Psyllid ID: psy12095


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13
MKLEYDFNANSLSVTVIQAEDLPALDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLNPVFNETFVFKGVPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVALCQIDLAQTIEEWRELQSVEGEGGQLL
cEEEEEccccEEEEEEEEcccccccccccccccEEEEEEEcccccEEEEcEEccccccccccEEEEcccccccccccEEEEEEEEccccccccEEEEEEEEccccccccccccEEEcccccccccccc
ccEEEEccccEEEEEEEEEEccccccccccccEEEEEEEEccccccEEccccccccccEEEEEEEEccccHHHHcccEEEEEEEEcccccccEEEEEEEEEHHHccccccEEEEEEcEcccccccccc
mkleydfnanslsVTVIqaedlpaldmggtsdpyvkvyllpdkkkkfETKVHrktlnpvfnetfvfkgvpyadaMNKTLVFAIFdfdrfskhdqiGEVKVALCQIDLAQTIEEWRELQSVEGEGGQLL
mkleydfnanSLSVTVIQAEDLPALDMGGTSDPYVKVYLLPDKKKkfetkvhrktlnpvfnetFVFKGVPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVALCQIDLAQTIEEWRELqsvegeggqll
MKLEYDFNANSLSVTVIQAEDLPALDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLNPVFNETFVFKGVPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVALCQIDLAQTIEEWRELQSVEGEGGQLL
******FNANSLSVTVIQAEDLPALDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLNPVFNETFVFKGVPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVALCQIDLAQTIEEWRE************
MKLEYDFNANSLSVTVIQAEDLPALDMGGTSDPYVKVYLLPDKK*KFETKVHRKTLNPVFNETFVFKGVPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVALCQIDLAQTIEEWR*************
MKLEYDFNANSLSVTVIQAEDLPALDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLNPVFNETFVFKGVPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVALCQIDLAQTIEEWREL***********
MKLEYDFNANSLSVTVIQAEDLPALDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLNPVFNETFVFKGVPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVALCQIDLAQTIEEWRELQSV********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKLEYDFNANSLSVTVIQAEDLPALDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLNPVFNETFVFKGVPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVALCQIDLAQTIEEWRELQSVEGEGGQLL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query128 2.2.26 [Sep-21-2011]
P21521 474 Synaptotagmin 1 OS=Drosop yes N/A 0.937 0.253 0.912 5e-64
P46097 422 Synaptotagmin-2 OS=Mus mu yes N/A 0.937 0.284 0.735 1e-46
Q8N9I0 419 Synaptotagmin-2 OS=Homo s yes N/A 0.937 0.286 0.735 2e-46
P29101 422 Synaptotagmin-2 OS=Rattus yes N/A 0.937 0.284 0.735 2e-46
P41823 428 Synaptotagmin-1 OS=Aplysi N/A N/A 0.937 0.280 0.694 4e-45
P47191 424 Synaptotagmin-1 OS=Gallus no N/A 0.937 0.283 0.702 2e-44
P24506 439 Synaptotagmin-B OS=Diplob N/A N/A 0.937 0.273 0.677 3e-44
Q5R4J5 419 Synaptotagmin-1 OS=Pongo yes N/A 0.937 0.286 0.702 4e-44
P21579 422 Synaptotagmin-1 OS=Homo s no N/A 0.937 0.284 0.702 4e-44
P48018 422 Synaptotagmin-1 OS=Bos ta no N/A 0.937 0.284 0.702 4e-44
>sp|P21521|SY65_DROME Synaptotagmin 1 OS=Drosophila melanogaster GN=Syt1 PE=1 SV=2 Back     alignment and function desciption
 Score =  242 bits (618), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 120/125 (96%)

Query: 2   KLEYDFNANSLSVTVIQAEDLPALDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLNPVFN 61
           KLEYDFN+NSL+VTVIQAE+LPALDMGGTSDPYVKVYLLPDKKKKFETKVHRKTL+PVFN
Sbjct: 199 KLEYDFNSNSLAVTVIQAEELPALDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLSPVFN 258

Query: 62  ETFVFKGVPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVALCQIDLAQTIEEWRELQSVE 121
           ETF FK +PYADAMNKTLVFAIFDFDRFSKHDQIGEVKV LC IDLAQTIEEWR+L SVE
Sbjct: 259 ETFTFKSLPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVPLCTIDLAQTIEEWRDLVSVE 318

Query: 122 GEGGQ 126
           GEGGQ
Sbjct: 319 GEGGQ 323




May have a regulatory role in the membrane interactions during trafficking of synaptic vesicles at the active zone of the synapse. It binds acidic phospholipids with a specificity that requires the presence of both an acidic head group and a diacyl backbone.
Drosophila melanogaster (taxid: 7227)
>sp|P46097|SYT2_MOUSE Synaptotagmin-2 OS=Mus musculus GN=Syt2 PE=1 SV=1 Back     alignment and function description
>sp|Q8N9I0|SYT2_HUMAN Synaptotagmin-2 OS=Homo sapiens GN=SYT2 PE=1 SV=2 Back     alignment and function description
>sp|P29101|SYT2_RAT Synaptotagmin-2 OS=Rattus norvegicus GN=Syt2 PE=1 SV=1 Back     alignment and function description
>sp|P41823|SY65_APLCA Synaptotagmin-1 OS=Aplysia californica GN=SYT1 PE=1 SV=2 Back     alignment and function description
>sp|P47191|SYT1_CHICK Synaptotagmin-1 OS=Gallus gallus GN=SYT1 PE=2 SV=1 Back     alignment and function description
>sp|P24506|SY62_DIPOM Synaptotagmin-B OS=Diplobatis ommata GN=P65-B PE=1 SV=1 Back     alignment and function description
>sp|Q5R4J5|SYT1_PONAB Synaptotagmin-1 OS=Pongo abelii GN=SYT1 PE=2 SV=1 Back     alignment and function description
>sp|P21579|SYT1_HUMAN Synaptotagmin-1 OS=Homo sapiens GN=SYT1 PE=1 SV=1 Back     alignment and function description
>sp|P48018|SYT1_BOVIN Synaptotagmin-1 OS=Bos taurus GN=SYT1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query128
12658419 429 synaptotagmin [Manduca sexta] 0.960 0.286 0.960 7e-66
383860584 434 PREDICTED: synaptotagmin 1-like [Megachi 0.937 0.276 0.96 9e-66
332018156 436 Synaptotagmin 1 [Acromyrmex echinatior] 0.953 0.279 0.952 1e-65
270006365 444 synaptotagmin [Tribolium castaneum] 0.953 0.274 0.96 2e-65
357626340 419 synaptotagmin I [Danaus plexippus] 0.953 0.291 0.96 2e-65
225543472 444 synaptotagmin 1 [Tribolium castaneum] gi 0.953 0.274 0.96 2e-65
237648990 431 synaptotagmin I [Bombyx mori] gi|2237024 0.953 0.283 0.96 2e-65
333033753 424 synaptotagmin 1 [Gryllus bimaculatus] 0.953 0.287 0.944 6e-65
307206115 429 Synaptotagmin [Harpegnathos saltator] 0.937 0.279 0.936 8e-65
193713831 466 PREDICTED: synaptotagmin 1 isoform 1 [Ac 0.937 0.257 0.944 8e-65
>gi|12658419|gb|AAK01129.1|AF331039_1 synaptotagmin [Manduca sexta] Back     alignment and taxonomy information
 Score =  254 bits (649), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 121/126 (96%), Positives = 124/126 (98%)

Query: 2   KLEYDFNANSLSVTVIQAEDLPALDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLNPVFN 61
           KLEYDFN+NSLSVTVIQAEDLPALDMGGTSDPYVKVYLLPDKKKKFETKVHRKTL+PVFN
Sbjct: 160 KLEYDFNSNSLSVTVIQAEDLPALDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLSPVFN 219

Query: 62  ETFVFKGVPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVALCQIDLAQTIEEWRELQSVE 121
           ETFVFK VPYADAMNKTLVFAIFDFDRFSKHDQIGEVKV LCQ+DLAQTIEEWRELQSVE
Sbjct: 220 ETFVFKNVPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVPLCQVDLAQTIEEWRELQSVE 279

Query: 122 GEGGQL 127
           GEGGQL
Sbjct: 280 GEGGQL 285




Source: Manduca sexta

Species: Manduca sexta

Genus: Manduca

Family: Sphingidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|383860584|ref|XP_003705769.1| PREDICTED: synaptotagmin 1-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|332018156|gb|EGI58762.1| Synaptotagmin 1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|270006365|gb|EFA02813.1| synaptotagmin [Tribolium castaneum] Back     alignment and taxonomy information
>gi|357626340|gb|EHJ76466.1| synaptotagmin I [Danaus plexippus] Back     alignment and taxonomy information
>gi|225543472|ref|NP_001139384.1| synaptotagmin 1 [Tribolium castaneum] gi|223702450|gb|ACN21656.1| synaptotagmin I isoform A [Tribolium castaneum] Back     alignment and taxonomy information
>gi|237648990|ref|NP_001153672.1| synaptotagmin I [Bombyx mori] gi|223702452|gb|ACN21657.1| synaptotagmin I isoform A [Bombyx mori] Back     alignment and taxonomy information
>gi|333033753|dbj|BAK23253.1| synaptotagmin 1 [Gryllus bimaculatus] Back     alignment and taxonomy information
>gi|307206115|gb|EFN84195.1| Synaptotagmin [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|193713831|ref|XP_001944713.1| PREDICTED: synaptotagmin 1 isoform 1 [Acyrthosiphon pisum] gi|328711543|ref|XP_003244566.1| PREDICTED: synaptotagmin 1 isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query128
FB|FBgn0004242 474 Syt1 "Synaptotagmin 1" [Drosop 0.976 0.263 0.912 1.9e-58
MGI|MGI:99666 422 Syt2 "synaptotagmin II" [Mus m 0.937 0.284 0.735 1e-43
UNIPROTKB|G5E6N8 417 SYT2 "Uncharacterized protein" 0.937 0.287 0.735 1.7e-43
UNIPROTKB|Q8N9I0 419 SYT2 "Synaptotagmin-2" [Homo s 0.937 0.286 0.735 1.7e-43
UNIPROTKB|F1S5A0 362 SYT2 "Uncharacterized protein" 0.937 0.331 0.735 1.7e-43
RGD|3804 422 Syt2 "synaptotagmin II" [Rattu 0.937 0.284 0.735 1.7e-43
UNIPROTKB|P29101 422 Syt2 "Synaptotagmin-2" [Rattus 0.937 0.284 0.735 1.7e-43
UNIPROTKB|P41823 428 SYT1 "Synaptotagmin-1" [Aplysi 0.937 0.280 0.694 1.5e-42
UNIPROTKB|P47191 424 SYT1 "Synaptotagmin-1" [Gallus 0.937 0.283 0.702 6.6e-42
UNIPROTKB|P48018 422 SYT1 "Synaptotagmin-1" [Bos ta 0.937 0.284 0.702 1.1e-41
FB|FBgn0004242 Syt1 "Synaptotagmin 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 600 (216.3 bits), Expect = 1.9e-58, P = 1.9e-58
 Identities = 114/125 (91%), Positives = 120/125 (96%)

Query:     2 KLEYDFNANSLSVTVIQAEDLPALDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLNPVFN 61
             KLEYDFN+NSL+VTVIQAE+LPALDMGGTSDPYVKVYLLPDKKKKFETKVHRKTL+PVFN
Sbjct:   199 KLEYDFNSNSLAVTVIQAEELPALDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLSPVFN 258

Query:    62 ETFVFKGVPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVALCQIDLAQTIEEWRELQSVE 121
             ETF FK +PYADAMNKTLVFAIFDFDRFSKHDQIGEVKV LC IDLAQTIEEWR+L SVE
Sbjct:   259 ETFTFKSLPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVPLCTIDLAQTIEEWRDLVSVE 318

Query:   122 GEGGQ 126
             GEGGQ
Sbjct:   319 GEGGQ 323


GO:0007269 "neurotransmitter secretion" evidence=NAS;IMP
GO:0016192 "vesicle-mediated transport" evidence=IMP;TAS
GO:0008345 "larval locomotory behavior" evidence=IMP
GO:0030285 "integral to synaptic vesicle membrane" evidence=NAS
GO:0005509 "calcium ion binding" evidence=ISS;IDA
GO:0006887 "exocytosis" evidence=NAS
GO:0005544 "calcium-dependent phospholipid binding" evidence=TAS
GO:0048489 "synaptic vesicle transport" evidence=NAS
GO:0008021 "synaptic vesicle" evidence=ISS;IDA;NAS
GO:0016020 "membrane" evidence=IEA;NAS
GO:0007317 "regulation of pole plasm oskar mRNA localization" evidence=IMP
GO:0016079 "synaptic vesicle exocytosis" evidence=ISS
GO:0005515 "protein binding" evidence=IPI
GO:0031594 "neuromuscular junction" evidence=IDA
GO:0048488 "synaptic vesicle endocytosis" evidence=IDA;IMP
GO:0005215 "transporter activity" evidence=IEA
GO:0050803 "regulation of synapse structure and activity" evidence=IMP
GO:0048791 "calcium ion-dependent exocytosis of neurotransmitter" evidence=IMP
GO:0007268 "synaptic transmission" evidence=IDA
GO:0060024 "rhythmic synaptic transmission" evidence=IDA
MGI|MGI:99666 Syt2 "synaptotagmin II" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|G5E6N8 SYT2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q8N9I0 SYT2 "Synaptotagmin-2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1S5A0 SYT2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|3804 Syt2 "synaptotagmin II" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P29101 Syt2 "Synaptotagmin-2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P41823 SYT1 "Synaptotagmin-1" [Aplysia californica (taxid:6500)] Back     alignment and assigned GO terms
UNIPROTKB|P47191 SYT1 "Synaptotagmin-1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P48018 SYT1 "Synaptotagmin-1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P29101SYT2_RATNo assigned EC number0.73550.93750.2843yesN/A
P46097SYT2_MOUSENo assigned EC number0.73550.93750.2843yesN/A
P21521SY65_DROMENo assigned EC number0.9120.93750.2531yesN/A
Q8N9I0SYT2_HUMANNo assigned EC number0.73550.93750.2863yesN/A
Q5R4J5SYT1_PONABNo assigned EC number0.70240.93750.2863yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query128
cd08385124 cd08385, C2A_Synaptotagmin-1-5-6-9-10, C2A domain 4e-78
cd08386125 cd08386, C2A_Synaptotagmin-7, C2A domain first rep 4e-52
cd08387124 cd08387, C2A_Synaptotagmin-8, C2A domain first rep 3e-38
cd08388128 cd08388, C2A_Synaptotagmin-4-11, C2A domain first 3e-38
cd08390123 cd08390, C2A_Synaptotagmin-15-17, C2A domain first 1e-37
pfam0016885 pfam00168, C2, C2 domain 4e-33
cd00030102 cd00030, C2, C2 domain 7e-33
smart00239101 smart00239, C2, Protein kinase C conserved region 8e-33
cd04031125 cd04031, C2A_RIM1alpha, C2 domain first repeat con 7e-32
cd04035123 cd04035, C2A_Rabphilin_Doc2, C2 domain first repea 1e-30
cd04030127 cd04030, C2C_KIAA1228, C2 domain third repeat pres 1e-29
cd00276134 cd00276, C2B_Synaptotagmin, C2 domain second repea 3e-29
cd08521123 cd08521, C2A_SLP, C2 domain first repeat present i 9e-29
cd04020162 cd04020, C2B_SLP_1-2-3-4, C2 domain second repeat 2e-27
cd08405136 cd08405, C2B_Synaptotagmin-7, C2 domain second rep 1e-26
cd08402136 cd08402, C2B_Synaptotagmin-1, C2 domain second rep 3e-26
cd08393125 cd08393, C2A_SLP-1_2, C2 domain first repeat prese 6e-26
cd04026131 cd04026, C2_PKC_alpha_gamma, C2 domain in Protein 6e-26
cd04040115 cd04040, C2D_Tricalbin-like, C2 domain fourth repe 7e-25
cd04009133 cd04009, C2B_Munc13-like, C2 domain second repeat 9e-25
cd08404136 cd08404, C2B_Synaptotagmin-4, C2 domain second rep 9e-25
cd08384133 cd08384, C2B_Rabphilin_Doc2, C2 domain second repe 3e-24
cd08381122 cd08381, C2B_PI3K_class_II, C2 domain second repea 4e-24
cd08389124 cd08389, C2A_Synaptotagmin-14_16, C2A domain first 1e-23
cd04029125 cd04029, C2A_SLP-4_5, C2 domain first repeat prese 1e-22
cd08403134 cd08403, C2B_Synaptotagmin-3-5-6-9-10, C2 domain s 6e-21
cd04037124 cd04037, C2E_Ferlin, C2 domain fifth repeat in Fer 5e-17
cd08410135 cd08410, C2B_Synaptotagmin-17, C2 domain second re 8e-17
cd04042121 cd04042, C2A_MCTP_PRT, C2 domain first repeat foun 2e-16
cd08675137 cd08675, C2B_RasGAP, C2 domain second repeat of Ra 2e-15
COG50381227 COG5038, COG5038, Ca2+-dependent lipid-binding pro 4e-15
cd04024128 cd04024, C2A_Synaptotagmin-like, C2 domain first r 1e-14
cd08391121 cd08391, C2A_C2C_Synaptotagmin_like, C2 domain fir 3e-14
cd08383117 cd08383, C2A_RasGAP, C2 domain (first repeat) of R 3e-14
cd04041111 cd04041, C2A_fungal, C2 domain first repeat; funga 4e-14
cd04039108 cd04039, C2_PSD, C2 domain present in Phosphatidyl 5e-14
cd04025123 cd04025, C2B_RasA1_RasA4, C2 domain second repeat 2e-13
cd08406136 cd08406, C2B_Synaptotagmin-12, C2 domain second re 4e-13
cd04038145 cd04038, C2_ArfGAP, C2 domain present in Arf GTPas 4e-13
cd04033133 cd04033, C2_NEDD4_NEDD4L, C2 domain present in the 4e-13
cd08377119 cd08377, C2C_MCTP_PRT, C2 domain third repeat foun 8e-13
cd08688110 cd08688, C2_KIAA0528-like, C2 domain found in the 1e-12
cd04011111 cd04011, C2B_Ferlin, C2 domain second repeat in Fe 8e-12
cd08376116 cd08376, C2B_MCTP_PRT, C2 domain second repeat fou 4e-11
cd04017135 cd04017, C2D_Ferlin, C2 domain fourth repeat in Fe 1e-10
cd00275128 cd00275, C2_PLC_like, C2 domain present in Phospho 1e-10
cd04028146 cd04028, C2B_RIM1alpha, C2 domain second repeat co 4e-10
cd04046126 cd04046, C2_Calpain, C2 domain present in Calpain 7e-10
cd04047110 cd04047, C2B_Copine, C2 domain second repeat in Co 1e-09
cd08392128 cd08392, C2A_SLP-3, C2 domain first repeat present 1e-09
cd04036119 cd04036, C2_cPLA2, C2 domain present in cytosolic 1e-09
cd08680124 cd08680, C2_Kibra, C2 domain found in Human protei 2e-09
cd04043126 cd04043, C2_Munc13_fungal, C2 domain in Munc13 (ma 2e-09
cd04010148 cd04010, C2B_RasA3, C2 domain second repeat presen 3e-09
cd04054121 cd04054, C2A_Rasal1_RasA4, C2 domain first repeat 4e-09
cd04048120 cd04048, C2A_Copine, C2 domain first repeat in Cop 4e-09
cd04022127 cd04022, C2A_MCTP_PRT_plant, C2 domain first repea 4e-09
cd08685119 cd08685, C2_RGS-like, C2 domain of the Regulator O 5e-09
cd08408138 cd08408, C2B_Synaptotagmin-14_16, C2 domain second 6e-09
cd04027127 cd04027, C2B_Munc13, C2 domain second repeat in Mu 7e-09
cd04049124 cd04049, C2_putative_Elicitor-responsive_gene, C2 1e-08
cd04045120 cd04045, C2C_Tricalbin-like, C2 domain third repea 2e-08
cd08676153 cd08676, C2A_Munc13-like, C2 domain first repeat i 3e-08
cd08400126 cd08400, C2_Ras_p21A1, C2 domain present in RAS p2 9e-08
cd04052111 cd04052, C2B_Tricalbin-like, C2 domain second repe 2e-07
cd04051125 cd04051, C2_SRC2_like, C2 domain present in Soybea 3e-07
cd08682126 cd08682, C2_Rab11-FIP_classI, C2 domain found in R 3e-07
cd04044124 cd04044, C2A_Tricalbin-like, C2 domain first repea 4e-07
cd04018151 cd04018, C2C_Ferlin, C2 domain third repeat in Fer 6e-07
cd08395120 cd08395, C2C_Munc13, C2 domain third repeat in Mun 8e-07
cd04050105 cd04050, C2B_Synaptotagmin-like, C2 domain second 9e-07
cd08373127 cd08373, C2A_Ferlin, C2 domain first repeat in Fer 9e-07
cd08375136 cd08375, C2_Intersectin, C2 domain present in Inte 1e-06
COG5038 1227 COG5038, COG5038, Ca2+-dependent lipid-binding pro 2e-06
cd08681118 cd08681, C2_fungal_Inn1p-like, C2 domain found in 2e-06
cd08409137 cd08409, C2B_Synaptotagmin-15, C2 domain second re 3e-06
COG5038 1227 COG5038, COG5038, Ca2+-dependent lipid-binding pro 4e-06
cd08401121 cd08401, C2A_RasA2_RasA3, C2 domain first repeat p 6e-06
cd08382123 cd08382, C2_Smurf-like, C2 domain present in Smad 4e-05
cd04019150 cd04019, C2C_MCTP_PRT_plant, C2 domain third repea 9e-05
cd08691137 cd08691, C2_NEDL1-like, C2 domain present in NEDL1 1e-04
cd08677118 cd08677, C2A_Synaptotagmin-13, C2 domain 1e-04
cd08678126 cd08678, C2_C21orf25-like, C2 domain found in the 0.003
cd04021125 cd04021, C2_E3_ubiquitin_ligase, C2 domain present 0.003
cd08378121 cd08378, C2B_MCTP_PRT_plant, C2 domain second repe 0.004
>gnl|CDD|176031 cd08385, C2A_Synaptotagmin-1-5-6-9-10, C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10 Back     alignment and domain information
 Score =  225 bits (577), Expect = 4e-78
 Identities = 87/118 (73%), Positives = 101/118 (85%), Gaps = 1/118 (0%)

Query: 2   KLEYDFNANSLSVTVIQAEDLPALDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLNPVFN 61
            L+YDF +N L+V +IQA DLPA+DMGGTSDPYVKVYLLPDKKKKFETKVHRKTLNPVFN
Sbjct: 8   SLDYDFQSNQLTVGIIQAADLPAMDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLNPVFN 67

Query: 62  ETFVFKGVPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVALCQIDLAQTIEEWRELQS 119
           ETF FK VPY++  NKTLVF+++DFDRFSKHD IGEV+V L  +DL    EEWR+L+S
Sbjct: 68  ETFTFK-VPYSELGNKTLVFSVYDFDRFSKHDLIGEVRVPLLTVDLGHVTEEWRDLES 124


Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains. Synaptotagmin 1, a member of class 1 synaptotagmins, is located in the brain and endocranium and localized to the synaptic vesicles and secretory granules. It functions as a Ca2+ sensor for fast exocytosis as do synaptotagmins 5, 6, and 10. It is distinguished from the other synaptotagmins by having an N-glycosylated N-terminus. Synaptotagmins 5, 6, and 10, members of class 3 synaptotagmins, are located primarily in the brain and localized to the active zone and plasma membrane. They is distinguished from the other synaptotagmins by having disulfide bonds at its N-terminus. Synaptotagmin 6 also regulates the acrosome reaction, a unique Ca2+-regulated exocytosis, in sperm. Synaptotagmin 9, a class 5 synaptotagmins, is located in the brain and localized to the synaptic vesicles. It is thought to be a Ca2+-sensor for dense-core vesicle exocytosis. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium. Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10). The function of the two C2 domains that bind calcium are: regulating the fusion step of synaptic vesicle exocytosis (C2A) and binding to phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the absence of calcium ions and to phosphatidylinositol bisphosphate (PIP2) in their presence (C2B). C2B also regulates also the recycling step of synaptic vesicles. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins. Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1. However, there are a few exceptions to this including RIM isoforms and some splice variants of piccolo/aczonin and intersectin which only have a single C2 domain. C2 domains with a calcium binding region have negatively charged residues, primarily aspartates, that serve as ligands for calcium ions. This cd contains the first C2 repeat, C2A, and has a type-I topology. Length = 124

>gnl|CDD|176032 cd08386, C2A_Synaptotagmin-7, C2A domain first repeat present in Synaptotagmin 7 Back     alignment and domain information
>gnl|CDD|176033 cd08387, C2A_Synaptotagmin-8, C2A domain first repeat present in Synaptotagmin 8 Back     alignment and domain information
>gnl|CDD|176034 cd08388, C2A_Synaptotagmin-4-11, C2A domain first repeat present in Synaptotagmins 4 and 11 Back     alignment and domain information
>gnl|CDD|176036 cd08390, C2A_Synaptotagmin-15-17, C2A domain first repeat present in Synaptotagmins 15 and 17 Back     alignment and domain information
>gnl|CDD|215765 pfam00168, C2, C2 domain Back     alignment and domain information
>gnl|CDD|175973 cd00030, C2, C2 domain Back     alignment and domain information
>gnl|CDD|214577 smart00239, C2, Protein kinase C conserved region 2 (CalB) Back     alignment and domain information
>gnl|CDD|175997 cd04031, C2A_RIM1alpha, C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>gnl|CDD|176000 cd04035, C2A_Rabphilin_Doc2, C2 domain first repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>gnl|CDD|175996 cd04030, C2C_KIAA1228, C2 domain third repeat present in uncharacterized human KIAA1228-like proteins Back     alignment and domain information
>gnl|CDD|175975 cd00276, C2B_Synaptotagmin, C2 domain second repeat present in Synaptotagmin Back     alignment and domain information
>gnl|CDD|176056 cd08521, C2A_SLP, C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>gnl|CDD|175987 cd04020, C2B_SLP_1-2-3-4, C2 domain second repeat present in Synaptotagmin-like proteins 1-4 Back     alignment and domain information
>gnl|CDD|176050 cd08405, C2B_Synaptotagmin-7, C2 domain second repeat present in Synaptotagmin 7 Back     alignment and domain information
>gnl|CDD|176047 cd08402, C2B_Synaptotagmin-1, C2 domain second repeat present in Synaptotagmin 1 Back     alignment and domain information
>gnl|CDD|176039 cd08393, C2A_SLP-1_2, C2 domain first repeat present in Synaptotagmin-like proteins 1 and 2 Back     alignment and domain information
>gnl|CDD|175992 cd04026, C2_PKC_alpha_gamma, C2 domain in Protein Kinase C (PKC) alpha and gamma Back     alignment and domain information
>gnl|CDD|176005 cd04040, C2D_Tricalbin-like, C2 domain fourth repeat present in Tricalbin-like proteins Back     alignment and domain information
>gnl|CDD|175976 cd04009, C2B_Munc13-like, C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>gnl|CDD|176049 cd08404, C2B_Synaptotagmin-4, C2 domain second repeat present in Synaptotagmin 4 Back     alignment and domain information
>gnl|CDD|176030 cd08384, C2B_Rabphilin_Doc2, C2 domain second repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>gnl|CDD|176027 cd08381, C2B_PI3K_class_II, C2 domain second repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>gnl|CDD|176035 cd08389, C2A_Synaptotagmin-14_16, C2A domain first repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>gnl|CDD|175995 cd04029, C2A_SLP-4_5, C2 domain first repeat present in Synaptotagmin-like proteins 4 and 5 Back     alignment and domain information
>gnl|CDD|176048 cd08403, C2B_Synaptotagmin-3-5-6-9-10, C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10 Back     alignment and domain information
>gnl|CDD|176002 cd04037, C2E_Ferlin, C2 domain fifth repeat in Ferlin Back     alignment and domain information
>gnl|CDD|176055 cd08410, C2B_Synaptotagmin-17, C2 domain second repeat present in Synaptotagmin 17 Back     alignment and domain information
>gnl|CDD|176007 cd04042, C2A_MCTP_PRT, C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>gnl|CDD|176057 cd08675, C2B_RasGAP, C2 domain second repeat of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>gnl|CDD|227371 COG5038, COG5038, Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|175990 cd04024, C2A_Synaptotagmin-like, C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>gnl|CDD|176037 cd08391, C2A_C2C_Synaptotagmin_like, C2 domain first and third repeat in Synaptotagmin-like proteins Back     alignment and domain information
>gnl|CDD|176029 cd08383, C2A_RasGAP, C2 domain (first repeat) of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>gnl|CDD|176006 cd04041, C2A_fungal, C2 domain first repeat; fungal group Back     alignment and domain information
>gnl|CDD|176004 cd04039, C2_PSD, C2 domain present in Phosphatidylserine decarboxylase (PSD) Back     alignment and domain information
>gnl|CDD|175991 cd04025, C2B_RasA1_RasA4, C2 domain second repeat present in RasA1 and RasA4 Back     alignment and domain information
>gnl|CDD|176051 cd08406, C2B_Synaptotagmin-12, C2 domain second repeat present in Synaptotagmin 12 Back     alignment and domain information
>gnl|CDD|176003 cd04038, C2_ArfGAP, C2 domain present in Arf GTPase Activating Proteins (GAP) Back     alignment and domain information
>gnl|CDD|175999 cd04033, C2_NEDD4_NEDD4L, C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42) Back     alignment and domain information
>gnl|CDD|176023 cd08377, C2C_MCTP_PRT, C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>gnl|CDD|176070 cd08688, C2_KIAA0528-like, C2 domain found in the Human KIAA0528 cDNA clone Back     alignment and domain information
>gnl|CDD|175978 cd04011, C2B_Ferlin, C2 domain second repeat in Ferlin Back     alignment and domain information
>gnl|CDD|176022 cd08376, C2B_MCTP_PRT, C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>gnl|CDD|175984 cd04017, C2D_Ferlin, C2 domain fourth repeat in Ferlin Back     alignment and domain information
>gnl|CDD|175974 cd00275, C2_PLC_like, C2 domain present in Phosphoinositide-specific phospholipases C (PLC) Back     alignment and domain information
>gnl|CDD|175994 cd04028, C2B_RIM1alpha, C2 domain second repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>gnl|CDD|176011 cd04046, C2_Calpain, C2 domain present in Calpain proteins Back     alignment and domain information
>gnl|CDD|176012 cd04047, C2B_Copine, C2 domain second repeat in Copine Back     alignment and domain information
>gnl|CDD|176038 cd08392, C2A_SLP-3, C2 domain first repeat present in Synaptotagmin-like protein 3 Back     alignment and domain information
>gnl|CDD|176001 cd04036, C2_cPLA2, C2 domain present in cytosolic PhosphoLipase A2 (cPLA2) Back     alignment and domain information
>gnl|CDD|176062 cd08680, C2_Kibra, C2 domain found in Human protein Kibra Back     alignment and domain information
>gnl|CDD|176008 cd04043, C2_Munc13_fungal, C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group Back     alignment and domain information
>gnl|CDD|175977 cd04010, C2B_RasA3, C2 domain second repeat present in RAS p21 protein activator 3 (RasA3) Back     alignment and domain information
>gnl|CDD|176018 cd04054, C2A_Rasal1_RasA4, C2 domain first repeat present in RasA1 and RasA4 Back     alignment and domain information
>gnl|CDD|176013 cd04048, C2A_Copine, C2 domain first repeat in Copine Back     alignment and domain information
>gnl|CDD|175989 cd04022, C2A_MCTP_PRT_plant, C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>gnl|CDD|176067 cd08685, C2_RGS-like, C2 domain of the Regulator Of G-Protein Signaling (RGS) family Back     alignment and domain information
>gnl|CDD|176053 cd08408, C2B_Synaptotagmin-14_16, C2 domain second repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>gnl|CDD|175993 cd04027, C2B_Munc13, C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>gnl|CDD|176014 cd04049, C2_putative_Elicitor-responsive_gene, C2 domain present in the putative elicitor-responsive gene Back     alignment and domain information
>gnl|CDD|176010 cd04045, C2C_Tricalbin-like, C2 domain third repeat present in Tricalbin-like proteins Back     alignment and domain information
>gnl|CDD|176058 cd08676, C2A_Munc13-like, C2 domain first repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>gnl|CDD|176045 cd08400, C2_Ras_p21A1, C2 domain present in RAS p21 protein activator 1 (RasA1) Back     alignment and domain information
>gnl|CDD|176017 cd04052, C2B_Tricalbin-like, C2 domain second repeat present in Tricalbin-like proteins Back     alignment and domain information
>gnl|CDD|176016 cd04051, C2_SRC2_like, C2 domain present in Soybean genes Regulated by Cold 2 (SRC2)-like proteins Back     alignment and domain information
>gnl|CDD|176064 cd08682, C2_Rab11-FIP_classI, C2 domain found in Rab11-family interacting proteins (FIP) class I Back     alignment and domain information
>gnl|CDD|176009 cd04044, C2A_Tricalbin-like, C2 domain first repeat present in Tricalbin-like proteins Back     alignment and domain information
>gnl|CDD|175985 cd04018, C2C_Ferlin, C2 domain third repeat in Ferlin Back     alignment and domain information
>gnl|CDD|176041 cd08395, C2C_Munc13, C2 domain third repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>gnl|CDD|176015 cd04050, C2B_Synaptotagmin-like, C2 domain second repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>gnl|CDD|176019 cd08373, C2A_Ferlin, C2 domain first repeat in Ferlin Back     alignment and domain information
>gnl|CDD|176021 cd08375, C2_Intersectin, C2 domain present in Intersectin Back     alignment and domain information
>gnl|CDD|227371 COG5038, COG5038, Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|176063 cd08681, C2_fungal_Inn1p-like, C2 domain found in fungal Ingression 1 (Inn1) proteins Back     alignment and domain information
>gnl|CDD|176054 cd08409, C2B_Synaptotagmin-15, C2 domain second repeat present in Synaptotagmin 15 Back     alignment and domain information
>gnl|CDD|227371 COG5038, COG5038, Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|176046 cd08401, C2A_RasA2_RasA3, C2 domain first repeat present in RasA2 and RasA3 Back     alignment and domain information
>gnl|CDD|176028 cd08382, C2_Smurf-like, C2 domain present in Smad ubiquitination-related factor (Smurf)-like proteins Back     alignment and domain information
>gnl|CDD|175986 cd04019, C2C_MCTP_PRT_plant, C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>gnl|CDD|176073 cd08691, C2_NEDL1-like, C2 domain present in NEDL1 (NEDD4-like ubiquitin protein ligase-1) Back     alignment and domain information
>gnl|CDD|176059 cd08677, C2A_Synaptotagmin-13, C2 domain Back     alignment and domain information
>gnl|CDD|176060 cd08678, C2_C21orf25-like, C2 domain found in the Human chromosome 21 open reading frame 25 (C21orf25) protein Back     alignment and domain information
>gnl|CDD|175988 cd04021, C2_E3_ubiquitin_ligase, C2 domain present in E3 ubiquitin ligase Back     alignment and domain information
>gnl|CDD|176024 cd08378, C2B_MCTP_PRT_plant, C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 128
cd08677118 C2A_Synaptotagmin-13 C2 domain. Synaptotagmin is a 99.97
cd08680124 C2_Kibra C2 domain found in Human protein Kibra. K 99.96
cd08393125 C2A_SLP-1_2 C2 domain first repeat present in Syna 99.96
cd08385124 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repe 99.96
cd08389124 C2A_Synaptotagmin-14_16 C2A domain first repeat pr 99.96
cd04029125 C2A_SLP-4_5 C2 domain first repeat present in Syna 99.96
cd08387124 C2A_Synaptotagmin-8 C2A domain first repeat presen 99.96
cd08381122 C2B_PI3K_class_II C2 domain second repeat present 99.96
cd08392128 C2A_SLP-3 C2 domain first repeat present in Synapt 99.96
cd08388128 C2A_Synaptotagmin-4-11 C2A domain first repeat pre 99.95
cd08406136 C2B_Synaptotagmin-12 C2 domain second repeat prese 99.95
cd08407138 C2B_Synaptotagmin-13 C2 domain second repeat prese 99.95
cd08386125 C2A_Synaptotagmin-7 C2A domain first repeat presen 99.95
cd08692135 C2B_Tac2-N C2 domain second repeat found in Tac2-N 99.95
cd04028146 C2B_RIM1alpha C2 domain second repeat contained in 99.95
cd04030127 C2C_KIAA1228 C2 domain third repeat present in unc 99.95
cd08521123 C2A_SLP C2 domain first repeat present in Synaptot 99.95
cd08390123 C2A_Synaptotagmin-15-17 C2A domain first repeat pr 99.94
cd04031125 C2A_RIM1alpha C2 domain first repeat contained in 99.94
cd08384133 C2B_Rabphilin_Doc2 C2 domain second repeat present 99.94
cd08409137 C2B_Synaptotagmin-15 C2 domain second repeat prese 99.94
cd08408138 C2B_Synaptotagmin-14_16 C2 domain second repeat pr 99.94
cd04020162 C2B_SLP_1-2-3-4 C2 domain second repeat present in 99.93
cd08685119 C2_RGS-like C2 domain of the Regulator Of G-Protei 99.93
cd08404136 C2B_Synaptotagmin-4 C2 domain second repeat presen 99.93
cd08405136 C2B_Synaptotagmin-7 C2 domain second repeat presen 99.93
cd08402136 C2B_Synaptotagmin-1 C2 domain second repeat presen 99.93
cd08403134 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repe 99.93
cd08395120 C2C_Munc13 C2 domain third repeat in Munc13 (mamma 99.92
cd00276134 C2B_Synaptotagmin C2 domain second repeat present 99.92
cd08682126 C2_Rab11-FIP_classI C2 domain found in Rab11-famil 99.92
cd08410135 C2B_Synaptotagmin-17 C2 domain second repeat prese 99.92
cd04016121 C2_Tollip C2 domain present in Toll-interacting pr 99.92
cd08379126 C2D_MCTP_PRT_plant C2 domain fourth repeat found i 99.9
cd04010148 C2B_RasA3 C2 domain second repeat present in RAS p 99.9
cd08681118 C2_fungal_Inn1p-like C2 domain found in fungal Ing 99.9
cd04022127 C2A_MCTP_PRT_plant C2 domain first repeat found in 99.9
cd04036119 C2_cPLA2 C2 domain present in cytosolic PhosphoLip 99.9
cd04035123 C2A_Rabphilin_Doc2 C2 domain first repeat present 99.9
cd08376116 C2B_MCTP_PRT C2 domain second repeat found in Mult 99.9
cd08688110 C2_KIAA0528-like C2 domain found in the Human KIAA 99.89
cd04025123 C2B_RasA1_RasA4 C2 domain second repeat present in 99.89
cd04042121 C2A_MCTP_PRT C2 domain first repeat found in Multi 99.89
cd04026131 C2_PKC_alpha_gamma C2 domain in Protein Kinase C ( 99.89
KOG1028|consensus 421 99.88
cd04009133 C2B_Munc13-like C2 domain second repeat in Munc13 99.88
cd04041111 C2A_fungal C2 domain first repeat; fungal group. C 99.88
KOG0696|consensus 683 99.88
cd08401121 C2A_RasA2_RasA3 C2 domain first repeat present in 99.88
cd04050105 C2B_Synaptotagmin-like C2 domain second repeat pre 99.87
cd04024128 C2A_Synaptotagmin-like C2 domain first repeat pres 99.87
cd04019150 C2C_MCTP_PRT_plant C2 domain third repeat found in 99.87
cd08675137 C2B_RasGAP C2 domain second repeat of Ras GTPase a 99.87
cd08378121 C2B_MCTP_PRT_plant C2 domain second repeat found i 99.87
cd08678126 C2_C21orf25-like C2 domain found in the Human chro 99.87
cd08676153 C2A_Munc13-like C2 domain first repeat in Munc13 ( 99.86
cd04017135 C2D_Ferlin C2 domain fourth repeat in Ferlin. Ferl 99.86
cd04043126 C2_Munc13_fungal C2 domain in Munc13 (mammalian un 99.86
cd04049124 C2_putative_Elicitor-responsive_gene C2 domain pre 99.86
cd08391121 C2A_C2C_Synaptotagmin_like C2 domain first and thi 99.86
cd08400126 C2_Ras_p21A1 C2 domain present in RAS p21 protein 99.86
cd08375136 C2_Intersectin C2 domain present in Intersectin. A 99.86
KOG1030|consensus168 99.86
cd08394127 C2A_Munc13 C2 domain first repeat in Munc13 (mamma 99.85
cd04054121 C2A_Rasal1_RasA4 C2 domain first repeat present in 99.85
cd04011111 C2B_Ferlin C2 domain second repeat in Ferlin. Ferl 99.85
cd04039108 C2_PSD C2 domain present in Phosphatidylserine dec 99.85
cd04045120 C2C_Tricalbin-like C2 domain third repeat present 99.85
cd04040115 C2D_Tricalbin-like C2 domain fourth repeat present 99.85
cd04015158 C2_plant_PLD C2 domain present in plant phospholip 99.85
cd08382123 C2_Smurf-like C2 domain present in Smad ubiquitina 99.85
cd08377119 C2C_MCTP_PRT C2 domain third repeat found in Multi 99.85
cd04018151 C2C_Ferlin C2 domain third repeat in Ferlin. Ferli 99.84
cd04033133 C2_NEDD4_NEDD4L C2 domain present in the Human neu 99.84
cd08690155 C2_Freud-1 C2 domain found in 5' repressor element 99.84
cd04014132 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) 99.84
cd04051125 C2_SRC2_like C2 domain present in Soybean genes Re 99.83
cd04027127 C2B_Munc13 C2 domain second repeat in Munc13 (mamm 99.82
KOG1028|consensus421 99.82
cd04044124 C2A_Tricalbin-like C2 domain first repeat present 99.81
cd04037124 C2E_Ferlin C2 domain fifth repeat in Ferlin. Ferli 99.81
cd04046126 C2_Calpain C2 domain present in Calpain proteins. 99.81
cd08373127 C2A_Ferlin C2 domain first repeat in Ferlin. Ferli 99.81
cd04048120 C2A_Copine C2 domain first repeat in Copine. There 99.8
cd04038145 C2_ArfGAP C2 domain present in Arf GTPase Activati 99.79
cd04032127 C2_Perforin C2 domain of Perforin. Perforin contai 99.79
cd04013146 C2_SynGAP_like C2 domain present in Ras GTPase act 99.79
cd08383117 C2A_RasGAP C2 domain (first repeat) of Ras GTPase 99.78
cd08691137 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-li 99.77
cd00275128 C2_PLC_like C2 domain present in Phosphoinositide- 99.75
cd04021125 C2_E3_ubiquitin_ligase C2 domain present in E3 ubi 99.74
cd08374133 C2F_Ferlin C2 domain sixth repeat in Ferlin. Ferli 99.74
cd08686118 C2_ABR C2 domain in the Active BCR (Breakpoint clu 99.72
cd04047110 C2B_Copine C2 domain second repeat in Copine. Ther 99.7
PLN032002102 cellulose synthase-interactive protein; Provisiona 99.7
PF0016885 C2: C2 domain; InterPro: IPR000008 The C2 domain i 99.7
cd04052111 C2B_Tricalbin-like C2 domain second repeat present 99.67
PLN03008 868 Phospholipase D delta 99.65
smart00239101 C2 Protein kinase C conserved region 2 (CalB). Ca2 99.63
cd00030102 C2 C2 domain. The C2 domain was first identified i 99.6
KOG2059|consensus 800 99.56
PLN02223537 phosphoinositide phospholipase C 99.53
KOG1011|consensus 1283 99.53
PLN02952599 phosphoinositide phospholipase C 99.52
KOG0905|consensus1639 99.47
PLN02230598 phosphoinositide phospholipase C 4 99.45
PLN02222581 phosphoinositide phospholipase C 2 99.42
KOG0169|consensus746 99.4
PLN02228567 Phosphoinositide phospholipase C 99.38
KOG1328|consensus1103 99.37
PLN02270 808 phospholipase D alpha 99.3
COG50381227 Ca2+-dependent lipid-binding protein, contains C2 99.29
cd08684103 C2A_Tac2-N C2 domain first repeat found in Tac2-N 99.24
COG5038 1227 Ca2+-dependent lipid-binding protein, contains C2 99.2
KOG1328|consensus 1103 99.16
KOG1031|consensus 1169 99.13
KOG1013|consensus362 99.12
cd08689109 C2_fungal_Pkc1p C2 domain found in protein kinase 99.05
KOG2059|consensus 800 98.97
KOG1264|consensus1267 98.87
KOG1013|consensus 362 98.84
KOG1011|consensus1283 98.71
PLN02352 758 phospholipase D epsilon 98.7
KOG1326|consensus 1105 98.64
KOG1326|consensus 1105 98.5
KOG2060|consensus405 98.5
cd08683143 C2_C2cd3 C2 domain found in C2 calcium-dependent d 98.46
PLN02964 644 phosphatidylserine decarboxylase 98.23
KOG3837|consensus523 98.17
KOG1265|consensus 1189 98.13
KOG1327|consensus 529 98.06
cd08693173 C2_PI3K_class_I_beta_delta C2 domain present in cl 97.64
cd08398158 C2_PI3K_class_I_alpha C2 domain present in class I 97.58
PF12416 340 DUF3668: Cep120 protein; InterPro: IPR022136 This 97.54
cd08380156 C2_PI3K_like C2 domain present in phosphatidylinos 97.34
cd08397159 C2_PI3K_class_III C2 domain present in class III p 97.26
cd04012171 C2A_PI3K_class_II C2 domain first repeat present i 97.11
cd08399178 C2_PI3K_class_I_gamma C2 domain present in class I 96.89
cd08694196 C2_Dock-A C2 domains found in Dedicator Of CytoKin 96.74
cd08695189 C2_Dock-B C2 domains found in Dedicator Of CytoKin 96.63
PF00792142 PI3K_C2: Phosphoinositide 3-kinase C2; InterPro: I 96.44
PF10358143 NT-C2: N-terminal C2 in EEIG1 and EHBP1 proteins; 96.21
PF15627156 CEP76-C2: CEP76 C2 domain 96.11
KOG1452|consensus 442 95.98
PF14429184 DOCK-C2: C2 domain in Dock180 and Zizimin proteins 95.83
smart00142100 PI3K_C2 Phosphoinositide 3-kinase, region postulat 94.92
cd08679178 C2_DOCK180_related C2 domains found in Dedicator O 94.5
cd08696179 C2_Dock-C C2 domains found in Dedicator Of CytoKin 93.87
cd08697185 C2_Dock-D C2 domains found in Dedicator Of CytoKin 91.16
KOG1327|consensus 529 90.38
cd0868798 C2_PKN-like C2 domain in Protein kinase C-like (PK 90.3
PF15625168 CC2D2AN-C2: CC2D2A N-terminal C2 domain 88.06
PTZ00447 508 apical membrane antigen 1-like protein; Provisiona 85.43
KOG0906|consensus 843 82.86
PF07162168 B9-C2: Ciliary basal body-associated, B9 protein; 80.08
>cd08677 C2A_Synaptotagmin-13 C2 domain Back     alignment and domain information
Probab=99.97  E-value=3.1e-30  Score=147.70  Aligned_cols=113  Identities=24%  Similarity=0.515  Sum_probs=102.2

Q ss_pred             CeEEEecCCCEEEEEEEEecCCCCCCCCCCCCCeEEEEEeCC-CCCeeecceeecCCCCeecceEEEcccCCCCCCCCeE
Q psy12095          1 MKLEYDFNANSLSVTVIQAEDLPALDMGGTSDPYVKVYLLPD-KKKKFETKVHRKTLNPVFNETFVFKGVPYADAMNKTL   79 (128)
Q Consensus         1 ~~~~y~~~~~~l~v~i~~a~~l~~~~~~~~~~p~~~~~~~~~-~~~~~~t~~~~~~~~p~~~e~~~f~~~~~~~~~~~~l   79 (128)
                      |+|+|.+..+.|+|+|++|++|+ .  .+.+|||+++++.+. +..+.+|++.+.+.+|.|||+|.|+ ++.+++...++
T Consensus         5 fsL~Y~~~~~~L~V~vikA~~L~-~--~g~sDPYVKv~L~~~~k~~k~kT~v~rktlnPvfnE~f~F~-v~~~~l~~~tL   80 (118)
T cd08677           5 YSLSYDKQKAELHVNILEAENIS-V--DAGCECYISGCVSVSEGQKEAQTALKKLALHTQWEEELVFP-LPEEESLDGTL   80 (118)
T ss_pred             EEEEEcCcCCEEEEEEEEecCCC-C--CCCCCeEEEEEEcCCcCccEEEcceecCCCCCccccEEEEe-CCHHHhCCcEE
Confidence            68999999999999999999998 2  355899999999764 3357789999999999999999999 99888888999


Q ss_pred             EEEEEEccCCCCCceeEEEEEecccccccccccceEec
Q psy12095         80 VFAIFDFDRFSKHDQIGEVKVALCQIDLAQTIEEWREL  117 (128)
Q Consensus        80 ~v~v~~~~~~~~~~~lG~~~~~l~~l~~~~~~~~w~~L  117 (128)
                      .+.|||++.++++++||++.+++.++..+.+.++|.+|
T Consensus        81 ~~~V~d~Drfs~~d~IG~v~l~l~~~~~~~~~~~W~~~  118 (118)
T cd08677          81 TLTLRCCDRFSRHSTLGELRLKLADVSMMLGAAQWVDL  118 (118)
T ss_pred             EEEEEeCCCCCCCceEEEEEEccccccCCccccchhcC
Confidence            99999999999999999999999988777788899875



Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains. Synaptotagmin 13, a member of class 6 synaptotagmins, is located in the brain. It functions are unknown. It, like synaptotagmins 8 and 12, does not have any consensus Ca2+ binding sites. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium. Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10). The function of the two C2 domains that bind calcium are: regulating the fusion step of synaptic vesicle exocytosis (C2A) and binding to phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the absence of calcium ions and to phosphatidylinositol bisphosphate (PIP2) in their presence (C2B). C2B also regulates also the recycling step of synaptic vesicles. C2 domain

>cd08680 C2_Kibra C2 domain found in Human protein Kibra Back     alignment and domain information
>cd08393 C2A_SLP-1_2 C2 domain first repeat present in Synaptotagmin-like proteins 1 and 2 Back     alignment and domain information
>cd08385 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10 Back     alignment and domain information
>cd08389 C2A_Synaptotagmin-14_16 C2A domain first repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>cd04029 C2A_SLP-4_5 C2 domain first repeat present in Synaptotagmin-like proteins 4 and 5 Back     alignment and domain information
>cd08387 C2A_Synaptotagmin-8 C2A domain first repeat present in Synaptotagmin 8 Back     alignment and domain information
>cd08381 C2B_PI3K_class_II C2 domain second repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08392 C2A_SLP-3 C2 domain first repeat present in Synaptotagmin-like protein 3 Back     alignment and domain information
>cd08388 C2A_Synaptotagmin-4-11 C2A domain first repeat present in Synaptotagmins 4 and 11 Back     alignment and domain information
>cd08406 C2B_Synaptotagmin-12 C2 domain second repeat present in Synaptotagmin 12 Back     alignment and domain information
>cd08407 C2B_Synaptotagmin-13 C2 domain second repeat present in Synaptotagmin 13 Back     alignment and domain information
>cd08386 C2A_Synaptotagmin-7 C2A domain first repeat present in Synaptotagmin 7 Back     alignment and domain information
>cd08692 C2B_Tac2-N C2 domain second repeat found in Tac2-N (Tandem C2 protein in Nucleus) Back     alignment and domain information
>cd04028 C2B_RIM1alpha C2 domain second repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>cd04030 C2C_KIAA1228 C2 domain third repeat present in uncharacterized human KIAA1228-like proteins Back     alignment and domain information
>cd08521 C2A_SLP C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd08390 C2A_Synaptotagmin-15-17 C2A domain first repeat present in Synaptotagmins 15 and 17 Back     alignment and domain information
>cd04031 C2A_RIM1alpha C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>cd08384 C2B_Rabphilin_Doc2 C2 domain second repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>cd08409 C2B_Synaptotagmin-15 C2 domain second repeat present in Synaptotagmin 15 Back     alignment and domain information
>cd08408 C2B_Synaptotagmin-14_16 C2 domain second repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>cd04020 C2B_SLP_1-2-3-4 C2 domain second repeat present in Synaptotagmin-like proteins 1-4 Back     alignment and domain information
>cd08685 C2_RGS-like C2 domain of the Regulator Of G-Protein Signaling (RGS) family Back     alignment and domain information
>cd08404 C2B_Synaptotagmin-4 C2 domain second repeat present in Synaptotagmin 4 Back     alignment and domain information
>cd08405 C2B_Synaptotagmin-7 C2 domain second repeat present in Synaptotagmin 7 Back     alignment and domain information
>cd08402 C2B_Synaptotagmin-1 C2 domain second repeat present in Synaptotagmin 1 Back     alignment and domain information
>cd08403 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10 Back     alignment and domain information
>cd08395 C2C_Munc13 C2 domain third repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd00276 C2B_Synaptotagmin C2 domain second repeat present in Synaptotagmin Back     alignment and domain information
>cd08682 C2_Rab11-FIP_classI C2 domain found in Rab11-family interacting proteins (FIP) class I Back     alignment and domain information
>cd08410 C2B_Synaptotagmin-17 C2 domain second repeat present in Synaptotagmin 17 Back     alignment and domain information
>cd04016 C2_Tollip C2 domain present in Toll-interacting protein (Tollip) Back     alignment and domain information
>cd08379 C2D_MCTP_PRT_plant C2 domain fourth repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd04010 C2B_RasA3 C2 domain second repeat present in RAS p21 protein activator 3 (RasA3) Back     alignment and domain information
>cd08681 C2_fungal_Inn1p-like C2 domain found in fungal Ingression 1 (Inn1) proteins Back     alignment and domain information
>cd04022 C2A_MCTP_PRT_plant C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd04036 C2_cPLA2 C2 domain present in cytosolic PhosphoLipase A2 (cPLA2) Back     alignment and domain information
>cd04035 C2A_Rabphilin_Doc2 C2 domain first repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>cd08376 C2B_MCTP_PRT C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd08688 C2_KIAA0528-like C2 domain found in the Human KIAA0528 cDNA clone Back     alignment and domain information
>cd04025 C2B_RasA1_RasA4 C2 domain second repeat present in RasA1 and RasA4 Back     alignment and domain information
>cd04042 C2A_MCTP_PRT C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd04026 C2_PKC_alpha_gamma C2 domain in Protein Kinase C (PKC) alpha and gamma Back     alignment and domain information
>KOG1028|consensus Back     alignment and domain information
>cd04009 C2B_Munc13-like C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>cd04041 C2A_fungal C2 domain first repeat; fungal group Back     alignment and domain information
>KOG0696|consensus Back     alignment and domain information
>cd08401 C2A_RasA2_RasA3 C2 domain first repeat present in RasA2 and RasA3 Back     alignment and domain information
>cd04050 C2B_Synaptotagmin-like C2 domain second repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd04024 C2A_Synaptotagmin-like C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd04019 C2C_MCTP_PRT_plant C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd08675 C2B_RasGAP C2 domain second repeat of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>cd08378 C2B_MCTP_PRT_plant C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd08678 C2_C21orf25-like C2 domain found in the Human chromosome 21 open reading frame 25 (C21orf25) protein Back     alignment and domain information
>cd08676 C2A_Munc13-like C2 domain first repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>cd04017 C2D_Ferlin C2 domain fourth repeat in Ferlin Back     alignment and domain information
>cd04043 C2_Munc13_fungal C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group Back     alignment and domain information
>cd04049 C2_putative_Elicitor-responsive_gene C2 domain present in the putative elicitor-responsive gene Back     alignment and domain information
>cd08391 C2A_C2C_Synaptotagmin_like C2 domain first and third repeat in Synaptotagmin-like proteins Back     alignment and domain information
>cd08400 C2_Ras_p21A1 C2 domain present in RAS p21 protein activator 1 (RasA1) Back     alignment and domain information
>cd08375 C2_Intersectin C2 domain present in Intersectin Back     alignment and domain information
>KOG1030|consensus Back     alignment and domain information
>cd08394 C2A_Munc13 C2 domain first repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd04054 C2A_Rasal1_RasA4 C2 domain first repeat present in RasA1 and RasA4 Back     alignment and domain information
>cd04011 C2B_Ferlin C2 domain second repeat in Ferlin Back     alignment and domain information
>cd04039 C2_PSD C2 domain present in Phosphatidylserine decarboxylase (PSD) Back     alignment and domain information
>cd04045 C2C_Tricalbin-like C2 domain third repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd04040 C2D_Tricalbin-like C2 domain fourth repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd04015 C2_plant_PLD C2 domain present in plant phospholipase D (PLD) Back     alignment and domain information
>cd08382 C2_Smurf-like C2 domain present in Smad ubiquitination-related factor (Smurf)-like proteins Back     alignment and domain information
>cd08377 C2C_MCTP_PRT C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd04018 C2C_Ferlin C2 domain third repeat in Ferlin Back     alignment and domain information
>cd04033 C2_NEDD4_NEDD4L C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42) Back     alignment and domain information
>cd08690 C2_Freud-1 C2 domain found in 5' repressor element under dual repression binding protein-1 (Freud-1) Back     alignment and domain information
>cd04014 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) epsilon Back     alignment and domain information
>cd04051 C2_SRC2_like C2 domain present in Soybean genes Regulated by Cold 2 (SRC2)-like proteins Back     alignment and domain information
>cd04027 C2B_Munc13 C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>KOG1028|consensus Back     alignment and domain information
>cd04044 C2A_Tricalbin-like C2 domain first repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd04037 C2E_Ferlin C2 domain fifth repeat in Ferlin Back     alignment and domain information
>cd04046 C2_Calpain C2 domain present in Calpain proteins Back     alignment and domain information
>cd08373 C2A_Ferlin C2 domain first repeat in Ferlin Back     alignment and domain information
>cd04048 C2A_Copine C2 domain first repeat in Copine Back     alignment and domain information
>cd04038 C2_ArfGAP C2 domain present in Arf GTPase Activating Proteins (GAP) Back     alignment and domain information
>cd04032 C2_Perforin C2 domain of Perforin Back     alignment and domain information
>cd04013 C2_SynGAP_like C2 domain present in Ras GTPase activating protein (GAP) family Back     alignment and domain information
>cd08383 C2A_RasGAP C2 domain (first repeat) of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>cd08691 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-like ubiquitin protein ligase-1) Back     alignment and domain information
>cd00275 C2_PLC_like C2 domain present in Phosphoinositide-specific phospholipases C (PLC) Back     alignment and domain information
>cd04021 C2_E3_ubiquitin_ligase C2 domain present in E3 ubiquitin ligase Back     alignment and domain information
>cd08374 C2F_Ferlin C2 domain sixth repeat in Ferlin Back     alignment and domain information
>cd08686 C2_ABR C2 domain in the Active BCR (Breakpoint cluster region) Related protein Back     alignment and domain information
>cd04047 C2B_Copine C2 domain second repeat in Copine Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>PF00168 C2: C2 domain; InterPro: IPR000008 The C2 domain is a Ca2+-dependent membrane-targeting module found in many cellular proteins involved in signal transduction or membrane trafficking Back     alignment and domain information
>cd04052 C2B_Tricalbin-like C2 domain second repeat present in Tricalbin-like proteins Back     alignment and domain information
>PLN03008 Phospholipase D delta Back     alignment and domain information
>smart00239 C2 Protein kinase C conserved region 2 (CalB) Back     alignment and domain information
>cd00030 C2 C2 domain Back     alignment and domain information
>KOG2059|consensus Back     alignment and domain information
>PLN02223 phosphoinositide phospholipase C Back     alignment and domain information
>KOG1011|consensus Back     alignment and domain information
>PLN02952 phosphoinositide phospholipase C Back     alignment and domain information
>KOG0905|consensus Back     alignment and domain information
>PLN02230 phosphoinositide phospholipase C 4 Back     alignment and domain information
>PLN02222 phosphoinositide phospholipase C 2 Back     alignment and domain information
>KOG0169|consensus Back     alignment and domain information
>PLN02228 Phosphoinositide phospholipase C Back     alignment and domain information
>KOG1328|consensus Back     alignment and domain information
>PLN02270 phospholipase D alpha Back     alignment and domain information
>COG5038 Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>cd08684 C2A_Tac2-N C2 domain first repeat found in Tac2-N (Tandem C2 protein in Nucleus) Back     alignment and domain information
>COG5038 Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>KOG1328|consensus Back     alignment and domain information
>KOG1031|consensus Back     alignment and domain information
>KOG1013|consensus Back     alignment and domain information
>cd08689 C2_fungal_Pkc1p C2 domain found in protein kinase C (Pkc1p) in Saccharomyces cerevisiae Back     alignment and domain information
>KOG2059|consensus Back     alignment and domain information
>KOG1264|consensus Back     alignment and domain information
>KOG1013|consensus Back     alignment and domain information
>KOG1011|consensus Back     alignment and domain information
>PLN02352 phospholipase D epsilon Back     alignment and domain information
>KOG1326|consensus Back     alignment and domain information
>KOG1326|consensus Back     alignment and domain information
>KOG2060|consensus Back     alignment and domain information
>cd08683 C2_C2cd3 C2 domain found in C2 calcium-dependent domain containing 3 (C2cd3) proteins Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>KOG3837|consensus Back     alignment and domain information
>KOG1265|consensus Back     alignment and domain information
>KOG1327|consensus Back     alignment and domain information
>cd08693 C2_PI3K_class_I_beta_delta C2 domain present in class I beta and delta phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08398 C2_PI3K_class_I_alpha C2 domain present in class I alpha phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>PF12416 DUF3668: Cep120 protein; InterPro: IPR022136 This domain family is found in eukaryotes, and is typically between 75 and 114 amino acids in length Back     alignment and domain information
>cd08380 C2_PI3K_like C2 domain present in phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08397 C2_PI3K_class_III C2 domain present in class III phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd04012 C2A_PI3K_class_II C2 domain first repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08399 C2_PI3K_class_I_gamma C2 domain present in class I gamma phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08694 C2_Dock-A C2 domains found in Dedicator Of CytoKinesis (Dock) class A proteins Back     alignment and domain information
>cd08695 C2_Dock-B C2 domains found in Dedicator Of CytoKinesis (Dock) class B proteins Back     alignment and domain information
>PF00792 PI3K_C2: Phosphoinositide 3-kinase C2; InterPro: IPR002420 Phosphatidylinositol 3-kinase (PI3-kinase) (2 Back     alignment and domain information
>PF10358 NT-C2: N-terminal C2 in EEIG1 and EHBP1 proteins; InterPro: IPR019448 This entry represents the N-terminal 150 residues of a family of conserved proteins which are induced by oestrogen [] Back     alignment and domain information
>PF15627 CEP76-C2: CEP76 C2 domain Back     alignment and domain information
>KOG1452|consensus Back     alignment and domain information
>PF14429 DOCK-C2: C2 domain in Dock180 and Zizimin proteins; PDB: 3L4C_A Back     alignment and domain information
>smart00142 PI3K_C2 Phosphoinositide 3-kinase, region postulated to contain C2 domain Back     alignment and domain information
>cd08679 C2_DOCK180_related C2 domains found in Dedicator Of CytoKinesis 1 (DOCK 180) and related proteins Back     alignment and domain information
>cd08696 C2_Dock-C C2 domains found in Dedicator Of CytoKinesis (Dock) class C proteins Back     alignment and domain information
>cd08697 C2_Dock-D C2 domains found in Dedicator Of CytoKinesis (Dock) class C proteins Back     alignment and domain information
>KOG1327|consensus Back     alignment and domain information
>cd08687 C2_PKN-like C2 domain in Protein kinase C-like (PKN) proteins Back     alignment and domain information
>PF15625 CC2D2AN-C2: CC2D2A N-terminal C2 domain Back     alignment and domain information
>PTZ00447 apical membrane antigen 1-like protein; Provisional Back     alignment and domain information
>KOG0906|consensus Back     alignment and domain information
>PF07162 B9-C2: Ciliary basal body-associated, B9 protein; InterPro: IPR010796 Proteins in this entry include the MSK1 protein (Q9NXB0 from SWISSPROT) and other known or predicted flagellar basal body proteome components [] or cilia-containing species Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query128
2r83_A 284 Crystal Structure Analysis Of Human Synaptotagmin 1 2e-45
1rsy_A152 Structure Of The First C2-domain Of Synaptotagmin I 8e-45
1byn_A128 Solution Structure Of The Calcium-Bound First C2-Do 9e-45
3f04_A143 Crystal Structure Of Synaptotagmin I C2a Domain Len 3e-44
3f00_A143 Crystal Structure Of Synaptotagmin I C2a Domain Wit 3e-44
2d8k_A141 Solution Structure Of The First C2 Domain Of Synapt 2e-32
1dqv_A 296 Crystal Structure Of Synaptotagmin Iii C2aC2B Lengt 2e-30
3hn8_A 296 Crystal Structure Of Synaptotagmin Length = 296 2e-30
1ugk_A138 Solution Structure Of The First C2 Domain Of Synapt 3e-24
2enp_A147 Solution Structure Of The First C2 Domain From Huma 5e-23
2chd_A142 Crystal Structure Of The C2a Domain Of Rabphilin-3a 1e-17
2k3h_A140 Structural Determinants For Ca2+ And Pip2 Binding B 2e-17
1rh8_A142 Three-Dimensional Structure Of The Calcium-Free Pic 3e-17
3n5a_A138 Synaptotagmin-7, C2b-Domain, Calcium Bound Length = 2e-16
2cm6_A166 Crystal Structure Of The C2b Domain Of Rabphilin3a 8e-16
3rpb_A140 The C2b-Domain Of Rabphilin: Structural Variations 1e-15
2cm5_A166 Crystal Structure Of The C2b Domain Of Rabphilin Le 1e-15
2uzp_A144 Crystal Structure Of The C2 Domain Of Human Protein 2e-14
1dsy_A139 C2 Domain From Protein Kinase C (Alpha) Complexed W 2e-13
3gpe_A137 Crystal Structure Analysis Of Pkc (Alpha)-C2 Domain 2e-13
4dnl_A140 Crystal Structure Of A C2 Domain Of A Protein Kinas 4e-13
2dmg_A142 Solution Structure Of The Third C2 Domain Of Kiaa12 4e-13
1v27_A141 Solution Structure Of The First C2 Domain Of Rim2 L 8e-13
2bwq_A129 Crystal Structure Of The Rim2 C2a-Domain At 1.4 Ang 9e-13
1w15_A153 Rat Synaptotagmin 4 C2b Domain In The Presence Of C 1e-12
1tjm_A159 Crystallographic Identification Of Sr2+ Coordinatio 2e-12
1k5w_A152 Three-Dimensional Structure Of The Synaptotagmin 1 3e-12
2lha_A151 Solution Structure Of C2b With Ip6 Length = 151 3e-12
2b3r_A134 Crystal Structure Of The C2 Domain Of Class Ii Phos 9e-12
3fdw_A148 Crystal Structure Of A C2 Domain From Human Synapto 9e-12
2nsq_A155 Crystal Structure Of The C2 Domain Of The Human E3 8e-11
1a25_A149 C2 Domain From Protein Kinase C (Beta) Length = 149 2e-10
3pfq_A 674 Crystal Structure And Allosteric Activation Of Prot 2e-10
3b7y_A153 Crystal Structure Of The C2 Domain Of The E3 Ubiqui 3e-08
3m7f_B176 Crystal Structure Of The Nedd4 C2GRB10 SH2 COMPLEX 2e-07
2q3x_A171 The Rim1alpha C2b Domain Length = 171 2e-06
3jzy_A510 Crystal Structure Of Human Intersectin 2 C2 Domain 8e-06
3kwt_A148 Munc13-1 C2b-Domain, Calcium-Free Length = 148 1e-05
2ep6_A133 Solution Structure Of The Second C2 Domain From Hum 1e-05
>pdb|2R83|A Chain A, Crystal Structure Analysis Of Human Synaptotagmin 1 C2a-c2b Length = 284 Back     alignment and structure

Iteration: 1

Score = 177 bits (448), Expect = 2e-45, Method: Compositional matrix adjust. Identities = 85/121 (70%), Positives = 96/121 (79%), Gaps = 1/121 (0%) Query: 3 LEYDFNANSLSVTVIQAEDLPALDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLNPVFNE 62 L+YDF N L V +IQA +LPALDMGGTSDPYVKV+LLPDKKKKFETKVHRKTLNPVFNE Sbjct: 12 LDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNE 71 Query: 63 TFVFKGVPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVALCQIDLAQTIEEWRELQSVEG 122 F FK VPY++ KTLV A++DFDRFSKHD IGE KV + +D EEWR+LQS E Sbjct: 72 QFTFK-VPYSELAGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEK 130 Query: 123 E 123 E Sbjct: 131 E 131
>pdb|1RSY|A Chain A, Structure Of The First C2-domain Of Synaptotagmin I: A Novel Ca2+(slash)phospholipid Binding Fold Length = 152 Back     alignment and structure
>pdb|1BYN|A Chain A, Solution Structure Of The Calcium-Bound First C2-Domain Of Synaptotagmin I Length = 128 Back     alignment and structure
>pdb|3F04|A Chain A, Crystal Structure Of Synaptotagmin I C2a Domain Length = 143 Back     alignment and structure
>pdb|3F00|A Chain A, Crystal Structure Of Synaptotagmin I C2a Domain With Cu(Ii) Length = 143 Back     alignment and structure
>pdb|2D8K|A Chain A, Solution Structure Of The First C2 Domain Of Synaptotagmin Vii Length = 141 Back     alignment and structure
>pdb|1DQV|A Chain A, Crystal Structure Of Synaptotagmin Iii C2aC2B Length = 296 Back     alignment and structure
>pdb|3HN8|A Chain A, Crystal Structure Of Synaptotagmin Length = 296 Back     alignment and structure
>pdb|1UGK|A Chain A, Solution Structure Of The First C2 Domain Of Synaptotagmin Iv From Human Fetal Brain (Kiaa1342) Length = 138 Back     alignment and structure
>pdb|2ENP|A Chain A, Solution Structure Of The First C2 Domain From Human BK Protein Length = 147 Back     alignment and structure
>pdb|2CHD|A Chain A, Crystal Structure Of The C2a Domain Of Rabphilin-3a Length = 142 Back     alignment and structure
>pdb|2K3H|A Chain A, Structural Determinants For Ca2+ And Pip2 Binding By The C2a Domain Of Rabphilin-3a Length = 140 Back     alignment and structure
>pdb|1RH8|A Chain A, Three-Dimensional Structure Of The Calcium-Free Piccolo C2a- Domain Length = 142 Back     alignment and structure
>pdb|3N5A|A Chain A, Synaptotagmin-7, C2b-Domain, Calcium Bound Length = 138 Back     alignment and structure
>pdb|2CM6|A Chain A, Crystal Structure Of The C2b Domain Of Rabphilin3a Length = 166 Back     alignment and structure
>pdb|3RPB|A Chain A, The C2b-Domain Of Rabphilin: Structural Variations In A Janus-Faced Domain Length = 140 Back     alignment and structure
>pdb|2CM5|A Chain A, Crystal Structure Of The C2b Domain Of Rabphilin Length = 166 Back     alignment and structure
>pdb|2UZP|A Chain A, Crystal Structure Of The C2 Domain Of Human Protein Kinase C Gamma. Length = 144 Back     alignment and structure
>pdb|1DSY|A Chain A, C2 Domain From Protein Kinase C (Alpha) Complexed With Ca2+ And Phosphatidylserine Length = 139 Back     alignment and structure
>pdb|3GPE|A Chain A, Crystal Structure Analysis Of Pkc (Alpha)-C2 Domain Complexed With Ca2+ And Ptdins(4,5)p2 Length = 137 Back     alignment and structure
>pdb|4DNL|A Chain A, Crystal Structure Of A C2 Domain Of A Protein Kinase C Alpha (Prkca) From Homo Sapiens At 1.90 A Resolution Length = 140 Back     alignment and structure
>pdb|2DMG|A Chain A, Solution Structure Of The Third C2 Domain Of Kiaa1228 Protein Length = 142 Back     alignment and structure
>pdb|1V27|A Chain A, Solution Structure Of The First C2 Domain Of Rim2 Length = 141 Back     alignment and structure
>pdb|2BWQ|A Chain A, Crystal Structure Of The Rim2 C2a-Domain At 1.4 Angstrom Resolution Length = 129 Back     alignment and structure
>pdb|1W15|A Chain A, Rat Synaptotagmin 4 C2b Domain In The Presence Of Calcium Length = 153 Back     alignment and structure
>pdb|1TJM|A Chain A, Crystallographic Identification Of Sr2+ Coordination Site In Synaptotagmin I C2b Domain Length = 159 Back     alignment and structure
>pdb|1K5W|A Chain A, Three-Dimensional Structure Of The Synaptotagmin 1 C2b- Domain: Synaptotagmin 1 As A Phospholipid Binding Machine Length = 152 Back     alignment and structure
>pdb|2LHA|A Chain A, Solution Structure Of C2b With Ip6 Length = 151 Back     alignment and structure
>pdb|2B3R|A Chain A, Crystal Structure Of The C2 Domain Of Class Ii Phosphatidylinositide 3-Kinase C2 Length = 134 Back     alignment and structure
>pdb|3FDW|A Chain A, Crystal Structure Of A C2 Domain From Human Synaptotagmin- Like Protein 4 Length = 148 Back     alignment and structure
>pdb|2NSQ|A Chain A, Crystal Structure Of The C2 Domain Of The Human E3 Ubiquitin-Protein Ligase Nedd4-Like Protein Length = 155 Back     alignment and structure
>pdb|1A25|A Chain A, C2 Domain From Protein Kinase C (Beta) Length = 149 Back     alignment and structure
>pdb|3PFQ|A Chain A, Crystal Structure And Allosteric Activation Of Protein Kinase C Beta Ii Length = 674 Back     alignment and structure
>pdb|3B7Y|A Chain A, Crystal Structure Of The C2 Domain Of The E3 Ubiquitin- Protein Ligase Nedd4 Length = 153 Back     alignment and structure
>pdb|3M7F|B Chain B, Crystal Structure Of The Nedd4 C2GRB10 SH2 COMPLEX Length = 176 Back     alignment and structure
>pdb|2Q3X|A Chain A, The Rim1alpha C2b Domain Length = 171 Back     alignment and structure
>pdb|3JZY|A Chain A, Crystal Structure Of Human Intersectin 2 C2 Domain Length = 510 Back     alignment and structure
>pdb|3KWT|A Chain A, Munc13-1 C2b-Domain, Calcium-Free Length = 148 Back     alignment and structure
>pdb|2EP6|A Chain A, Solution Structure Of The Second C2 Domain From Human Mctp2 Protein Length = 133 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query128
2d8k_A141 Synaptotagmin VII; exocytosis, calcium binding, ly 3e-64
1rsy_A152 Synaptotagmin I; calcium/phospholipid binding prot 7e-63
3f04_A143 Synaptotagmin-1; C2A, calcium, cell junction, cyto 1e-62
1ugk_A138 Synaptotagmin IV, KIAA1342; beta sandwich, structu 4e-60
2chd_A142 Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium 4e-60
2enp_A147 B/K protein; C2 type 1,beta sandwich, structural g 6e-59
1wfm_A138 Synaptotagmin XIII; C2 domain, exocytosis, neurotr 8e-58
3fdw_A148 Synaptotagmin-like protein 4; structural genomics, 1e-57
2b3r_A134 Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA 2e-57
1rh8_A142 Piccolo protein; beta-sandwich, metal binding prot 2e-57
1v27_A141 Regulating synaptic membrane exocytosis protein 2; 1e-56
2r83_A 284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 6e-56
2r83_A284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 2e-36
2bwq_A129 Regulating synaptic membrane exocytosis protein 2; 1e-55
2dmg_A142 KIAA1228 protein; beta-sandwich, structural genomi 3e-55
2z0u_A155 WW domain-containing protein 1; C2 domain, alterna 1e-53
1dqv_A 296 Synaptotagmin III; beta sandwich, calcium ION, C2 2e-53
1dqv_A296 Synaptotagmin III; beta sandwich, calcium ION, C2 3e-36
3rdl_A137 Protein kinase C alpha type; protein kinase PKC, t 3e-52
1a25_A149 CALB, protein kinase C (beta); calcium++/phospholi 5e-52
2q3x_A171 Regulating synaptic membrane exocytosis protein 1; 2e-49
3fbk_A153 RGS3, RGP3, regulator of G-protein signaling 3; al 2e-48
2cm5_A166 Rabphilin-3A; protein transport, zinc-finger, Ca2+ 9e-46
3n5a_A138 Synaptotagmin-7; calcium/phospholipid binding prot 4e-45
3b7y_A153 E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- 1e-44
1w15_A153 Synaptotagmin IV; metal binding protein, endocytos 3e-44
2dmh_A140 Myoferlin; beta-sandwich, FER-1-like protein 3, mu 2e-42
3m7f_B176 E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 3e-42
1tjx_A159 Similar to synaptotagmini/P65; C2B domain, calcium 5e-42
1rlw_A126 Phospholipase A2, CALB domain; hydrolase, C2 domai 9e-39
1wfj_A136 Putative elicitor-responsive gene; C2 domain, rike 2e-36
2ep6_A133 MCTP2 protein; beta sandwich, Ca2+ binding, membra 5e-35
3pyc_A132 E3 ubiquitin-protein ligase smurf1; phospholipid b 2e-33
2nq3_A173 Itchy homolog E3 ubiquitin protein ligase; C2 doma 3e-28
1cjy_A 749 CPLA2, protein (cytosolic phospholipase A2); lipid 1e-26
3kwu_A148 MUNC13-1; calcium binding protein, phospholipid bi 2e-26
2fk9_A157 Protein kinase C, ETA type; ATP-binding, metal-bin 4e-26
1gmi_A136 Protein kinase C, epsilon type; PKC, C2 domain, X- 2e-24
3bxj_A 483 RAS GTPase-activating protein syngap; GTPase activ 2e-16
3nsj_A540 Perforin-1; pore forming protein, immune system; H 3e-16
3l9b_A144 Otoferlin; C2-domain, beta-sheets, cell membrane, 6e-12
2cjt_A131 UNC-13 homolog A, MUNC13-1; phorbol-ester binding, 7e-12
2cjs_A167 UNC-13 homolog A, MUNC13-1; neurotransmitter trans 7e-10
1djx_A624 PLC-D1, phosphoinositide-specific phospholipase C, 4e-09
3ohm_B885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 7e-05
>2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 141 Back     alignment and structure
 Score =  191 bits (486), Expect = 3e-64
 Identities = 59/125 (47%), Positives = 86/125 (68%)

Query: 1   MKLEYDFNANSLSVTVIQAEDLPALDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLNPVF 60
             + Y+F  ++L+V +++A++LPA D  GTSDP+VK+YLLPDKK K ETKV RK LNP +
Sbjct: 17  FSVGYNFQESTLTVKIMKAQELPAKDFSGTSDPFVKIYLLPDKKHKLETKVKRKNLNPHW 76

Query: 61  NETFVFKGVPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVALCQIDLAQTIEEWRELQSV 120
           NETF+F+G PY   + + L   + D+DRFS++D IGEV + L ++DL Q    W++L+  
Sbjct: 77  NETFLFEGFPYEKVVQRILYLQVLDYDRFSRNDPIGEVSIPLNKVDLTQMQTFWKDLKPS 136

Query: 121 EGEGG 125
               G
Sbjct: 137 GPSSG 141


>1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 Length = 152 Back     alignment and structure
>3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* Length = 143 Back     alignment and structure
>1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 138 Back     alignment and structure
>2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A Length = 142 Back     alignment and structure
>2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 147 Back     alignment and structure
>1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 138 Back     alignment and structure
>3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} Length = 148 Back     alignment and structure
>2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} Length = 134 Back     alignment and structure
>1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 Length = 142 Back     alignment and structure
>1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 141 Back     alignment and structure
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Length = 284 Back     alignment and structure
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Length = 284 Back     alignment and structure
>2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 Length = 129 Back     alignment and structure
>2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 142 Back     alignment and structure
>2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} Length = 155 Back     alignment and structure
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Length = 296 Back     alignment and structure
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Length = 296 Back     alignment and structure
>1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 Length = 149 Back     alignment and structure
>2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} Length = 171 Back     alignment and structure
>3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} Length = 153 Back     alignment and structure
>2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A Length = 166 Back     alignment and structure
>3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} Length = 138 Back     alignment and structure
>3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A Length = 153 Back     alignment and structure
>1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A Length = 153 Back     alignment and structure
>2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} Length = 176 Back     alignment and structure
>1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* Length = 159 Back     alignment and structure
>1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 Length = 126 Back     alignment and structure
>1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Length = 136 Back     alignment and structure
>2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 Length = 133 Back     alignment and structure
>3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A Length = 132 Back     alignment and structure
>2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 Length = 173 Back     alignment and structure
>1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A Length = 749 Back     alignment and structure
>3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} PDB: 3kwt_A* Length = 148 Back     alignment and structure
>2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} Length = 157 Back     alignment and structure
>1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Length = 136 Back     alignment and structure
>3bxj_A RAS GTPase-activating protein syngap; GTPase activation, membrane, phosphoprotein, SH3-binding, signaling protein; 3.00A {Rattus norvegicus} Length = 483 Back     alignment and structure
>3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} Length = 540 Back     alignment and structure
>3l9b_A Otoferlin; C2-domain, beta-sheets, cell membrane, synaptic V hearing, membrane, synapse, transmembrane, membrane protein; 1.95A {Rattus norvegicus} Length = 144 Back     alignment and structure
>2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 Length = 131 Back     alignment and structure
>2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 Length = 167 Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Length = 624 Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Length = 885 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query128
2d8k_A141 Synaptotagmin VII; exocytosis, calcium binding, ly 99.96
3f04_A143 Synaptotagmin-1; C2A, calcium, cell junction, cyto 99.96
1rsy_A152 Synaptotagmin I; calcium/phospholipid binding prot 99.96
3fdw_A148 Synaptotagmin-like protein 4; structural genomics, 99.96
2z0u_A155 WW domain-containing protein 1; C2 domain, alterna 99.95
1wfm_A138 Synaptotagmin XIII; C2 domain, exocytosis, neurotr 99.95
2enp_A147 B/K protein; C2 type 1,beta sandwich, structural g 99.95
2b3r_A134 Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA 99.95
2dmg_A142 KIAA1228 protein; beta-sandwich, structural genomi 99.95
1ugk_A138 Synaptotagmin IV, KIAA1342; beta sandwich, structu 99.95
2bwq_A129 Regulating synaptic membrane exocytosis protein 2; 99.95
3fbk_A153 RGS3, RGP3, regulator of G-protein signaling 3; al 99.95
1v27_A141 Regulating synaptic membrane exocytosis protein 2; 99.94
1w15_A153 Synaptotagmin IV; metal binding protein, endocytos 99.94
1rh8_A142 Piccolo protein; beta-sandwich, metal binding prot 99.94
1tjx_A159 Similar to synaptotagmini/P65; C2B domain, calcium 99.94
2chd_A142 Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium 99.94
2r83_A 284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 99.93
3n5a_A138 Synaptotagmin-7; calcium/phospholipid binding prot 99.93
3rdl_A137 Protein kinase C alpha type; protein kinase PKC, t 99.93
2cm5_A166 Rabphilin-3A; protein transport, zinc-finger, Ca2+ 99.93
2q3x_A171 Regulating synaptic membrane exocytosis protein 1; 99.92
1a25_A149 CALB, protein kinase C (beta); calcium++/phospholi 99.92
2ep6_A133 MCTP2 protein; beta sandwich, Ca2+ binding, membra 99.9
3b7y_A153 E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- 99.9
1dqv_A 296 Synaptotagmin III; beta sandwich, calcium ION, C2 99.9
1rlw_A126 Phospholipase A2, CALB domain; hydrolase, C2 domai 99.9
2dmh_A140 Myoferlin; beta-sandwich, FER-1-like protein 3, mu 99.9
2fk9_A157 Protein kinase C, ETA type; ATP-binding, metal-bin 99.89
3kwu_A148 MUNC13-1; calcium binding protein, phospholipid bi 99.89
3m7f_B176 E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 99.89
2r83_A284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 99.88
1wfj_A136 Putative elicitor-responsive gene; C2 domain, rike 99.88
3pyc_A132 E3 ubiquitin-protein ligase smurf1; phospholipid b 99.87
1gmi_A136 Protein kinase C, epsilon type; PKC, C2 domain, X- 99.87
1dqv_A296 Synaptotagmin III; beta sandwich, calcium ION, C2 99.86
2nq3_A173 Itchy homolog E3 ubiquitin protein ligase; C2 doma 99.83
3jzy_A510 Intersectin 2; C2 domain, structural genomics cons 99.79
1cjy_A 749 CPLA2, protein (cytosolic phospholipase A2); lipid 99.78
2cjt_A131 UNC-13 homolog A, MUNC13-1; phorbol-ester binding, 99.76
1djx_A624 PLC-D1, phosphoinositide-specific phospholipase C, 99.74
3nsj_A540 Perforin-1; pore forming protein, immune system; H 99.73
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 99.73
2cjs_A167 UNC-13 homolog A, MUNC13-1; neurotransmitter trans 99.72
3l9b_A144 Otoferlin; C2-domain, beta-sheets, cell membrane, 99.7
3bxj_A 483 RAS GTPase-activating protein syngap; GTPase activ 99.6
2zkm_X799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.48
3qr0_A816 Phospholipase C-beta (PLC-beta); PH domain, EF han 99.47
3ohm_B885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 99.47
1yrk_A126 NPKC-delta, protein kinase C, delta type; C2 domai 99.17
2enj_A138 NPKC-theta, protein kinase C theta type; beta-sand 99.12
3l4c_A220 Dedicator of cytokinesis protein 1; DOCK180, DOCK1 96.8
2wxf_A 940 Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca 96.04
3hhm_A 1091 Phosphatidylinositol-4,5-bisphosphate 3-kinase cat 94.79
1e7u_A 961 Phosphatidylinositol 3-kinase catalytic subunit; p 94.23
2y3a_A 1092 Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca 93.01
2yrb_A156 Protein fantom; beta sandwich, NPPSFA, national pr 90.31
>2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
Probab=99.96  E-value=1.6e-28  Score=145.88  Aligned_cols=124  Identities=47%  Similarity=0.909  Sum_probs=109.1

Q ss_pred             CeEEEecCCCEEEEEEEEecCCCCCCCCCCCCCeEEEEEeCCCCCeeecceeecCCCCeecceEEEcccCCCCCCCCeEE
Q psy12095          1 MKLEYDFNANSLSVTVIQAEDLPALDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLNPVFNETFVFKGVPYADAMNKTLV   80 (128)
Q Consensus         1 ~~~~y~~~~~~l~v~i~~a~~l~~~~~~~~~~p~~~~~~~~~~~~~~~t~~~~~~~~p~~~e~~~f~~~~~~~~~~~~l~   80 (128)
                      +++.|.+..+.|+|+|++|++|+..+..+.+|||+++.+.+++....+|+++..+.+|.|+|+|.|..++.+++....|.
T Consensus        17 ~~l~y~~~~~~L~v~v~~a~~L~~~d~~g~~dpyv~v~~~~~~~~~~kT~v~~~t~nP~wne~f~f~~~~~~~~~~~~l~   96 (141)
T 2d8k_A           17 FSVGYNFQESTLTVKIMKAQELPAKDFSGTSDPFVKIYLLPDKKHKLETKVKRKNLNPHWNETFLFEGFPYEKVVQRILY   96 (141)
T ss_dssp             EEEEECSSSCCEEEEEEEEESCCCCSSSSCCCEEEEEEEESCCSSEEECCCCTTCSSCCCCEEEEECSCCHHHHTTSEEE
T ss_pred             EEEEEeCCCCEEEEEEEEeECCCCCCCCCCCCcEEEEEEECCCCccEeCceEcCCCCCccccEEEECccCHHHcccCEEE
Confidence            47899999999999999999999988888999999999987666788999999999999999999983333333457899


Q ss_pred             EEEEEccCCCCCceeEEEEEecccccccccccceEecccccCCC
Q psy12095         81 FAIFDFDRFSKHDQIGEVKVALCQIDLAQTIEEWRELQSVEGEG  124 (128)
Q Consensus        81 v~v~~~~~~~~~~~lG~~~~~l~~l~~~~~~~~w~~L~~~~~~~  124 (128)
                      |+|||++.++++++||++.++|.++..+.....|++|.+.+...
T Consensus        97 i~V~d~d~~~~~~~iG~~~i~l~~l~~~~~~~~W~~L~~~~~~s  140 (141)
T 2d8k_A           97 LQVLDYDRFSRNDPIGEVSIPLNKVDLTQMQTFWKDLKPSGPSS  140 (141)
T ss_dssp             EEEEECCSSSSCEEEEEEEEETTTSCTTSCEEEEECCEECCCCC
T ss_pred             EEEEECCCCCCCcEEEEEEEEhhhhcCCCCccEEEECcCCCCCC
Confidence            99999999999999999999999998888888999999887654



>3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.7.1.2 PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* Back     alignment and structure
>1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} Back     alignment and structure
>2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} Back     alignment and structure
>1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} Back     alignment and structure
>2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} SCOP: b.7.1.0 Back     alignment and structure
>1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A Back     alignment and structure
>1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* Back     alignment and structure
>2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A Back     alignment and structure
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} Back     alignment and structure
>2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A Back     alignment and structure
>2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} Back     alignment and structure
>1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A Back     alignment and structure
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Back     alignment and structure
>1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} Back     alignment and structure
>3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} SCOP: b.7.1.0 PDB: 3kwt_A* Back     alignment and structure
>3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} Back     alignment and structure
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Back     alignment and structure
>3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A Back     alignment and structure
>1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Back     alignment and structure
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Back     alignment and structure
>2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Back     alignment and structure
>1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A Back     alignment and structure
>2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 Back     alignment and structure
>3l9b_A Otoferlin; C2-domain, beta-sheets, cell membrane, synaptic V hearing, membrane, synapse, transmembrane, membrane protein; 1.95A {Rattus norvegicus} Back     alignment and structure
>3bxj_A RAS GTPase-activating protein syngap; GTPase activation, membrane, phosphoprotein, SH3-binding, signaling protein; 3.00A {Rattus norvegicus} Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>1yrk_A NPKC-delta, protein kinase C, delta type; C2 domain, protein binding; HET: PTR; 1.70A {Homo sapiens} PDB: 1bdy_A Back     alignment and structure
>2enj_A NPKC-theta, protein kinase C theta type; beta-sandwich, phosphotyrosine binding, TCR, T-cell, diacylglycerol, phorbol ester, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>3l4c_A Dedicator of cytokinesis protein 1; DOCK180, DOCK1, phosphoinositide specificity, guanine exchan factor, RHO GTPase, cytoskeleton, cell migration; 2.37A {Homo sapiens} Back     alignment and structure
>2wxf_A Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca subunit delta isoform; transferase, phosphoprotein, isoform-specific inhibitors; HET: 039; 1.90A {Mus musculus} PDB: 2wxg_A* 2wxh_A* 2wxi_A* 2wxj_A* 2wxk_A* 2wxl_A* 2wxm_A* 2wxn_A* 2wxo_A* 2wxp_A* 2wxq_A* 2wxr_A 2x38_A* Back     alignment and structure
>3hhm_A Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha isoform; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_A 2rd0_A 4a55_A* 2enq_A Back     alignment and structure
>2y3a_A Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca subunit beta isoform; transferase, phosphoinositide 3-kinase, RTK; HET: GD9; 3.30A {Mus musculus} Back     alignment and structure
>2yrb_A Protein fantom; beta sandwich, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 128
d1rsya_143 b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu 2e-37
d2bwqa1125 b.7.1.2 (A:729-853) Regulating synaptic membrane e 5e-37
d1ugka_138 b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens 4e-36
d1w15a_138 b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegi 4e-32
d1rh8a_142 b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [Tax 1e-30
d2cm5a1137 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat ( 1e-29
d1a25a_132 b.7.1.2 (A:) C2 domain from protein kinase c (beta 1e-29
d1wfma_138 b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapie 9e-29
d1uowa_157 b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu 2e-28
d1dqva1130 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus 5e-28
d1dqva2145 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus 1e-27
d1rlwa_126 b.7.1.1 (A:) Domain from cytosolic phospholipase A 9e-25
d1wfja_136 b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cr 2e-21
d1qasa2131 b.7.1.1 (A:626-756) PI-specific phospholipase C is 1e-19
d2ep6a1126 b.7.1.1 (A:92-217) Multiple C2 and transmembrane d 1e-17
d1gmia_136 b.7.1.1 (A:) Domain from protein kinase C epsilon 2e-15
d2nq3a1133 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itc 3e-15
d2zkmx2122 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human 1e-14
d1bdya_123 b.7.1.1 (A:) Domain from protein kinase C delta {R 6e-14
d2cjta1128 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus no 2e-11
>d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 143 Back     information, alignment and structure

class: All beta proteins
fold: C2 domain-like
superfamily: C2 domain (Calcium/lipid-binding domain, CaLB)
family: Synaptotagmin-like (S variant)
domain: Synaptogamin I
species: Rat (Rattus norvegicus) [TaxId: 10116]
 Score =  122 bits (306), Expect = 2e-37
 Identities = 83/119 (69%), Positives = 94/119 (78%), Gaps = 1/119 (0%)

Query: 1   MKLEYDFNANSLSVTVIQAEDLPALDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLNPVF 60
             L+YDF  N L V +IQA +LPALDMGGTSDPYVKV+LLPDKKKKFETKVHRKTLNPVF
Sbjct: 25  YSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVF 84

Query: 61  NETFVFKGVPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVALCQIDLAQTIEEWRELQS 119
           NE F FK VPY++   KTLV A++DFDRFSKHD IGE KV +  +D     EEWR+LQS
Sbjct: 85  NEQFTFK-VPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQS 142


>d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} Length = 138 Back     information, alignment and structure
>d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 Back     information, alignment and structure
>d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 142 Back     information, alignment and structure
>d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 137 Back     information, alignment and structure
>d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 132 Back     information, alignment and structure
>d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} Length = 138 Back     information, alignment and structure
>d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 157 Back     information, alignment and structure
>d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 130 Back     information, alignment and structure
>d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 Back     information, alignment and structure
>d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126 Back     information, alignment and structure
>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 136 Back     information, alignment and structure
>d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 131 Back     information, alignment and structure
>d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126 Back     information, alignment and structure
>d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} Length = 136 Back     information, alignment and structure
>d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} Length = 133 Back     information, alignment and structure
>d2zkmx2 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 123 Back     information, alignment and structure
>d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 128 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query128
d1rsya_143 Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 99.96
d1dqva1130 Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 99.96
d1wfma_138 Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9 99.95
d2bwqa1125 Regulating synaptic membrane exocytosis protein, r 99.94
d1rh8a_142 Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} 99.94
d2cm5a1137 C2b-domain of rabphilin {Rat (Rattus norvegicus) [ 99.94
d1w15a_138 Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 99.94
d1a25a_132 C2 domain from protein kinase c (beta) {Rat (Rattu 99.94
d1ugka_138 Synaptotagmin IV {Human (Homo sapiens) [TaxId: 960 99.94
d1uowa_157 Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 99.93
d1dqva2145 Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 99.93
d1rlwa_126 Domain from cytosolic phospholipase A2 {Human (Hom 99.9
d2ep6a1126 Multiple C2 and transmembrane domain-containing pr 99.9
d1wfja_136 C2 domain protein At1g63220 {Thale cress (Arabidop 99.87
d1gmia_136 Domain from protein kinase C epsilon {Rat (Rattus 99.87
d1qasa2131 PI-specific phospholipase C isozyme D1 (PLC-D1), C 99.84
d2cjta1128 Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 99.83
d2nq3a1133 E3 ubiquitin-protein ligase Itchy {Human (Homo sap 99.83
d2zkmx2122 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 99.69
d1bdya_123 Domain from protein kinase C delta {Rat (Rattus no 99.66
d1e7ua2174 Phoshoinositide 3-kinase (PI3K) {Pig (Sus scrofa) 96.87
>d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: All beta proteins
fold: C2 domain-like
superfamily: C2 domain (Calcium/lipid-binding domain, CaLB)
family: Synaptotagmin-like (S variant)
domain: Synaptogamin I
species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=99.96  E-value=5.9e-29  Score=146.68  Aligned_cols=119  Identities=70%  Similarity=1.136  Sum_probs=107.8

Q ss_pred             CeEEEecCCCEEEEEEEEecCCCCCCCCCCCCCeEEEEEeCCCCCeeecceeecCCCCeecceEEEcccCCCCCCCCeEE
Q psy12095          1 MKLEYDFNANSLSVTVIQAEDLPALDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLNPVFNETFVFKGVPYADAMNKTLV   80 (128)
Q Consensus         1 ~~~~y~~~~~~l~v~i~~a~~l~~~~~~~~~~p~~~~~~~~~~~~~~~t~~~~~~~~p~~~e~~~f~~~~~~~~~~~~l~   80 (128)
                      |++.|++..+.|+|+|++|++|+.++..+.+|||+++.+.+.+....+|+++.++.+|.|+|.|.|. +...++....|.
T Consensus        25 ~sl~y~~~~~~L~V~V~~a~~L~~~~~~g~~dpyV~v~l~~~~~~~~kT~~~~~t~~P~wne~f~f~-i~~~~l~~~~L~  103 (143)
T d1rsya_          25 YSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFK-VPYSELGGKTLV  103 (143)
T ss_dssp             EEEEEETTTTEEEEEEEEEESCCCCSTTSCCCEEEEEEEETTCCSCEECCCCTTCSSCEEEEEEEEC-CCHHHHTTCEEE
T ss_pred             EEEEEeCCCCEEEEEEEEccCCCCCCCCCCCCeEEEEEEcCCCCeeEEEEEeccccCcceeeeeEEE-EEeeccCCceEE
Confidence            4789999999999999999999998888899999999998877778899999999999999999998 766555667899


Q ss_pred             EEEEEccCCCCCceeEEEEEecccccccccccceEecccc
Q psy12095         81 FAIFDFDRFSKHDQIGEVKVALCQIDLAQTIEEWRELQSV  120 (128)
Q Consensus        81 v~v~~~~~~~~~~~lG~~~~~l~~l~~~~~~~~w~~L~~~  120 (128)
                      |.|||++.++++++||.+.++|.++..+....+|++|+.+
T Consensus       104 i~V~d~d~~~~~~~iG~~~i~L~~~~~~~~~~~W~~L~sa  143 (143)
T d1rsya_         104 MAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSA  143 (143)
T ss_dssp             EEEEECCSSSCCEEEEEEEEEGGGCCCSSCEEEEEECBCC
T ss_pred             EEEEEcCCCCCCcEEEEEEEEchhccCCCCCccEEeCCCC
Confidence            9999999999999999999999999888888899999753



>d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zkmx2 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure