999


Q ss_pred             CcEEEEEecccccccCCccceEEEEEeccccCCCeEEEE------------eecCcEEEEeeeEeEEe
Q psy12043         87 PCQFQVYCRLDLTYWPFDSQVCELILGSWVYDGNNIDFH------------FEDGNWRMNGDASEFKI  142 (143)
Q Consensus        87 ~~~~~~~C~~~~~~fPfD~q~C~l~f~s~~y~~~~v~l~------------~~n~EW~l~~~~~~~~~  142 (143)
                      ++++++.|.|++..|| |+|+|.|+||||+|++.+|++.            .+||||+|+++.+..+.
T Consensus       117 ~~~~~~~C~~~~~~f~-d~Q~C~l~fgSw~y~~~~i~l~~~~~~~~~~~~~~~~~eW~l~~~~~~~~~  183 (208)
T d1uw6a_         117 SIRQRFSCDVSGVDTE-SGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVTQKKNS  183 (208)
T ss_dssp             EEEEEEECCCTTTTSS-SCEEEEEEEEESSCCTTTEEEEECCCSSCTTTTSCTTSSEEEEEEEEEEEE
T ss_pred             cEEEEEeccccccCCc-ceEEEEEEEeCceeccceEEEeeccCCCccccccccCCCEEEEEeEEEEEE
Confidence            9999999999987777 8999999999999999999997            57899999999887654