Psyllid ID: psy12196


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150
MSCVPCDVLFHNKATLYKHLYLEHKATSLSIQCNMCSLVLDSKESLVTHISQTHTLMFTCRRCPSTFLNSATLSKHVKMEHNSKSYQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPYCITDFSEDKNLIQHIVSVHLGKEGTAPART
ccccccccccccccHHHHHHHHccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccccccccccccHHHHHcccccccccccccccc
cccHHcccccccccHHHHHHHHcccccccccccccccccEccccHHHHHHHcccccccccccccccEccccHHHHHHHHccccccccccHccccEccccHHHHHHHHccccccccccccHccccccccHHHHHHHHHHcccccccccccc
mscvpcdvlfhNKATLYKHLYLEHKATSLSIQCNMCSLVLDSKESLVTHISQTHTlmftcrrcpstflnsatLSKHVkmehnsksyqcnecpeSFERLNKLKRHkfqahndsvhqiqcpycitdfsedkNLIQHIVSVHlgkegtapart
MSCVPCDVLFHNKATLYKHLYLEHKATSLSIQCNMCSLVLDSKESLVTHISQTHTLMFTCRRCPSTFLNSATLSKHVKMEHNSKSYQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPYCITDFSEDKNLIQHIVsvhlgkegtapart
MSCVPCDVLFHNKATLYKHLYLEHKATSLSIQCNMCSLVLDSKESLVTHISQTHTLMFTCRRCPSTFLNSATLSKHVKMEHNSKSYQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPYCITDFSEDKNLIQHIVSVHLGKEGTAPART
**CVPCDVLFHNKATLYKHLYLEHKATSLSIQCNMCSLVLDSKESLVTHISQTHTLMFTCRRCPSTFLNSATLSK**********************LNKLKRHKFQAHNDSVHQIQCPYCITDFSEDKNLIQHIVSVHL**********
MSCVPCDVLFHNKATLYKHLYLEHKATSLSIQCNMCSLVLDSKESLVTHISQTHTLMFTCRRCPSTFLNSATLSKHVKMEHNSKSYQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPYCITDFSEDKNLIQHIVSVHLGKEGTAP***
MSCVPCDVLFHNKATLYKHLYLEHKATSLSIQCNMCSLVLDSKESLVTHISQTHTLMFTCRRCPSTFLNSATLSKHVKMEHNSKSYQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPYCITDFSEDKNLIQHIVSVHLGKEGTAPART
MSCVPCDVLFHNKATLYKHLYLEHKATSLSIQCNMCSLVLDSKESLVTHISQTHTLMFTCRRCPSTFLNSATLSKHVKMEHNSKSYQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPYCITDFSEDKNLIQHIVSVHLGKEGT*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSCVPCDVLFHNKATLYKHLYLEHKATSLSIQCNMCSLVLDSKESLVTHISQTHTLMFTCRRCPSTFLNSATLSKHVKMEHNSKSYQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPYCITDFSEDKNLIQHIVSVHLGKEGTAPART
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query150 2.2.26 [Sep-21-2011]
Q9EQJ4 579 Zinc finger protein 384 O yes N/A 0.786 0.203 0.325 1e-11
Q8TF68 577 Zinc finger protein 384 O yes N/A 0.786 0.204 0.325 1e-11
Q13105 803 Zinc finger and BTB domai no N/A 0.893 0.166 0.272 7e-11
Q60821 794 Zinc finger and BTB domai no N/A 0.893 0.168 0.265 5e-10
Q9HAZ2 1276 PR domain zinc finger pro no N/A 0.86 0.101 0.297 5e-10
P17012799 Zinc finger X-chromosomal no N/A 0.886 0.166 0.342 1e-09
P17010805 Zinc finger X-chromosomal no N/A 0.886 0.165 0.342 1e-09
Q8TF45 676 Zinc finger protein 418 O no N/A 0.9 0.199 0.290 2e-09
Q95LI3801 Zinc finger Y-chromosomal no N/A 0.886 0.166 0.342 2e-09
O62836800 Zinc finger X-chromosomal no N/A 0.886 0.166 0.342 2e-09
>sp|Q9EQJ4|ZN384_RAT Zinc finger protein 384 OS=Rattus norvegicus GN=Znf384 PE=1 SV=1 Back     alignment and function desciption
 Score = 68.9 bits (167), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 40/123 (32%), Positives = 66/123 (53%), Gaps = 5/123 (4%)

Query: 23  EHKATSLSIQCNMCSLVLDSKESLVTHI-SQTHTLMFTCRRCPSTFLNSATLSKHVKMEH 81
           +H+    + +C MCSL   SK  +  H  S T T    C  C  TF NS+ L++H+++  
Sbjct: 221 DHQKDGKTYRCRMCSLTFYSKSEMQIHSKSHTETKPHKCPHCSKTFANSSYLAQHIRIHS 280

Query: 82  NSKSYQCNECPESFERLNKLKRHK---FQAHNDSVHQIQCPYCITDFSEDKNLIQHIVSV 138
            +K Y CN C +SF +L+ L++H     + H +++   +CP+C   F+    L QH+  +
Sbjct: 281 GAKPYSCNFCEKSFRQLSHLQQHTRIHSKMHTETIKPHKCPHCSKTFANTSYLAQHL-RI 339

Query: 139 HLG 141
           H G
Sbjct: 340 HSG 342




Transcription factor that binds the consensus DNA sequence [GC]AAAAA. Seems to bind and regulate the promoters of MMP1, MMP3, MMP7 and COL1A1.
Rattus norvegicus (taxid: 10116)
>sp|Q8TF68|ZN384_HUMAN Zinc finger protein 384 OS=Homo sapiens GN=ZNF384 PE=1 SV=2 Back     alignment and function description
>sp|Q13105|ZBT17_HUMAN Zinc finger and BTB domain-containing protein 17 OS=Homo sapiens GN=ZBTB17 PE=1 SV=3 Back     alignment and function description
>sp|Q60821|ZBT17_MOUSE Zinc finger and BTB domain-containing protein 17 OS=Mus musculus GN=Zbtb17 PE=1 SV=2 Back     alignment and function description
>sp|Q9HAZ2|PRD16_HUMAN PR domain zinc finger protein 16 OS=Homo sapiens GN=PRDM16 PE=1 SV=3 Back     alignment and function description
>sp|P17012|ZFX_MOUSE Zinc finger X-chromosomal protein OS=Mus musculus GN=Zfx PE=1 SV=2 Back     alignment and function description
>sp|P17010|ZFX_HUMAN Zinc finger X-chromosomal protein OS=Homo sapiens GN=ZFX PE=2 SV=2 Back     alignment and function description
>sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 Back     alignment and function description
>sp|Q95LI3|ZFY_BOVIN Zinc finger Y-chromosomal protein OS=Bos taurus GN=ZFY PE=2 SV=1 Back     alignment and function description
>sp|O62836|ZFX_BOVIN Zinc finger X-chromosomal protein OS=Bos taurus GN=ZFX PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query150
158296910 966 AGAP008232-PA [Anopheles gambiae str. PE 0.866 0.134 0.296 8e-11
432111846 645 Zinc finger protein 384 [Myotis davidii] 0.786 0.182 0.325 4e-10
74192453221 unnamed protein product [Mus musculus] 0.786 0.533 0.325 5e-10
354467295 581 PREDICTED: zinc finger protein 384-like 0.786 0.203 0.325 6e-10
348554974 581 PREDICTED: zinc finger protein 384-like 0.786 0.203 0.325 6e-10
77812688 581 zinc finger protein 384 isoform 1 [Rattu 0.786 0.203 0.325 6e-10
30921314 579 RecName: Full=Zinc finger protein 384; A 0.786 0.203 0.325 6e-10
126352391 584 zinc finger protein 384 isoform 1 [Mus m 0.786 0.202 0.325 6e-10
39793889 588 Zfp384 protein [Mus musculus] 0.786 0.200 0.325 6e-10
334324906 1487 PREDICTED: zinc finger protein 208-like 0.913 0.092 0.344 6e-10
>gi|158296910|ref|XP_317239.4| AGAP008232-PA [Anopheles gambiae str. PEST] gi|157014939|gb|EAA43874.4| AGAP008232-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
 Score = 72.0 bits (175), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 40/135 (29%), Positives = 66/135 (48%), Gaps = 5/135 (3%)

Query: 3   CVPCDVLFHNKATLYKHLYLEHKATSLSIQCNMCSLVLDSKESLVTHISQTHTLM--FTC 60
           CV CD   H+   L  HL + H     + +C +C      + SL+ H +  H  +  F C
Sbjct: 215 CVVCDRQCHDIDQLDDHLVISHHYPKDAYRCELCPRAYSYRPSLLRHRAIVHGELRRFPC 274

Query: 61  RRCPSTFLNSATLSKHVKMEH-NSKSYQCNECPESFERLNKLKRHKFQAHNDSVHQIQCP 119
             CP  F + + L +H++  H  ++S+ C EC ++F   + LK+H    H+ SV   QC 
Sbjct: 275 ENCPKVFTDPSNLQRHIRTHHVGARSHACPECGKTFATSSGLKQHT-HIHS-SVKPFQCE 332

Query: 120 YCITDFSEDKNLIQH 134
            C   +++  NL +H
Sbjct: 333 VCFKSYTQFSNLCRH 347




Source: Anopheles gambiae str. PEST

Species: Anopheles gambiae

Genus: Anopheles

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|432111846|gb|ELK34888.1| Zinc finger protein 384 [Myotis davidii] Back     alignment and taxonomy information
>gi|74192453|dbj|BAE43028.1| unnamed protein product [Mus musculus] Back     alignment and taxonomy information
>gi|354467295|ref|XP_003496105.1| PREDICTED: zinc finger protein 384-like [Cricetulus griseus] Back     alignment and taxonomy information
>gi|348554974|ref|XP_003463299.1| PREDICTED: zinc finger protein 384-like isoform 1 [Cavia porcellus] Back     alignment and taxonomy information
>gi|77812688|ref|NP_596920.2| zinc finger protein 384 isoform 1 [Rattus norvegicus] gi|77812690|ref|NP_001030002.1| zinc finger protein 384 isoform 1 [Rattus norvegicus] gi|149049438|gb|EDM01892.1| zinc finger protein 384, isoform CRA_c [Rattus norvegicus] gi|149049439|gb|EDM01893.1| zinc finger protein 384, isoform CRA_c [Rattus norvegicus] Back     alignment and taxonomy information
>gi|30921314|sp|Q9EQJ4.1|ZN384_RAT RecName: Full=Zinc finger protein 384; AltName: Full=Cas-associated zinc finger protein; AltName: Full=Nuclear matrix transcription factor 4; Short=Nuclear matrix protein 4 gi|11870000|gb|AAG40582.1|AF216804_1 nuclear matrix transcription factor [Rattus norvegicus] Back     alignment and taxonomy information
>gi|126352391|ref|NP_780766.3| zinc finger protein 384 isoform 1 [Mus musculus] Back     alignment and taxonomy information
>gi|39793889|gb|AAH64013.1| Zfp384 protein [Mus musculus] Back     alignment and taxonomy information
>gi|334324906|ref|XP_001374944.2| PREDICTED: zinc finger protein 208-like [Monodelphis domestica] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query150
UNIPROTKB|F1SL43 573 ZNF384 "Uncharacterized protei 0.786 0.205 0.325 5.9e-16
UNIPROTKB|F1PI62 575 ZNF384 "Uncharacterized protei 0.786 0.205 0.325 5.9e-16
UNIPROTKB|Q8TF68 577 ZNF384 "Zinc finger protein 38 0.786 0.204 0.325 5.9e-16
RGD|708346 579 Zfp384 "zinc finger protein 38 0.786 0.203 0.325 6e-16
UNIPROTKB|G3V9M5 581 Zfp384 "Protein Zfp384" [Rattu 0.786 0.203 0.325 6e-16
UNIPROTKB|F1MGZ7 575 ZNF384 "Uncharacterized protei 0.786 0.205 0.325 9.7e-16
ZFIN|ZDB-GENE-080218-22324 zgc:174708 "zgc:174708" [Danio 0.913 0.422 0.300 8.3e-15
ZFIN|ZDB-GENE-110914-41 573 si:dkey-233e3.3 "si:dkey-233e3 0.913 0.239 0.307 1.2e-14
UNIPROTKB|F1NBG4394 ZFX "Uncharacterized protein" 0.886 0.337 0.35 1.7e-14
UNIPROTKB|H0Y6X2241 ZBTB17 "Zinc finger and BTB do 0.913 0.568 0.284 2.3e-14
UNIPROTKB|F1SL43 ZNF384 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
 Score = 208 (78.3 bits), Expect = 5.9e-16, P = 5.9e-16
 Identities = 40/123 (32%), Positives = 66/123 (53%)

Query:    23 EHKATSLSIQCNMCSLVLDSKESLVTHI-SQTHTLMFTCRRCPSTFLNSATLSKHVKMEH 81
             +H+    + +C MCSL   SK  +  H  S T T    C  C  TF NS+ L++H+++  
Sbjct:   226 DHQKDGKTYRCRMCSLTFFSKSEMQIHSKSHTETKPHKCPHCSKTFANSSYLAQHIRIHS 285

Query:    82 NSKSYQCNECPESFERLNKLKRHK---FQAHNDSVHQIQCPYCITDFSEDKNLIQHIVSV 138
              +K Y CN C +SF +L+ L++H     + H +++   +CP+C   F+    L QH+  +
Sbjct:   286 GAKPYSCNFCEKSFRQLSHLQQHTRIHSKMHTETIKPHKCPHCSKTFANTSYLAQHL-RI 344

Query:   139 HLG 141
             H G
Sbjct:   345 HSG 347


GO:0005634 "nucleus" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
UNIPROTKB|F1PI62 ZNF384 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q8TF68 ZNF384 "Zinc finger protein 384" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|708346 Zfp384 "zinc finger protein 384" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|G3V9M5 Zfp384 "Protein Zfp384" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1MGZ7 ZNF384 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-080218-22 zgc:174708 "zgc:174708" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110914-41 si:dkey-233e3.3 "si:dkey-233e3.3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NBG4 ZFX "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|H0Y6X2 ZBTB17 "Zinc finger and BTB domain-containing protein 17" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 150
KOG2462|consensus279 100.0
KOG2462|consensus279 99.96
KOG3608|consensus 467 99.84
KOG3608|consensus467 99.82
KOG1074|consensus 958 99.82
KOG3576|consensus267 99.8
KOG1074|consensus 958 99.78
KOG3623|consensus 1007 99.72
KOG3623|consensus1007 99.66
KOG3576|consensus267 99.65
PLN03086567 PRLI-interacting factor K; Provisional 99.39
PHA00733128 hypothetical protein 99.35
PHA00733128 hypothetical protein 99.16
PLN03086567 PRLI-interacting factor K; Provisional 99.13
PHA0276855 hypothetical protein; Provisional 99.11
PHA0276855 hypothetical protein; Provisional 99.11
PHA0061644 hypothetical protein 99.04
KOG3993|consensus500 98.88
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.83
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.75
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.72
KOG3993|consensus 500 98.68
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.65
PHA0061644 hypothetical protein 98.64
PHA0073279 hypothetical protein 98.58
PHA0073279 hypothetical protein 98.46
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 98.42
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 98.3
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 98.23
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 98.19
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 98.11
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 98.08
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 98.05
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.99
smart0035526 ZnF_C2H2 zinc finger. 97.78
COG5189423 SFP1 Putative transcriptional repressor regulating 97.71
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 97.69
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.65
COG5189423 SFP1 Putative transcriptional repressor regulating 97.57
smart0035526 ZnF_C2H2 zinc finger. 97.56
KOG2231|consensus 669 97.43
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 97.4
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 97.35
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 97.32
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 96.94
PRK04860160 hypothetical protein; Provisional 96.94
PRK04860160 hypothetical protein; Provisional 96.93
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.77
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 96.6
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 96.23
KOG1146|consensus 1406 96.12
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 95.74
COG5236 493 Uncharacterized conserved protein, contains RING Z 95.62
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 95.45
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 94.9
KOG2482|consensus423 94.77
KOG1146|consensus 1406 94.6
COG404965 Uncharacterized protein containing archaeal-type C 94.54
KOG2231|consensus 669 93.53
KOG2893|consensus 341 93.07
KOG4173|consensus253 92.48
KOG2482|consensus423 92.08
KOG2186|consensus 276 91.54
KOG4173|consensus253 91.18
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 91.1
COG404965 Uncharacterized protein containing archaeal-type C 91.05
COG5048 467 FOG: Zn-finger [General function prediction only] 90.77
PF1290740 zf-met2: Zinc-binding 90.16
KOG2893|consensus 341 89.99
PF05443132 ROS_MUCR: ROS/MUCR transcriptional regulator prote 89.88
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 89.7
COG1592166 Rubrerythrin [Energy production and conversion] 89.64
cd0072934 rubredoxin_SM Rubredoxin, Small Modular nonheme ir 89.59
PF1526954 zf-C2H2_7: Zinc-finger 89.55
TIGR0209838 MJ0042_CXXC MJ0042 family finger-like domain. This 89.39
COG288861 Predicted Zn-ribbon RNA-binding protein with a fun 89.36
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 89.16
smart0073426 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18 88.72
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 88.72
COG5236 493 Uncharacterized conserved protein, contains RING Z 88.71
PHA0062659 hypothetical protein 88.62
smart0061450 ZnF_BED BED zinc finger. DNA-binding domain in chr 88.6
PF09986 214 DUF2225: Uncharacterized protein conserved in bact 88.54
TIGR0260552 CxxC_CxxC_SSSS putative regulatory protein, FmdB f 88.31
smart0065944 RPOLCX RNA polymerase subunit CX. present in RNA p 87.71
TIGR00373158 conserved hypothetical protein TIGR00373. This fam 87.25
smart0083441 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_C 86.92
COG5048467 FOG: Zn-finger [General function prediction only] 86.31
PF1371736 zinc_ribbon_4: zinc-ribbon domain 86.12
KOG2186|consensus 276 85.87
PF04959 214 ARS2: Arsenite-resistance protein 2; InterPro: IPR 85.8
PF0289245 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc 85.79
PRK06266178 transcription initiation factor E subunit alpha; V 83.9
PF0972342 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR0134 83.86
PRK1489059 putative Zn-ribbon RNA-binding protein; Provisiona 83.11
smart00531147 TFIIE Transcription initiation factor IIE. 82.08
PF04780 466 DUF629: Protein of unknown function (DUF629); Inte 81.7
PRK0039846 rpoP DNA-directed RNA polymerase subunit P; Provis 81.12
PF14353128 CpXC: CpXC protein 81.06
TIGR02300129 FYDLN_acid conserved hypothetical protein TIGR0230 80.61
KOG2785|consensus 390 80.6
>KOG2462|consensus Back     alignment and domain information
Probab=100.00  E-value=4.5e-36  Score=185.49  Aligned_cols=138  Identities=25%  Similarity=0.485  Sum_probs=128.9

Q ss_pred             CCCCcccccccCHHHHHHHHHHHhh-CCCcceecccccccccChHHHHHHHhccCCcccccCCCCcccCChHHHHHHHHh
Q psy12196          1 MSCVPCDVLFHNKATLYKHLYLEHK-ATSLSIQCNMCSLVLDSKESLVTHISQTHTLMFTCRRCPSTFLNSATLSKHVKM   79 (150)
Q Consensus         1 ~~C~~C~~~f~~~~~l~~h~~~~~~-~~~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~   79 (150)
                      |+|+.||+.+.+.++|.+|...|-. ...+.+.|+.|++.+.....|..|+ ++|..+++|.+||++|...+.|+-|+++
T Consensus       131 ~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHi-rTH~l~c~C~iCGKaFSRPWLLQGHiRT  209 (279)
T KOG2462|consen  131 YKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHI-RTHTLPCECGICGKAFSRPWLLQGHIRT  209 (279)
T ss_pred             eeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHh-hccCCCcccccccccccchHHhhccccc
Confidence            6899999999999999999988543 3467789999999999999999999 9999999999999999999999999999


Q ss_pred             hcCCCcccCCCChhhhcchhHHhhHHhhhcCCCCCCcCCcchhhhccCchHHHHHHHHhcCC
Q psy12196         80 EHNSKSYQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPYCITDFSEDKNLIQHIVSVHLG  141 (150)
Q Consensus        80 ~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~  141 (150)
                      |+|||||.|..|++.|..+++|+.|+++|.+.+  +|+|..|+|.|...+.|.+|.++--..
T Consensus       210 HTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K--~~qC~~C~KsFsl~SyLnKH~ES~C~~  269 (279)
T KOG2462|consen  210 HTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVK--KHQCPRCGKSFALKSYLNKHSESACLK  269 (279)
T ss_pred             ccCCCCccCCcccchhcchHHHHHHHHhhcCCc--cccCcchhhHHHHHHHHHHhhhhcccc
Confidence            999999999999999999999999999999988  999999999999999999999876433



>KOG2462|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>KOG2186|consensus Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF12907 zf-met2: Zinc-binding Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>PF05443 ROS_MUCR: ROS/MUCR transcriptional regulator protein; InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>COG1592 Rubrerythrin [Energy production and conversion] Back     alignment and domain information
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase Back     alignment and domain information
>PF15269 zf-C2H2_7: Zinc-finger Back     alignment and domain information
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain Back     alignment and domain information
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PHA00626 hypothetical protein Back     alignment and domain information
>smart00614 ZnF_BED BED zinc finger Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family Back     alignment and domain information
>smart00659 RPOLCX RNA polymerase subunit CX Back     alignment and domain information
>TIGR00373 conserved hypothetical protein TIGR00373 Back     alignment and domain information
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF13717 zinc_ribbon_4: zinc-ribbon domain Back     alignment and domain information
>KOG2186|consensus Back     alignment and domain information
>PF04959 ARS2: Arsenite-resistance protein 2; InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity [] Back     alignment and domain information
>PF02892 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PRK06266 transcription initiation factor E subunit alpha; Validated Back     alignment and domain information
>PF09723 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR013429 This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria Back     alignment and domain information
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional Back     alignment and domain information
>smart00531 TFIIE Transcription initiation factor IIE Back     alignment and domain information
>PF04780 DUF629: Protein of unknown function (DUF629); InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function Back     alignment and domain information
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional Back     alignment and domain information
>PF14353 CpXC: CpXC protein Back     alignment and domain information
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300 Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query150
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 8e-07
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 3e-06
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 5e-05
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure

Iteration: 1

Score = 49.3 bits (116), Expect = 8e-07, Method: Compositional matrix adjust. Identities = 35/115 (30%), Positives = 49/115 (42%), Gaps = 6/115 (5%) Query: 31 IQCNMCSLVLDSKESLVTHISQTHTLM--FTCRRCPSTFLNSATLSKHVKMEHNSKSYQC 88 +C C K+ L H +THT + C C +F A L H + K Y C Sbjct: 50 YKCPECGKSFSDKKDLTRH-QRTHTGEKPYKCPECGKSFSQRANLRAHQRTHTGEKPYAC 108 Query: 89 NECPESFERLNKLKRHKFQAHNDSVHQIQCPYCITDFSEDKNLIQHIVSVHLGKE 143 EC +SF +L L+ H Q + +CP C FS + NL H H G++ Sbjct: 109 PECGKSFSQLAHLRAH--QRTHTGEKPYKCPECGKSFSREDNLHTH-QRTHTGEK 160
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query150
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 1e-05
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 1e-05
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-04
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 4e-05
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 9e-04
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 6e-05
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 9e-05
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 8e-04
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-04
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 2e-04
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 4e-04
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 4e-04
1ej6_B 1275 Lambda1; icosahedral, non-equivalence, dsRNA virus 7e-04
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
 Score = 41.1 bits (95), Expect = 1e-05
 Identities = 17/119 (14%), Positives = 35/119 (29%), Gaps = 4/119 (3%)

Query: 23  EHKATSLSIQCNMCSLVLDSKESLVTHISQTHTLMFTCRRCPSTFLNSATLSKHVKMEHN 82
           ++ +    I  ++    L     L     +    +          L+ ++    +     
Sbjct: 12  KYLSNHKGIFIHVTLEELKRYHQLTPEQKRLIRAIVKTLIHNPQLLDESSYLYRLLASKA 71

Query: 83  SKSYQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPYCITDFSEDKNLIQHIVSVHLG 141
              + C  C   F     LK+H         H   CP C  +F+   + + H+   H  
Sbjct: 72  ISQFVCPLCLMPFSSSVSLKQHIRYTE----HTKVCPVCKKEFTSTDSALDHVCKKHNI 126


>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>1ej6_B Lambda1; icosahedral, non-equivalence, dsRNA virus, methylase, methyltransferase, guanylyltransferase, zinc finger, icosahedral virus; 3.60A {Reovirus SP} SCOP: i.7.1.1 PDB: 2cse_V Length = 1275 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query150
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 100.0
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 100.0
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.97
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.97
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.96
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.95
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.95
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.94
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.94
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.93
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.92
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.92
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.92
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.92
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.92
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.91
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.91
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.89
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.89
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.89
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.88
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.86
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.85
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.85
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.84
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.82
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.82
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.82
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.81
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.81
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.81
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.8
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.8
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.8
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.79
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.78
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.77
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.76
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.76
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.75
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.75
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.75
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.75
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.74
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.74
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.73
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.72
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.72
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.71
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.7
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.7
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.68
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.68
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.68
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.66
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.65
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.65
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.65
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.64
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.64
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.64
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.63
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.63
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.61
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.6
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.6
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.59
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.58
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.58
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.57
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.56
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.56
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.56
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.55
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.53
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.52
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.51
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.5
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.49
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.44
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.44
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.41
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.38
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.38
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.37
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.37
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.37
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.37
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.37
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.37
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.37
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.37
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.37
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.36
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.36
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.36
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.36
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.36
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.36
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.36
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.36
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.36
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.36
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.36
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.36
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.36
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.36
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.36
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.36
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.36
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.36
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.36
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.36
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.36
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.36
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.36
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.35
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.35
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.35
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.35
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.35
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.35
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.35
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.35
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.35
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.35
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.35
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.35
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.35
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.35
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.35
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.35
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.35
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.35
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.35
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.35
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.35
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.35
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.35
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.35
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.35
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.35
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.35
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.35
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.35
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.35
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.35
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.34
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.34
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.34
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.34
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.34
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.34
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.34
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.34
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.34
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.34
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.34
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.34
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.34
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.34
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.34
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.34
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.34
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.34
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.34
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.34
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.34
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.34
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.33
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.33
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.33
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.33
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.33
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.33
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.33
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.33
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.33
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.33
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.33
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.33
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.33
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.33
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.33
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.33
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.32
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.32
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.32
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.32
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.32
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.32
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.31
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.31
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.31
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.31
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.31
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.31
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.31
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.31
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.31
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.31
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.31
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.3
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.3
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.3
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.3
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.3
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.3
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.3
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.3
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.29
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.29
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.29
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.29
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.29
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.29
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.29
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.28
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.28
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.28
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.28
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.28
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.27
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.27
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.26
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.26
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.26
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.26
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.25
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.25
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.25
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.25
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.24
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.24
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.24
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.24
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.24
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.23
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.23
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.23
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.23
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.23
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.23
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.23
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.23
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.23
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.23
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.22
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.22
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.22
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.22
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.22
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.22
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.22
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.22
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.22
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.22
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.21
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.2
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.2
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.2
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.2
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.2
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.2
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 99.2
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.2
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.2
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.19
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.18
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.18
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 99.18
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.17
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.17
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.17
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.17
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.17
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.16
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.16
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.16
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.15
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.15
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.14
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 99.14
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.13
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.12
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.11
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 99.11
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 99.1
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 99.08
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 99.08
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 99.08
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.07
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 99.06
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 99.02
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.01
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.99
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.96
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.92
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.91
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.9
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.89
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.88
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.87
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.86
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.85
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.85
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.85
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.85
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.84
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.84
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.82
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.82
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.81
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.8
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.79
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.79
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.78
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.78
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.78
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.77
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.77
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.76
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.74
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.74
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.74
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 98.2
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.71
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.71
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.7
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.7
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.69
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.69
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.69
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.68
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.68
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 98.13
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.67
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.67
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.67
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.66
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.66
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.63
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.63
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.62
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.62
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.61
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.58
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.57
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.56
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.96
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.5
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.5
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.49
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.46
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.46
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.44
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.44
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.44
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.41
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.41
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.4
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.37
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.36
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.35
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.35
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.33
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.65
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 98.31
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.63
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.26
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.5
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 98.01
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.72
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.57
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 97.06
2e72_A49 POGO transposable element with ZNF domain; zinc fi 96.99
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 96.93
2e72_A49 POGO transposable element with ZNF domain; zinc fi 96.87
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 96.86
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.74
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 96.58
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 95.76
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 95.45
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 93.88
2jsp_A87 Transcriptional regulatory protein ROS; prokaryoti 92.77
6rxn_A46 Rubredoxin; electron transfer(iron-sulfur protein) 92.52
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 92.27
2jvx_A28 NF-kappa-B essential modulator; CCHC classical zin 92.02
2djr_A76 Zinc finger BED domain-containing protein 2; C2H2 90.47
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 89.97
2i5o_A39 DNA polymerase ETA; zinc finger, DNA polymerase,PO 89.65
2k5c_A95 Uncharacterized protein PF0385; structural genomic 89.04
2gmg_A105 Hypothetical protein PF0610; winged-helix like pro 88.88
2k9h_A57 Glycoprotein; hantavirus, zinc finger, CCHC, metal 88.74
2elu_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 86.14
1e8j_A52 Rubredoxin; iron-sulfur-protein, zinc-substitution 86.03
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 84.96
3sp4_A204 Aprataxin-like protein; HIT domain, zinc finger, D 84.93
1yuz_A202 Nigerythrin; rubrythrin, rubredoxin, hemerythrin, 83.64
1wvk_A86 AT2G23090/F21P24.15; structural genomics, protein 83.45
1vq8_Z83 50S ribosomal protein L37AE; ribosome 50S, protein 81.4
2kn9_A81 Rubredoxin; metalloprotein, ssgcid, structural gen 80.68
1wir_A121 Protein arginine N-methyltransferase 3; C2H2 zinc 80.66
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
Probab=100.00  E-value=4.8e-35  Score=179.91  Aligned_cols=139  Identities=24%  Similarity=0.476  Sum_probs=82.6

Q ss_pred             CCCcccccccCHHHHHHHHHHHhhCCCcceecccccccccChHHHHHHHhcc-CCcccccCCCCcccCChHHHHHHHHhh
Q psy12196          2 SCVPCDVLFHNKATLYKHLYLEHKATSLSIQCNMCSLVLDSKESLVTHISQT-HTLMFTCRRCPSTFLNSATLSKHVKME   80 (150)
Q Consensus         2 ~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~-~~~~~~c~~c~~~f~~~~~l~~h~~~~   80 (150)
                      .|+.|++.|.+...|..|+..++  +..+|.|+.|++.|.....|..|+... ..++|.|+.|++.|.+...|..|+..|
T Consensus        51 ~C~~C~~~f~~~~~l~~H~~~h~--~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h  128 (190)
T 2i13_A           51 KCPECGKSFSDKKDLTRHQRTHT--GEKPYKCPECGKSFSQRANLRAHQRTHTGEKPYACPECGKSFSQLAHLRAHQRTH  128 (190)
T ss_dssp             ECTTTCCEESSHHHHHHHHHHHH--CCCCEECTTTCCEESCHHHHHHHHHHHHTCCCEECTTTCCEESSHHHHHHHHHHH
T ss_pred             cCCCcCchhCCHHHHHHHHHhcC--CCCCccCcccCCccCCHHHHHHHHHhcCCCCCCcCCCCCCccCCHHHHHHHHHHh
Confidence            46666666666666666665533  334466666666666666666665322 235666666666666666666666666


Q ss_pred             cCCCcccCCCChhhhcchhHHhhHHhhhcCCCCCCcCCcchhhhccCchHHHHHHHHhcCCCCC
Q psy12196         81 HNSKSYQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPYCITDFSEDKNLIQHIVSVHLGKEG  144 (150)
Q Consensus        81 ~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~  144 (150)
                      +++++|.|.+|++.|.....|..|+++|++++  +|.|+.|++.|.....|..|+++|++++||
T Consensus       129 ~~~~~~~C~~C~~~f~~~~~L~~H~~~H~~~~--~~~C~~C~~~f~~~~~L~~H~~~H~~~k~~  190 (190)
T 2i13_A          129 TGEKPYKCPECGKSFSREDNLHTHQRTHTGEK--PYKCPECGKSFSRRDALNVHQRTHTGKKTS  190 (190)
T ss_dssp             HCCCCEECTTTCCEESCHHHHHHHHHHHHCCC--CEECTTTCCEESSHHHHHHHHTTC------
T ss_pred             CCCCCeECCCCCcccCCHHHHHHHHHhcCCCC--CeECCCCCCccCCHHHHHHHHHhcCCCCCC
Confidence            66666666666666666666666666666655  666666666666666666666666666654



>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2jsp_A Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens} Back     alignment and structure
>6rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.50A {Desulfovibrio desulfuricans} SCOP: g.41.5.1 Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>2jvx_A NF-kappa-B essential modulator; CCHC classical zinc finger, NEMO zinc finger, beta-BETA- alpha fold, coiled coil, cytoplasm, disease mutation; NMR {Synthetic} PDB: 2jvy_A Back     alignment and structure
>2djr_A Zinc finger BED domain-containing protein 2; C2H2 type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>2i5o_A DNA polymerase ETA; zinc finger, DNA polymerase,POL ETA, UBZ, ubiquitin-binding zinc finger, translesion synthesis, ubiquitin-binding domain; HET: DNA; NMR {Homo sapiens} Back     alignment and structure
>2k5c_A Uncharacterized protein PF0385; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Pyrococcus furiosus} Back     alignment and structure
>2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82 Back     alignment and structure
>2k9h_A Glycoprotein; hantavirus, zinc finger, CCHC, metal binding protein; NMR {Andes virus} Back     alignment and structure
>2elu_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2elw_A Back     alignment and structure
>1e8j_A Rubredoxin; iron-sulfur-protein, zinc-substitution, thermostability; NMR {Desulfovibrio gigas} SCOP: g.41.5.1 PDB: 1rdg_A 2dsx_A 1spw_A Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>3sp4_A Aprataxin-like protein; HIT domain, zinc finger, DNA-binding protein, DNA deadenylas hydrolase; 1.80A {Schizosaccharomyces pombe} PDB: 3spd_A* 3spl_A* 3szq_A* Back     alignment and structure
>1yuz_A Nigerythrin; rubrythrin, rubredoxin, hemerythrin, electron transfer, DIIR center, oxidoreductase; 1.40A {Desulfovibrio vulgaris subsp} SCOP: a.25.1.1 g.41.5.1 PDB: 1yv1_A 1yux_A Back     alignment and structure
>1wvk_A AT2G23090/F21P24.15; structural genomics, protein structure initiative, cell free, center for eukaryotic structural genomics, CESG; NMR {Arabidopsis thaliana} SCOP: g.82.1.1 Back     alignment and structure
>1vq8_Z 50S ribosomal protein L37AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1vq4_Z* 1vq6_Z* 1vq5_Z* 1vq7_Z* 1vq9_Z* 1vqk_Z* 1vql_Z* 1vqm_Z* 1vqn_Z* 1vqo_Z* 1vqp_Z* 1yhq_Z* 1yi2_Z* 1yij_Z* 1yit_Z* 1yj9_Z* 1yjn_Z* 1yjw_Z* 2qa4_Z* 1s72_Z* ... Back     alignment and structure
>2kn9_A Rubredoxin; metalloprotein, ssgcid, structural genomics, seattle structural genomics center for infectious electron transport, iron; NMR {Mycobacterium tuberculosis} Back     alignment and structure
>1wir_A Protein arginine N-methyltransferase 3; C2H2 zinc finger domain, PRMT3, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.37.1.5 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query150
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.76
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.73
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.46
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.45
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.41
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.4
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.39
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.38
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.38
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.38
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.36
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.33
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.32
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.31
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.29
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.27
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.25
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.25
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 99.24
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.21
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.19
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.18
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 99.18
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.16
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.16
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 99.13
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.13
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.1
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 99.05
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.01
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.97
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.9
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.88
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.86
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.83
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.82
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.77
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.71
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.61
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.58
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.57
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.54
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.47
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.47
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.41
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.37
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.34
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.31
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.28
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.25
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 98.25
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.19
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 98.16
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 98.15
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 98.06
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 98.05
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.03
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.0
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.99
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.95
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.94
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.89
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.72
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.71
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.68
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.66
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.65
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.58
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.55
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.5
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.48
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.48
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.47
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.43
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.42
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.4
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.35
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.35
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.26
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 97.21
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.16
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.15
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.13
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 97.06
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 97.04
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 97.03
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.99
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 96.97
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.93
d1y0jb136 U-shaped transcription factor, different fingers { 96.9
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.8
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 96.74
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 96.64
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 96.61
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.59
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 96.58
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.56
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.55
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 96.51
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.51
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 96.45
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 96.36
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.06
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 96.03
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 95.71
d1y0jb136 U-shaped transcription factor, different fingers { 95.5
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 94.99
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 94.36
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 93.96
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 93.95
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 93.35
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 93.05
d1wjpa341 Zinc finger protein 295, ZNF295 {Human (Homo sapie 92.27
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 92.17
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 91.88
d1fu9a_36 U-shaped transcription factor, different fingers { 91.6
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 91.56
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 90.49
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 89.9
d6rxna_45 Rubredoxin {Desulfovibrio desulfuricans, strain 27 89.39
d1tf3a331 Transcription factor IIIA, TFIIIA {Xenopus laevis 88.92
d1m36a_33 Monocytic leukemia zinc finger protein Moz {Human 87.25
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.76  E-value=1.5e-19  Score=86.76  Aligned_cols=53  Identities=25%  Similarity=0.453  Sum_probs=36.4

Q ss_pred             CCcccCCCChhhhcchhHHhhHHhhhcCCCCCCcCCcchhhhccCchHHHHHHHHh
Q psy12196         83 SKSYQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPYCITDFSEDKNLIQHIVSV  138 (150)
Q Consensus        83 ~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~  138 (150)
                      |+||.| .||+.|.....|..|+++|++++  ||.|++|+++|...+.|..|+++|
T Consensus         1 EK~y~C-~Cgk~F~~~~~l~~H~~~Ht~ek--py~C~~C~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           1 DKLYPC-QCGKSFTHKSQRDRHMSMHLGLR--PYGCGVCGKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             CCCEEC-TTSCEESSHHHHHHHHHHHSCCC--SEECTTTSCEESSSHHHHHHHTTT
T ss_pred             CcCCCC-CCCCeECCHHHhHHHhhcccccc--CCcCCCcCCEecCHHHHHHHHhcC
Confidence            466777 37777777777777777776666  677777777777777777776554



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1wjpa3 g.37.1.1 (A:67-107) Zinc finger protein 295, ZNF295 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1fu9a_ g.37.1.2 (A:) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d6rxna_ g.41.5.1 (A:) Rubredoxin {Desulfovibrio desulfuricans, strain 27774 [TaxId: 876]} Back     information, alignment and structure
>d1tf3a3 g.37.1.1 (A:71-101) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1m36a_ g.37.1.2 (A:) Monocytic leukemia zinc finger protein Moz {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure