Psyllid ID: psy12195


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250----
MSKYQQHLEEHKVVIIRCETCTRNYESLESLTTHLSFKHSNQFLMKCTNCNVLVPRDEILPHLSIQHCQGTTPSIYECNQCKEKTNDMTTMLNHYSVKHYMDINMSCVPCDVLFHNKATLYKHLYLEHKATSLSIQCNMCSLVLDSKESLVTHISQTHTLMFTCRRCPSTFLNSATLSKHVKMEHNSKSYQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPYCITDFSEDKNLIQHIVSVHLGKEGTAPART
cccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccHHcccccccccccccccccc
ccHHHHHHHHccccccccccccccEccccHHHEEEEEccccccccccccccccEccccHHHHHHHHHHHcccccccccccccccEccccHHHHEEEEEcccccccccccccccEccccHHHHHEHHcccccccccEcccccccEccccHHHHHHHcccccccccccccccEccccHHHHHHHHccccccccccccccccccccHHHHHHHHHcccccccccccHccccEccccHHHHHHHHHcccccccEcccc
MSKYQQHLEEHKVVIIRCETCTRNYESLESLTThlsfkhsnqflmkctncnvlvprdeilphlsiqhcqgttpsiyecnqckektndMTTMLNHYSVKHymdinmscvpcdvlfhNKATLYKHLYLEHKATSLSIQCNMCSLVLDSKESLVTHISQTHTlmftcrrcpstflnsatLSKHVkmehnsksyqcnecpeSFERLNKLKRHkfqahndsvhqiqcpycitdfsedkNLIQHIVSVHlgkegtapart
mskyqqhleehKVVIIRCETCTRNYESLESLTTHLSFKHSNQFLMKCTNCNVLVPRDEILPHLSIQHCQGTTPSIYECNQCKEKTNDMTTMLNHYSVKHYMDINMSCVPCDVLFHNKATLYKHLYLEHKATSLSIQCNMCSLVLDSKESLVTHISQTHTLMFTCRRCPSTFLNSATLSKHVKMEHNSKSYQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPYCITDFSEDKNLIQHIVsvhlgkegtapart
MSKYQQHLEEHKVVIIRCETCTRNYESLESLTTHLSFKHSNQFLMKCTNCNVLVPRDEILPHLSIQHCQGTTPSIYECNQCKEKTNDMTTMLNHYSVKHYMDINMSCVPCDVLFHNKATLYKHLYLEHKATSLSIQCNMCSLVLDSKESLVTHISQTHTLMFTCRRCPSTFLNSATLSKHVKMEHNSKSYQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPYCITDFSEDKNLIQHIVSVHLGKEGTAPART
*********EHKVVIIRCETCTRNYESLESLTTHLSFKHSNQFLMKCTNCNVLVPRDEILPHLSIQHCQGTTPSIYECNQCKEKTNDMTTMLNHYSVKHYMDINMSCVPCDVLFHNKATLYKHLYLEHKATSLSIQCNMCSLVLDSKESLVTHISQTHTLMFTCRRCPSTFLNSATLSK**********************LNKLKRHKFQAHNDSVHQIQCPYCITDFSEDKNLIQHIVSVHL**********
*SKYQQHLEEHKVVIIRCETCTRNYESLESLTTHLSFKHSNQFLMKCTNCNVLVPRDEILPHLSIQHCQGTTPSIYECNQCKEKTNDMTTMLNHYSVKHYMDINMSCVPCDVLFHNKATLYKHLYLEHKATSLSIQCNMCSLVLDSKESLVTHISQTHTLMFTCRRCPSTFLNSATLSKHVKMEHNSKSYQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPYCITDFSEDKNLIQHIVSVHLGKEGTA****
********EEHKVVIIRCETCTRNYESLESLTTHLSFKHSNQFLMKCTNCNVLVPRDEILPHLSIQHCQGTTPSIYECNQCKEKTNDMTTMLNHYSVKHYMDINMSCVPCDVLFHNKATLYKHLYLEHKATSLSIQCNMCSLVLDSKESLVTHISQTHTLMFTCRRCPSTFLNSATLSKHVKMEHNSKSYQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPYCITDFSEDKNLIQHIVSVHLGKEGTAPART
MSKYQQHLEEHKVVIIRCETCTRNYESLESLTTHLSFKHSNQFLMKCTNCNVLVPRDEILPHLSIQHCQGTTPSIYECNQCKEKTNDMTTMLNHYSVKHYMDINMSCVPCDVLFHNKATLYKHLYLEHKATSLSIQCNMCSLVLDSKESLVTHISQTHTLMFTCRRCPSTFLNSATLSKHVKMEHNSKSYQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPYCITDFSEDKNLIQHIVSVHLGKEGTAP***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSKYQQHLEEHKVVIIRCETCTRNYESLESLTTHLSFKHSNQFLMKCTNCNVLVPRDEILPHLSIQHCQGTTPSIYECNQCKEKTNDMTTMLNHYSVKHYMDINMSCVPCDVLFHNKATLYKHLYLEHKATSLSIQCNMCSLVLDSKESLVTHISQTHTLMFTCRRCPSTFLNSATLSKHVKMEHNSKSYQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPYCITDFSEDKNLIQHIVSVHLGKEGTAPART
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query254 2.2.26 [Sep-21-2011]
Q054811191 Zinc finger protein 91 OS no N/A 0.905 0.193 0.263 8e-15
P17012799 Zinc finger X-chromosomal yes N/A 0.862 0.274 0.292 1e-14
P17010805 Zinc finger X-chromosomal no N/A 0.866 0.273 0.291 2e-14
Q95LI3801 Zinc finger Y-chromosomal yes N/A 0.866 0.274 0.291 3e-14
O62836800 Zinc finger X-chromosomal yes N/A 0.866 0.275 0.291 3e-14
Q6B4Z5801 Zinc finger Y-chromosomal no N/A 0.866 0.274 0.286 3e-14
Q52V16801 Zinc finger Y-chromosomal N/A N/A 0.866 0.274 0.286 5e-14
Q8N988423 Zinc finger protein 557 O no N/A 0.826 0.496 0.276 5e-14
P08048801 Zinc finger Y-chromosomal no N/A 0.866 0.274 0.286 5e-14
Q8TF45 676 Zinc finger protein 418 O no N/A 0.858 0.322 0.246 1e-13
>sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 Back     alignment and function desciption
 Score = 80.9 bits (198), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 67/254 (26%), Positives = 105/254 (41%), Gaps = 24/254 (9%)

Query: 4    YQQHLEEHKVVIIR-----CETCTRNYESLESLTTHLSFKHSNQFLMKCTNCNVLVPRDE 58
            +   L EHK +  R     CE C + +     LTTH    H+ +   KC  C     +  
Sbjct: 893  WSSTLTEHKRIHTREKTYKCEECGKAFSQPSHLTTHKRM-HTGEKPYKCEECGKAFSQSS 951

Query: 59   ILPHLSIQHCQGTTPSIYECNQCKEKTNDMTTMLNHYSVKHYMDINMSCVPCDVLFHNKA 118
             L    I H  G  P  Y+C +C +     +T+  H  + H  +    C  C   F   +
Sbjct: 952  TLTTHKIIH-TGEKP--YKCEECGKAFRKSSTLTEH-KIIHTGEKPYKCEECGKAFSQSS 1007

Query: 119  TLYKHLYLEHKATSLSIQCNMCSLVLDSKESLVTH-ISQTHTLMFTCRRCPSTFLNSATL 177
            TL +H  +         +C  C    +    L TH I  T    + C  C   F++S+TL
Sbjct: 1008 TLTRHTRMH--TGEKPYKCEECGKAFNRSSKLTTHKIIHTGEKPYKCEECGKAFISSSTL 1065

Query: 178  SKHVKMEHNSKSYQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPY----CITDFSEDK 233
            + H ++    K Y+C EC ++F + + L RHK       +H  + PY    C   F E  
Sbjct: 1066 NGHKRIHTREKPYKCEECGKAFSQSSTLTRHK------RLHTGEKPYKCGECGKAFKESS 1119

Query: 234  NLIQHIVSVHLGKE 247
             L +H + +H G++
Sbjct: 1120 ALTKHKI-IHTGEK 1132





Homo sapiens (taxid: 9606)
>sp|P17012|ZFX_MOUSE Zinc finger X-chromosomal protein OS=Mus musculus GN=Zfx PE=1 SV=2 Back     alignment and function description
>sp|P17010|ZFX_HUMAN Zinc finger X-chromosomal protein OS=Homo sapiens GN=ZFX PE=2 SV=2 Back     alignment and function description
>sp|Q95LI3|ZFY_BOVIN Zinc finger Y-chromosomal protein OS=Bos taurus GN=ZFY PE=2 SV=1 Back     alignment and function description
>sp|O62836|ZFX_BOVIN Zinc finger X-chromosomal protein OS=Bos taurus GN=ZFX PE=2 SV=2 Back     alignment and function description
>sp|Q6B4Z5|ZFY_PANTR Zinc finger Y-chromosomal protein OS=Pan troglodytes GN=ZFY PE=2 SV=1 Back     alignment and function description
>sp|Q52V16|ZFY_GORGO Zinc finger Y-chromosomal protein OS=Gorilla gorilla gorilla GN=ZFY PE=3 SV=1 Back     alignment and function description
>sp|Q8N988|ZN557_HUMAN Zinc finger protein 557 OS=Homo sapiens GN=ZNF557 PE=2 SV=2 Back     alignment and function description
>sp|P08048|ZFY_HUMAN Zinc finger Y-chromosomal protein OS=Homo sapiens GN=ZFY PE=1 SV=3 Back     alignment and function description
>sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query254
357621869 596 hypothetical protein KGM_10142 [Danaus p 0.799 0.340 0.288 2e-14
297276611 632 PREDICTED: zinc finger protein 726-like 0.901 0.362 0.282 7e-14
395514081 866 PREDICTED: zinc finger protein 470-like 0.846 0.248 0.275 8e-14
9623224 393 zinc finger protein Zfx [Neofelis nebulo 0.866 0.559 0.295 9e-14
395517204 385 PREDICTED: zinc finger protein 3 homolog 0.866 0.571 0.261 9e-14
62416 395 Azf-1 [Alligator mississippiensis] 0.862 0.554 0.301 1e-13
441627788 950 PREDICTED: zinc finger protein 91-like i 0.881 0.235 0.270 1e-13
9623290 387 zinc finger protein Zfy [Catopuma temmin 0.866 0.568 0.291 1e-13
334324898 899 PREDICTED: zinc finger protein 268-like 0.870 0.245 0.273 1e-13
441627791 1008 PREDICTED: zinc finger protein 91-like i 0.881 0.222 0.270 1e-13
>gi|357621869|gb|EHJ73544.1| hypothetical protein KGM_10142 [Danaus plexippus] Back     alignment and taxonomy information
 Score = 85.5 bits (210), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 71/246 (28%), Positives = 114/246 (46%), Gaps = 43/246 (17%)

Query: 5   QQHLEEH--KVVIIRCETCTRNYESLESLTTHLSFKHSNQFLMKCTNCNVL-VPRDEILP 61
           ++H+E+H  K    +CE CT+   +  SL  HL   HS ++  KC  C ++ + R  +L 
Sbjct: 263 RKHMEKHDSKNGPFQCELCTQYCPTKVSLRGHLK-SHSTRY--KCKLCGIVRLSRQHVLE 319

Query: 62  HLSIQHCQGTTPSIYECNQCKEKTNDMTTMLNHYSVKHYMDINMSCVPCDVLFHNKATLY 121
           H S++H    T ++Y+C QC+  TN  T M  H      + ++  C P            
Sbjct: 320 HYSLEHTH--TATVYKCPQCEHTTNKRTAMQRH------VRLHSKCEP------------ 359

Query: 122 KHLYLEHKATSLSIQCNMCSLVLDSKESLVTHISQ-THTLMFTCRRCPSTFLNSATLSKH 180
                        ++C++C     SKESL  HI +     +  C  C S+F+ +A L KH
Sbjct: 360 -------------VKCDLCGKTYKSKESLRIHIMRHDEQKLHQCEFCSSSFVYAAQLRKH 406

Query: 181 VKMEHNSKSYQCNECPESFERLNKLKRH--KFQAHND-SVHQIQCPYCITDFSEDKNLIQ 237
           ++  H +K Y C EC   F+ ++ LK+H  + + H D S ++  CP C   F     L  
Sbjct: 407 IRSVHENKDYYCVECDIMFKSMDNLKQHLQRAKRHRDSSSYKYTCPQCPERFISQSTLAT 466

Query: 238 HIVSVH 243
           H  + H
Sbjct: 467 HRTNAH 472




Source: Danaus plexippus

Species: Danaus plexippus

Genus: Danaus

Family: Nymphalidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|297276611|ref|XP_002801201.1| PREDICTED: zinc finger protein 726-like [Macaca mulatta] Back     alignment and taxonomy information
>gi|395514081|ref|XP_003761249.1| PREDICTED: zinc finger protein 470-like [Sarcophilus harrisii] Back     alignment and taxonomy information
>gi|9623224|gb|AAF90066.1| zinc finger protein Zfx [Neofelis nebulosa] Back     alignment and taxonomy information
>gi|395517204|ref|XP_003762769.1| PREDICTED: zinc finger protein 3 homolog [Sarcophilus harrisii] Back     alignment and taxonomy information
>gi|62416|emb|CAA43883.1| Azf-1 [Alligator mississippiensis] Back     alignment and taxonomy information
>gi|441627788|ref|XP_004089304.1| PREDICTED: zinc finger protein 91-like isoform 4 [Nomascus leucogenys] gi|441627816|ref|XP_004089306.1| PREDICTED: zinc finger protein 91-like isoform 6 [Nomascus leucogenys] Back     alignment and taxonomy information
>gi|9623290|gb|AAF90099.1| zinc finger protein Zfy [Catopuma temminckii] Back     alignment and taxonomy information
>gi|334324898|ref|XP_003340580.1| PREDICTED: zinc finger protein 268-like [Monodelphis domestica] Back     alignment and taxonomy information
>gi|441627791|ref|XP_004089305.1| PREDICTED: zinc finger protein 91-like isoform 5 [Nomascus leucogenys] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query254
UNIPROTKB|F1NBG4394 ZFX "Uncharacterized protein" 0.913 0.588 0.305 3.3e-24
UNIPROTKB|E9PEP7755 ZFX "Zinc finger X-chromosomal 0.909 0.305 0.312 2.3e-23
UNIPROTKB|P17010805 ZFX "Zinc finger X-chromosomal 0.909 0.286 0.312 2.6e-23
UNIPROTKB|B9EG97844 ZFX "ZFX protein" [Homo sapien 0.909 0.273 0.312 2.8e-23
UNIPROTKB|F1M952748 Zfx "Protein Zfx" [Rattus norv 0.909 0.308 0.312 2.9e-23
MGI|MGI:99211799 Zfx "zinc finger protein X-lin 0.909 0.289 0.308 3.2e-23
UNIPROTKB|F1LMV1799 Zfx "Protein Zfx" [Rattus norv 0.909 0.289 0.312 3.2e-23
UNIPROTKB|F1NQX8795 ZFX "Uncharacterized protein" 0.913 0.291 0.305 4.1e-23
UNIPROTKB|Q95LI3801 ZFY "Zinc finger Y-chromosomal 0.909 0.288 0.312 4.2e-23
UNIPROTKB|F1MPG2799 ZFX "Zinc finger X-chromosomal 0.909 0.289 0.312 5.3e-23
UNIPROTKB|F1NBG4 ZFX "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 277 (102.6 bits), Expect = 3.3e-24, P = 3.3e-24
 Identities = 76/249 (30%), Positives = 104/249 (41%)

Query:     2 SKYQQHLEEHK-VVIIRCETCTRNYESLES--LTTHLSFKHSNQFLMKCTNC-NVLVPRD 57
             S+ ++H+  H      +C+ C   Y S +S  L TH+  KHS +   KC  C        
Sbjct:   150 SELKKHMRIHTGEKPYQCQYC--EYRSADSSNLKTHVKTKHSKETSSKCDICFQTFSDTK 207

Query:    58 EILPHLSIQHCQGTTPSIYECNQCKEKTNDMTTMLNHYSVKHYMDINMSCVPCDVLFHNK 117
             E+  H ++ H +  T   ++C  C  K+++ + +  H    H  D    C  CD  FH  
Sbjct:   208 ELQQH-TLMHQESKT---HQCLHCDHKSSNSSDLKRHIISVHTKDYPHKCDMCDKGFHRP 263

Query:   118 ATLYKHLYLEHKATSLSIQCNMCSLVLDSKESLVTHISQTHT--LMFTCRRCPSTFLNSA 175
             + L KH+   HK   L  QC  C   +     L  HI   HT  L F C+RC   F    
Sbjct:   264 SELKKHV-AAHKGKKLH-QCRHCDFKIADPFILSRHILSVHTKDLPFRCKRCRKGFRQQN 321

Query:   176 TLSKHVKMEHNSKSYQCNECPESFERLNKLKRHKFQAHN-DSVHQIQCPYCITDFSEDKN 234
              L KH+K     K YQC  C  S    +  KRH    H  D  H+  C YC   F     
Sbjct:   322 ELKKHMKTHSGRKVYQCEYCEYSTTDASGFKRHVISIHTKDYPHR--CEYCKKGFRRPSE 379

Query:   235 LIQHIVSVH 243
               QHI+  H
Sbjct:   380 KNQHIMRHH 388


GO:0003676 "nucleic acid binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
UNIPROTKB|E9PEP7 ZFX "Zinc finger X-chromosomal protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P17010 ZFX "Zinc finger X-chromosomal protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|B9EG97 ZFX "ZFX protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1M952 Zfx "Protein Zfx" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:99211 Zfx "zinc finger protein X-linked" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1LMV1 Zfx "Protein Zfx" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1NQX8 ZFX "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q95LI3 ZFY "Zinc finger Y-chromosomal protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1MPG2 ZFX "Zinc finger X-chromosomal protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 254
KOG2462|consensus279 99.97
KOG3608|consensus467 99.96
KOG2462|consensus279 99.93
KOG1074|consensus958 99.91
KOG3608|consensus 467 99.9
KOG3623|consensus 1007 99.86
KOG1074|consensus 958 99.81
KOG3576|consensus267 99.72
KOG3623|consensus 1007 99.61
KOG3576|consensus267 99.61
PLN03086567 PRLI-interacting factor K; Provisional 99.32
PHA00733128 hypothetical protein 99.3
PLN03086567 PRLI-interacting factor K; Provisional 99.23
PHA00733128 hypothetical protein 99.2
PHA0276855 hypothetical protein; Provisional 99.07
PHA0276855 hypothetical protein; Provisional 99.04
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.93
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.87
KOG3993|consensus500 98.78
PHA0061644 hypothetical protein 98.74
KOG3993|consensus500 98.61
PHA0073279 hypothetical protein 98.57
PHA0061644 hypothetical protein 98.49
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.41
PHA0073279 hypothetical protein 98.36
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 98.17
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.15
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.95
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.94
COG5189423 SFP1 Putative transcriptional repressor regulating 97.94
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.85
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.84
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.84
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.66
COG5189423 SFP1 Putative transcriptional repressor regulating 97.65
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.63
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 97.3
smart0035526 ZnF_C2H2 zinc finger. 97.29
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 97.28
smart0035526 ZnF_C2H2 zinc finger. 96.89
PRK04860160 hypothetical protein; Provisional 96.84
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.83
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 96.73
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.63
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.58
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 96.55
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 96.21
KOG2482|consensus423 96.12
PRK04860160 hypothetical protein; Provisional 95.66
KOG1146|consensus 1406 95.65
KOG2231|consensus 669 95.47
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 95.4
KOG2231|consensus 669 95.06
KOG2482|consensus423 94.48
KOG1146|consensus 1406 94.34
COG404965 Uncharacterized protein containing archaeal-type C 94.14
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 94.13
KOG4173|consensus253 94.09
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 94.02
KOG4173|consensus253 93.66
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 93.54
PF1290740 zf-met2: Zinc-binding 93.3
KOG2785|consensus 390 93.14
KOG2893|consensus 341 92.15
COG404965 Uncharacterized protein containing archaeal-type C 92.12
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 91.27
KOG2785|consensus 390 91.19
KOG2893|consensus 341 91.12
PF06524314 NOA36: NOA36 protein; InterPro: IPR010531 This fam 90.94
COG5236 493 Uncharacterized conserved protein, contains RING Z 90.53
COG5236 493 Uncharacterized conserved protein, contains RING Z 90.3
TIGR00373158 conserved hypothetical protein TIGR00373. This fam 89.8
cd0072934 rubredoxin_SM Rubredoxin, Small Modular nonheme ir 89.77
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 89.58
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 89.41
PF1371937 zinc_ribbon_5: zinc-ribbon domain 89.02
TIGR0209838 MJ0042_CXXC MJ0042 family finger-like domain. This 89.0
COG5048 467 FOG: Zn-finger [General function prediction only] 88.82
PF1371736 zinc_ribbon_4: zinc-ribbon domain 88.78
PF0289245 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc 88.52
smart0061450 ZnF_BED BED zinc finger. DNA-binding domain in chr 88.4
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 88.1
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 87.83
PRK06266178 transcription initiation factor E subunit alpha; V 87.72
COG288861 Predicted Zn-ribbon RNA-binding protein with a fun 87.18
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 86.52
COG5048467 FOG: Zn-finger [General function prediction only] 86.12
smart00531147 TFIIE Transcription initiation factor IIE. 86.08
COG1592166 Rubrerythrin [Energy production and conversion] 85.83
smart0065944 RPOLCX RNA polymerase subunit CX. present in RNA p 84.87
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 84.76
PF09986 214 DUF2225: Uncharacterized protein conserved in bact 84.5
PHA0062659 hypothetical protein 84.46
smart0073426 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18 84.01
PRK0039846 rpoP DNA-directed RNA polymerase subunit P; Provis 83.72
PF09986214 DUF2225: Uncharacterized protein conserved in bact 83.72
COG199789 RPL43A Ribosomal protein L37AE/L43A [Translation, 82.75
smart00531147 TFIIE Transcription initiation factor IIE. 81.25
PRK00464154 nrdR transcriptional regulator NrdR; Validated 80.26
KOG2186|consensus 276 80.06
>KOG2462|consensus Back     alignment and domain information
Probab=99.97  E-value=3.6e-32  Score=198.23  Aligned_cols=139  Identities=27%  Similarity=0.506  Sum_probs=128.5

Q ss_pred             CCCCcccccchhhccChHHHHHHHHhhhcc-CCCcccccccccccCCHHHHHHHHHhcCCcccccCCCcccCCChHHHHH
Q psy12195        101 MDINMSCVPCDVLFHNKATLYKHLYLEHKA-TSLSIQCNMCSLVLDSKESLVTHISQTHTLMFTCRRCPSTFLNSATLSK  179 (254)
Q Consensus       101 ~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~-~~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~C~~C~~~f~~~~~l~~  179 (254)
                      ....|.|+.|++.+.+.++|-.|.+.|... ....+.|++|++.|.+...|..|++ +|..+.+|.+||+.|...+.|+.
T Consensus       127 ~~~r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHir-TH~l~c~C~iCGKaFSRPWLLQG  205 (279)
T KOG2462|consen  127 KHPRYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIR-THTLPCECGICGKAFSRPWLLQG  205 (279)
T ss_pred             cCCceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhh-ccCCCcccccccccccchHHhhc
Confidence            445699999999999999999999986543 3446899999999999999999998 99999999999999999999999


Q ss_pred             HHhHhhCCCcccCCCCcccCCCHHHHHHHHHHhhcCCCCCccCcchhhccCCchHHHHHHHHh
Q psy12195        180 HVKMEHNSKSYQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPYCITDFSEDKNLIQHIVSV  242 (254)
Q Consensus       180 H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~C~~C~~~f~~~~~l~~H~~~~  242 (254)
                      |+++|+|||||.|+.|+|+|.++++|..|+. +|.+ .+.|+|+.|+|.|+..+.|..|.+.-
T Consensus       206 HiRTHTGEKPF~C~hC~kAFADRSNLRAHmQ-THS~-~K~~qC~~C~KsFsl~SyLnKH~ES~  266 (279)
T KOG2462|consen  206 HIRTHTGEKPFSCPHCGKAFADRSNLRAHMQ-THSD-VKKHQCPRCGKSFALKSYLNKHSESA  266 (279)
T ss_pred             ccccccCCCCccCCcccchhcchHHHHHHHH-hhcC-CccccCcchhhHHHHHHHHHHhhhhc
Confidence            9999999999999999999999999999998 7888 78999999999999999999998554



>KOG3608|consensus Back     alignment and domain information
>KOG2462|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>PF12907 zf-met2: Zinc-binding Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>PF06524 NOA36: NOA36 protein; InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>TIGR00373 conserved hypothetical protein TIGR00373 Back     alignment and domain information
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>PF13719 zinc_ribbon_5: zinc-ribbon domain Back     alignment and domain information
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF13717 zinc_ribbon_4: zinc-ribbon domain Back     alignment and domain information
>PF02892 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00614 ZnF_BED BED zinc finger Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>PRK06266 transcription initiation factor E subunit alpha; Validated Back     alignment and domain information
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>smart00531 TFIIE Transcription initiation factor IIE Back     alignment and domain information
>COG1592 Rubrerythrin [Energy production and conversion] Back     alignment and domain information
>smart00659 RPOLCX RNA polymerase subunit CX Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PHA00626 hypothetical protein Back     alignment and domain information
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger Back     alignment and domain information
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>smart00531 TFIIE Transcription initiation factor IIE Back     alignment and domain information
>PRK00464 nrdR transcriptional regulator NrdR; Validated Back     alignment and domain information
>KOG2186|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query254
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 5e-07
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 7e-06
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 1e-04
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure

Iteration: 1

Score = 51.2 bits (121), Expect = 5e-07, Method: Compositional matrix adjust. Identities = 46/174 (26%), Positives = 66/174 (37%), Gaps = 9/174 (5%) Query: 76 YECNQCKEKTNDMTTMLNHYSVKHYMDINMSCVPCDVLFHNKATLYKHLYLEHKATSLSI 135 Y C +C K+ + L + H + C C F +K L +H Sbjct: 22 YACPECG-KSFSRSDHLAEHQRTHTGEKPYKCPECGKSFSDKKDLTRHQRTH--TGEKPY 78 Query: 136 QCNMCSLVLDSKESLVTHISQTHTL--MFTCRRCPSTFLNSATLSKHVKMEHNSKSYQCN 193 +C C + +L H +THT + C C +F A L H + K Y+C Sbjct: 79 KCPECGKSFSQRANLRAH-QRTHTGEKPYACPECGKSFSQLAHLRAHQRTHTGEKPYKCP 137 Query: 194 ECPESFERLNKLKRHKFQAHNDSVHQIQCPYCITDFSEDKNLIQHIVSVHLGKE 247 EC +SF R + L H Q + +CP C FS L H H GK+ Sbjct: 138 ECGKSFSREDNL--HTHQRTHTGEKPYKCPECGKSFSRRDALNVH-QRTHTGKK 188
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query254
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 4e-05
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 4e-05
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 4e-04
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 7e-05
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-04
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 2e-04
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 3e-04
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 4e-04
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 9e-04
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
 Score = 41.5 bits (96), Expect = 4e-05
 Identities = 17/119 (14%), Positives = 35/119 (29%), Gaps = 4/119 (3%)

Query: 127 EHKATSLSIQCNMCSLVLDSKESLVTHISQTHTLMFTCRRCPSTFLNSATLSKHVKMEHN 186
           ++ +    I  ++    L     L     +    +          L+ ++    +     
Sbjct: 12  KYLSNHKGIFIHVTLEELKRYHQLTPEQKRLIRAIVKTLIHNPQLLDESSYLYRLLASKA 71

Query: 187 SKSYQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPYCITDFSEDKNLIQHIVSVHLG 245
              + C  C   F     LK+H         H   CP C  +F+   + + H+   H  
Sbjct: 72  ISQFVCPLCLMPFSSSVSLKQHIRYTE----HTKVCPVCKKEFTSTDSALDHVCKKHNI 126


>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query254
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 100.0
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 100.0
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.98
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.96
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.95
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.93
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.92
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.92
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.92
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.91
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.9
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.9
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.89
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.88
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.87
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.86
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.86
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.86
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.85
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.84
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.84
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.83
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.79
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.78
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.78
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.77
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.76
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.76
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.75
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.75
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.74
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.74
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.73
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.73
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.73
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.72
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.72
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.71
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.69
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.69
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.69
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.69
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.68
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.68
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.67
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.65
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.64
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.64
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.64
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.63
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.62
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.62
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.61
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.61
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.6
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.6
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.6
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.59
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.59
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.59
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.58
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.57
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.55
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.55
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.54
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.54
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.54
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.54
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.52
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.52
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.51
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.51
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.5
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.5
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.48
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.48
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.46
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.42
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.39
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.39
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.38
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.34
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.32
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.29
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.29
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.28
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.28
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.28
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.28
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.28
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.28
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.27
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.27
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.27
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.27
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.27
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.27
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.26
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.26
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.26
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.26
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.26
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.26
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.26
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.26
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.26
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.26
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.26
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.25
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.25
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.25
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.25
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.25
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.25
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.25
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.25
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.24
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.24
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.24
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.24
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.24
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.24
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.24
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.24
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.23
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.23
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.23
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.23
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.22
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.21
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.21
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.21
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.21
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.19
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.19
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.18
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.17
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.17
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.17
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.17
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.17
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.16
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.16
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.16
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.16
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.16
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.15
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.15
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.15
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.15
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.15
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.15
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.15
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.15
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.15
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.15
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.14
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.14
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.14
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.14
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.14
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.14
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.14
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.14
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.14
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.14
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.14
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.14
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.14
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.14
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.13
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.13
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.13
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.13
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.13
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.13
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.13
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.13
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.13
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.13
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.12
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.12
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.12
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.12
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.12
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.12
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.12
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.12
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.12
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.12
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.11
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.11
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.11
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.11
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.11
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.11
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.11
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.11
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.11
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.11
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.11
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.11
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.11
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.1
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.1
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.1
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.1
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.1
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.1
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.1
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.1
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.1
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.1
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.1
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.1
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.1
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.1
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.1
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.1
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.1
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.1
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.1
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.09
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.09
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.09
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.09
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.09
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.09
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.09
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.09
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.09
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.09
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.09
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.08
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.08
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.08
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.08
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.08
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.08
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.08
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.08
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.07
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.07
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.07
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.07
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.07
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.06
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.06
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.06
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.06
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.06
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.06
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.06
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.06
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.05
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.05
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.05
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.05
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.05
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.05
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.05
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.05
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.05
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.05
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.04
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.04
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.04
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.04
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.04
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.04
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.04
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.03
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.03
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 99.03
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.02
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.02
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 99.02
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.01
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.0
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.0
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.0
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.99
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.99
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.98
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.98
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.97
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.97
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.97
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.97
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.93
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.91
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.9
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.87
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.8
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.79
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.75
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.74
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.74
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.74
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.72
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.72
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.72
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.68
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.64
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.64
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.64
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.63
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.6
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.6
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.58
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.58
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.56
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.55
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.55
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.54
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.54
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.53
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.53
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.52
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.52
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.5
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.5
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.5
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.5
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.49
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.48
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.46
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.44
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.42
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.42
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.42
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.41
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.41
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.76
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.39
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.39
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.39
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.39
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.38
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.37
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.35
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.35
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.69
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.33
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.33
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.33
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.31
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.29
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.29
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.29
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.28
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.27
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.26
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.25
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.25
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.25
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.24
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.23
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.22
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.22
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.21
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.2
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.19
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.19
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.47
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.17
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.45
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.4
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.08
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.25
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.96
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.83
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.72
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.61
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 97.26
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 96.89
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.8
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.77
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 96.46
2e72_A49 POGO transposable element with ZNF domain; zinc fi 96.44
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 96.24
2e72_A49 POGO transposable element with ZNF domain; zinc fi 96.16
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 95.44
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 95.37
2elu_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 94.8
2elu_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 93.43
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 92.91
2jvx_A28 NF-kappa-B essential modulator; CCHC classical zin 91.89
2k5c_A95 Uncharacterized protein PF0385; structural genomic 91.44
2k9h_A57 Glycoprotein; hantavirus, zinc finger, CCHC, metal 91.02
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 90.64
1wvk_A86 AT2G23090/F21P24.15; structural genomics, protein 89.7
2djr_A76 Zinc finger BED domain-containing protein 2; C2H2 89.18
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 88.11
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 86.91
2yrk_A55 Zinc finger homeobox protein 4; structure genomics 84.86
2yuc_A76 TNF receptor-associated factor 4; ZF-TRAF, cystein 83.87
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 81.74
2gmg_A105 Hypothetical protein PF0610; winged-helix like pro 81.05
6rxn_A46 Rubredoxin; electron transfer(iron-sulfur protein) 80.9
4ayb_P48 DNA-directed RNA polymerase; transferase, multi-su 80.38
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
Probab=100.00  E-value=2.2e-38  Score=232.61  Aligned_cols=181  Identities=24%  Similarity=0.461  Sum_probs=135.7

Q ss_pred             cchhhhhccCCCCCCcccccccccccccHHHHHhHHhhhccCCCCcccccchhhccChHHHHHHHHhhhccCCCcccccc
Q psy12195         60 LPHLSIQHCQGTTPSIYECNQCKEKTNDMTTMLNHYSVKHYMDINMSCVPCDVLFHNKATLYKHLYLEHKATSLSIQCNM  139 (254)
Q Consensus        60 l~~~~~~h~~~~~~~~~~C~~C~~~~~~~~~l~~h~~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~C~~  139 (254)
                      |..+...+   .++++|.|+.|+..|.....|..|+ ..|.++.+|.|+.|++.|.+...|..|+..+++ .. +|.|+.
T Consensus         9 l~~h~~~~---~~~~~~~C~~C~~~f~~~~~l~~H~-~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~-~~-~~~C~~   82 (190)
T 2i13_A            9 SVAQAALE---PGEKPYACPECGKSFSRSDHLAEHQ-RTHTGEKPYKCPECGKSFSDKKDLTRHQRTHTG-EK-PYKCPE   82 (190)
T ss_dssp             -------------------------CCSSHHHHHGG-GCC---CCEECTTTCCEESSHHHHHHHHHHHHC-CC-CEECTT
T ss_pred             chhhhhhc---CCCCCCcCCCCccccCCHHHHHHHH-HHcCCCCCccCCCcCchhCCHHHHHHHHHhcCC-CC-CccCcc
Confidence            33344445   6778899999999999999999998 668888899999999999999999999988543 33 689999


Q ss_pred             cccccCCHHHHHHHHHh-cCCcccccCCCcccCCChHHHHHHHhHhhCCCcccCCCCcccCCCHHHHHHHHHHhhcCCCC
Q psy12195        140 CSLVLDSKESLVTHISQ-THTLMFTCRRCPSTFLNSATLSKHVKMEHNSKSYQCNECPESFERLNKLKRHKFQAHNDSVH  218 (254)
Q Consensus       140 C~~~f~~~~~l~~h~~~-~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~  218 (254)
                      |++.|.+...|..|+.. ..+++|.|+.|++.|.....|..|+++|++++||.|++|++.|.+...|..|++ .|.+ .+
T Consensus        83 C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~-~H~~-~~  160 (190)
T 2i13_A           83 CGKSFSQRANLRAHQRTHTGEKPYACPECGKSFSQLAHLRAHQRTHTGEKPYKCPECGKSFSREDNLHTHQR-THTG-EK  160 (190)
T ss_dssp             TCCEESCHHHHHHHHHHHHTCCCEECTTTCCEESSHHHHHHHHHHHHCCCCEECTTTCCEESCHHHHHHHHH-HHHC-CC
T ss_pred             cCCccCCHHHHHHHHHhcCCCCCCcCCCCCCccCCHHHHHHHHHHhCCCCCeECCCCCcccCCHHHHHHHHH-hcCC-CC
Confidence            99999999999999763 345899999999999999999999999999999999999999999999999998 4555 67


Q ss_pred             CccCcchhhccCCchHHHHHHHHhcCCCCCC
Q psy12195        219 QIQCPYCITDFSEDKNLIQHIVSVHLGKEGT  249 (254)
Q Consensus       219 ~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~  249 (254)
                      +|.|++|++.|.+..+|..|+ +.|.|++||
T Consensus       161 ~~~C~~C~~~f~~~~~L~~H~-~~H~~~k~~  190 (190)
T 2i13_A          161 PYKCPECGKSFSRRDALNVHQ-RTHTGKKTS  190 (190)
T ss_dssp             CEECTTTCCEESSHHHHHHHH-TTC------
T ss_pred             CeECCCCCCccCCHHHHHHHH-HhcCCCCCC
Confidence            999999999999999999999 899999997



>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2elu_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2elw_A Back     alignment and structure
>2elu_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2elw_A Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>2jvx_A NF-kappa-B essential modulator; CCHC classical zinc finger, NEMO zinc finger, beta-BETA- alpha fold, coiled coil, cytoplasm, disease mutation; NMR {Synthetic} PDB: 2jvy_A Back     alignment and structure
>2k5c_A Uncharacterized protein PF0385; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Pyrococcus furiosus} Back     alignment and structure
>2k9h_A Glycoprotein; hantavirus, zinc finger, CCHC, metal binding protein; NMR {Andes virus} Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>1wvk_A AT2G23090/F21P24.15; structural genomics, protein structure initiative, cell free, center for eukaryotic structural genomics, CESG; NMR {Arabidopsis thaliana} SCOP: g.82.1.1 Back     alignment and structure
>2djr_A Zinc finger BED domain-containing protein 2; C2H2 type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>2yrk_A Zinc finger homeobox protein 4; structure genomics, ZF-C2H2 domain, ZFH-4, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.37.1.4 Back     alignment and structure
>2yuc_A TNF receptor-associated factor 4; ZF-TRAF, cysteine-rich domain associated with ring and TRAF domains protein 1, malignant 62; NMR {Homo sapiens} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82 Back     alignment and structure
>6rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.50A {Desulfovibrio desulfuricans} SCOP: g.41.5.1 Back     alignment and structure
>4ayb_P DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2pmz_P 2wb1_P 2y0s_P 3hkz_P 2waq_P 4b1o_P 4b1p_X Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query254
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.69
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.66
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.5
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.36
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.28
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.25
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.25
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.23
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.23
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.22
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.21
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.2
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.16
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.13
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 99.12
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.1
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.08
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.07
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.07
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.05
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.03
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 99.03
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.02
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.98
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.98
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.94
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.93
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.92
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.87
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.76
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.74
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.74
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.73
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.68
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.6
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.59
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.5
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.48
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.46
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.46
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.35
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.32
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 98.29
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.21
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.2
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.18
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.11
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.07
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.06
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.04
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.95
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.94
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.93
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.92
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.9
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.87
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.86
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.82
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.78
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.77
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.75
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.74
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.73
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.7
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.67
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.54
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.53
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.45
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.44
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.44
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.4
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.38
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.38
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.34
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.32
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 97.32
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.28
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.26
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.26
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.18
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 97.13
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.08
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.05
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.03
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.9
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.76
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.64
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 96.51
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.42
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 96.29
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 96.22
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 96.09
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 96.05
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 96.04
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.94
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.91
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 95.9
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 95.87
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 95.74
d1y0jb136 U-shaped transcription factor, different fingers { 95.21
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 95.08
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.07
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.07
d1y0jb136 U-shaped transcription factor, different fingers { 94.99
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 94.95
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 94.65
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 94.09
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 93.75
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 93.55
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 93.53
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 93.28
d1tf3a331 Transcription factor IIIA, TFIIIA {Xenopus laevis 92.51
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 91.65
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 91.35
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 91.04
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 90.37
d2ghfa236 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 89.93
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 89.47
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 89.03
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 88.47
d2ghfa158 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 88.35
d2ghfa236 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 88.21
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 87.53
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 86.7
d1m36a_33 Monocytic leukemia zinc finger protein Moz {Human 85.81
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 85.35
d2ghfa158 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 84.41
d1wjpa341 Zinc finger protein 295, ZNF295 {Human (Homo sapie 81.37
d1x3ca161 Zinc finger protein 292, ZNF292 {Human (Homo sapie 81.08
d2yrka148 Zinc finger homeobox protein 4, ZFHX4 {Human (Homo 80.9
d1x3ca161 Zinc finger protein 292, ZNF292 {Human (Homo sapie 80.58
d2dkta174 RING finger and CHY zinc finger domain-containing 80.33
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.69  E-value=9.5e-18  Score=93.67  Aligned_cols=50  Identities=22%  Similarity=0.588  Sum_probs=25.4

Q ss_pred             cccccCCCcccCCChHHHHHHHhHhhCCCcccCCCCcccCCCHHHHHHHHH
Q psy12195        160 LMFTCRRCPSTFLNSATLSKHVKMEHNSKSYQCNECPESFERLNKLKRHKF  210 (254)
Q Consensus       160 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~  210 (254)
                      +||.|. ||+.|.....|..|+++|++++||.|++||++|.+.+.|.+|++
T Consensus         2 K~y~C~-Cgk~F~~~~~l~~H~~~Ht~ekpy~C~~C~k~F~~~~~L~~H~r   51 (53)
T d2csha1           2 KLYPCQ-CGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMK   51 (53)
T ss_dssp             CCEECT-TSCEESSHHHHHHHHHHHSCCCSEECTTTSCEESSSHHHHHHHT
T ss_pred             cCCCCC-CCCeECCHHHhHHHhhccccccCCcCCCcCCEecCHHHHHHHHh
Confidence            445552 55555555555555555555555555555555555555555543



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1tf3a3 g.37.1.1 (A:71-101) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m36a_ g.37.1.2 (A:) Monocytic leukemia zinc finger protein Moz {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjpa3 g.37.1.1 (A:67-107) Zinc finger protein 295, ZNF295 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3ca1 g.37.1.1 (A:8-68) Zinc finger protein 292, ZNF292 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2yrka1 g.37.1.4 (A:8-55) Zinc finger homeobox protein 4, ZFHX4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3ca1 g.37.1.1 (A:8-68) Zinc finger protein 292, ZNF292 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dkta1 g.89.1.1 (A:8-81) RING finger and CHY zinc finger domain-containing protein 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure