Psyllid ID: psy12199


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------
MFIALIQLLKAETLLSGEHSALSIDQVERSDDFKPPSSTLPRAQPKRLGDDDILLRKRPHKKKKARLLKEEVPVVMVRQAMVTCHTAVHQATPWQEVPGSIPSQAMNPTMLTTTRVGNISLKIPRCEECDINFPSKMRHTFHLQHHLEDPDLPVNFMHECRECGSQFADILKHSLETHLSFIHVQDNQLKCTICNKENFKNQLSLSIHMRYHENVREYECEICKKKFINKSTLKEHSVSHMSVKPFKCEICGHYLSRASRLRAHLKAHSVVASNNKVQNCKKCFKCCQVFPSNEENLRKHFEKVHFDLEFDEAHFYDVVLKCVYRFRIVQYFLCELCDKTSIHYTYLCLHKKLKHSNLTYGGESPVCEPCNLTFKNEWQYLVHNRAVHELPPEPNSGAGSVLQNNPYPPLRKAKQHVKSVTCSVCEKAFSSKENCKAHYTRQHGNKEPKEPKSGEGLPALEQLLKMKPYTCEICSKTYTVEGSLLTHYDMHSGEFYQCDVCFKEFRSSVTLRNHTRRHDNFSCDECSVECQDLNALRMHTLREHGYKILACEKCDVKFTHKALLAEHINTKHNTDVTLKCQLCNVVVLIEEVIFWIS
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcc
ccccccccEEcccccccEccccHHHEHEccccccccccccccccEEEccccHHHHHEHcccccccccccHccccEEcccccHHEHEHccccccccccccccccEcccccHHHHHEHccccccccccccccccEccccHHHHHHHHccccccccccccEEcccccccEcccccHHHHHHHHHHccccccccccccccEEEEccccHHHHHHHccccccccccccccEEccccHHHHHHHHcccccccccccccccEccccHHHHHHHHHccccccccccccccccccEccccHHHHHHHHcccccccEcccccEEccccHHHEHEHHcccccccccccccEEcccccHHEHEEEcccccccccccccccHccccEccccHHHHHHHHccccccccccccccEccccHHHHHHHHcccccccccccccccEccccHHHHHHHHcccccccccccccccEEcccccccccccEcccccccEccccHHHHHHHHccccEEEccccccEEccccHHHEHEHEccccEcccccccEccccHHHHHHHHcccccccccccccccEcccccHHHHHHHEcccccccEcccccccEcccccEEEcc
MFIALIQLLKAEtllsgehsalsidqversddfkppsstlpraqpkrlgdddillrkrphkkKKARLLKEEVPVVMVRQAMVTCHTAvhqatpwqevpgsipsqamnptmltttrvgnislkiprceecdinfpskmrhtfhlqhhledpdlpvnfmheCRECGSQFADILKHSLETHLSFIHVqdnqlkcticnkenfknQLSLSIHMRYHENVREYECEICKkkfinkstlkehsvshmsvkpfkceicghYLSRASRLRAHLKAHSVVAsnnkvqnckkcfkccqvfpsneenLRKHFEKVhfdlefdeaHFYDVVLKCVYRFRIVQYFLCELCDKTSIHYTYLCLHKklkhsnltyggespvcepcnltfknEWQYLVHNravhelppepnsgagsvlqnnpypplrkakqhvkSVTCSVCEKafsskenckahytrqhgnkepkepksgeglpALEQLlkmkpytceicsktytvegsllthydmhsgefyqcdvcfkefrssvtlrnhtrrhdnfscdecsVECQDLNALRMHTLREHGYKILACEKCDVKFTHKALLAEHintkhntdvtlkcQLCNVVVLIEEVIFWIS
MFIALIQLLKAETLLSGEHSALsidqversddfkppsstlpraqpkrlgdddillrkrphkkkkarllkeevpvVMVRQAMVTCHTAVHQATPWQEVPGSIPSQAMNPTMLTTTRVGNISLKIPRCEECDINFPSKMRHTFHLQHHLEDPDLPVNFMHECRECGSQFADILKHSLETHLSFIHVQDNQLKCTICNKENFKNQLSLSIHMRYHENVREYECEICKKKFINKSTLKEHSVSHMSVKPFKCEICGHYLSRASRLRAHLKAHSVvasnnkvqncKKCFKCCQVFPSNEENLRKHFEKVHFDLEFDEAHFYDVVLKCVYRFRIVQYFLCELCDKTSIHYTYLCLHKKLKHSNLTYGGESPVCEPCNLTFKNEWQYLVHNRAVHELPPEPNSGAGSVLQNNPYPPLRKAKQHVKSVTCSVCEKafsskenckahytrqhgnkepkepksgeGLPALEQLLKMKPYTCEICSKTYTVEGSLLTHYDMHSGEFYQCDVCFKEFRSSVTLRnhtrrhdnfscdECSVECQDLNALRMHTLREHGYKILACEKCDVKFTHKALLAEHIntkhntdvtlKCQLCNVVVLIEEVIFWIS
MFIALIQLLKAETLLSGEHSALSIDQVERSDDFKPPSSTLPRAQPKRLGDDDILLRKRPHKKKKARLLKEEVPVVMVRQAMVTCHTAVHQATPWQEVPGSIPSQAMNPTMLTTTRVGNISLKIPRCEECDINFPSKMRHTFHLQHHLEDPDLPVNFMHECRECGSQFADILKHSLETHLSFIHVQDNQLKCTICNKENFKNQLSLSIHMRYHENVREYECEICKKKFINKSTLKEHSVSHMSVKPFKCEICGHYLSRASRLRAHLKAHSVVASNNKVQNCKKCFKCCQVFPSNEENLRKHFEKVHFDLEFDEAHFYDVVLKCVYRFRIVQYFLCELCDKTSIHYTYLCLHKKLKHSNLTYGGESPVCEPCNLTFKNEWQYLVHNRAVHELPPEPNSGAGSVLQNNPYPPLRKAKQHVKSVTCSVCEKAFSSKENCKAHYTRQHGNKEPKEPKSGEGLPALEQLLKMKPYTCEICSKTYTVEGSLLTHYDMHSGEFYQCDVCFKEFRSSVTLRNHTRRHDNFSCDECSVECQDLNALRMHTLREHGYKILACEKCDVKFTHKALLAEHINTKHNTDVTLKCQLCNVVVLIEEVIFWIS
*FIALIQLLKAETLL***************************************************LLKEEVPVVMVRQAMVTCHTAVHQATPWQEVPG********PTMLTTTRVGNISLKIPRCEECDINFPSKMRHTFHLQHHLEDPDLPVNFMHECRECGSQFADILKHSLETHLSFIHVQDNQLKCTICNKENFKNQLSLSIHMRYHENVREYECEICKKKFINKSTLKEHSVSHMSVKPFKCEICGHYLSRASRLRAHLKAHSVVASNNKVQNCKKCFKCCQVFPSNEENLRKHFEKVHFDLEFDEAHFYDVVLKCVYRFRIVQYFLCELCDKTSIHYTYLCLHKKLKHSNLTYGGESPVCEPCNLTFKNEWQYLVHNRAVH*******************************VTCSVCE**********************************EQLLKMKPYTCEICSKTYTVEGSLLTHYDMHSGEFYQCDVCFKEFRSSVTLRNHTRRHDNFSCDECSVECQDLNALRMHTLREHGYKILACEKCDVKFTHKALLAEHINTKHNTDVTLKCQLCNVVVLIEEVIFWI*
MFIALIQLLKAETLLSGEHSALSIDQVER****K*****LPRAQPKRLGDDDILLRKRPHKKKKARLLKEEVPVVMVRQAMVTCHTAVHQATPWQEVPGSIPSQAMNPTMLTTTRVGNISLKIPRCEECDINFPSKMRHTFHLQHHLEDPDLPVNFMHECRECGSQFADILKHSLETHLSFIHVQDNQLKCTICNKENFKNQLSLSIHMRYHENVREYECEICKKKFINKSTLKEHSVSHMSVKPFKCEICGHYLSRASRLRAHLKAHSVVASNNKVQNCKKCFKCCQVFPSNEENLRKHFEKVHFDLEFDEAHFYDVVLKCVYRFRIVQYFLCELCDKTSIHYTYLCLHKKLKHSNLTYGGESPVCEPCNLTFKNEWQYLVHNRAVHELPPEPNSGAGSVLQNNPYPPLRKAKQHVKSVTCSVCEKAFSSKENCKAHYTRQHGNKEPKEPKSGEGLPALEQLLKMKPYTCEICSKTYTVEGSLLTHYDMHSGEFYQCDVCFKEFRSSVTLRNHTRRHDNFSCDECSVECQDLNALRMHTLREHGYKILACEKCDVKFTHKALLAEHINTKHNTDVTLKCQLCNVVVLIEEVIFWI*
MFIALIQLLKAETLLSGEHSALSIDQVERSDDFKPPSSTLPRAQPKRLGDDDILLRKRPHKKKKARLLKEEVPVVMVRQAMVTCHTAVHQATPWQEVPGSIPSQAMNPTMLTTTRVGNISLKIPRCEECDINFPSKMRHTFHLQHHLEDPDLPVNFMHECRECGSQFADILKHSLETHLSFIHVQDNQLKCTICNKENFKNQLSLSIHMRYHENVREYECEICKKKFINKSTLKEHSVSHMSVKPFKCEICGHYLSRASRLRAHLKAHSVVASNNKVQNCKKCFKCCQVFPSNEENLRKHFEKVHFDLEFDEAHFYDVVLKCVYRFRIVQYFLCELCDKTSIHYTYLCLHKKLKHSNLTYGGESPVCEPCNLTFKNEWQYLVHNRAVHELPPEPNSGAGSVLQNNPYPPL**********TCSVCEKAFSSKENCKA****************GEGLPALEQLLKMKPYTCEICSKTYTVEGSLLTHYDMHSGEFYQCDVCFKEFRSSVTLRNHTRRHDNFSCDECSVECQDLNALRMHTLREHGYKILACEKCDVKFTHKALLAEHINTKHNTDVTLKCQLCNVVVLIEEVIFWIS
MFIALIQLLKAETLLSGEHSALSIDQVERSDDFKPPSSTLPRAQPKRLGDDDILLRKRPHKKKKARLLKEEVPVVMVRQAMVTCHTAVHQATPWQEVPGSIPSQAMNPTMLTTTRVGNISLKIPRCEECDINFPSKMRHTFHLQHHLEDPDLPVNFMHECRECGSQFADILKHSLETHLSFIHVQDNQLKCTICNKENFKNQLSLSIHMRYHENVREYECEICKKKFINKSTLKEHSVSHMSVKPFKCEICGHYLSRASRLRAHLKAHSVVASNNKVQNCKKCFKCCQVFPSNEENLRKHFEKVHFDLEFDEAHFYDVVLKCVYRFRIVQYFLCELCDKTSIHYTYLCLHKKLKHSNLTYGGESPVCEPCNLTFKNEWQYLVHNRAVHELPPEPNSGAGSVLQNNPYPPLRKAKQHVKSVTCSVCEKAFSSKENCKAHYTRQHGNKEPKEPKSGEGLPALEQLLKMKPYTCEICSKTYTVEGSLLTHYDMHSGEFYQCDVCFKEFRSSVTLRNHTRRHDNFSCDECSVECQDLNALRMHTLREHGYKILACEKCDVKFTHKALLAEHINTKHNTDVTLKCQLCNVVVLIEEV*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFIALIQLLKAETLLSGEHSALSIDQVERSDDFKPPSSTLPRAQPKRLGDDDILLRKRPHKKKKARLLKEEVPVVMVRQAMVTCHTAVHQATPWQEVPGSIPSQAMNPTMLTTTRVGNISLKIPRCEECDINFPSKMRHTFHLQHHLEDPDLPVNFMHECRECGSQFADILKHSLETHLSFIHVQDNQLKCTICNKENFKNQLSLSIHMRYHENVREYECEICKKKFINKSTLKEHSVSHMSVKPFKCEICGHYLSRASRLRAHLKAHSVVASNNKVQNCKKCFKCCQVFPSNEENLRKHFEKVHFDLEFDEAHFYDVVLKCVYRFRIVQYFLCELCDKTSIHYTYLCLHKKLKHSNLTYGGESPVCEPCNLTFKNEWQYLVHNRAVHELPPEPNSGAGSVLQNNPYPPLRKAKQHVKSVTCSVCEKAFSSKENCKAHYTRQHGNKEPKEPKSGEGLPALEQLLKMKPYTCEICSKTYTVEGSLLTHYDMHSGEFYQCDVCFKEFRSSVTLRNHTRRHDNFSCDECSVECQDLNALRMHTLREHGYKILACEKCDVKFTHKALLAEHINTKHNTDVTLKCQLCNVVVLIEEVIFWIS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query597 2.2.26 [Sep-21-2011]
Q14588700 Zinc finger protein 234 O yes N/A 0.835 0.712 0.248 7e-31
Q054811191 Zinc finger protein 91 OS no N/A 0.718 0.360 0.280 2e-30
P10076 861 Zinc finger protein 26 OS no N/A 0.731 0.507 0.265 5e-30
Q5MCW4686 Zinc finger protein 569 O no N/A 0.658 0.572 0.288 1e-29
Q4V348819 Zinc finger protein 658B no N/A 0.780 0.568 0.266 2e-29
Q80W31679 Zinc finger protein 569 O no N/A 0.658 0.578 0.283 2e-29
Q5TYW11059 Zinc finger protein 658 O no N/A 0.780 0.440 0.264 3e-29
Q02386682 Zinc finger protein 45 OS no N/A 0.619 0.542 0.281 4e-29
Q9HCG1818 Zinc finger protein 160 O no N/A 0.802 0.585 0.262 7e-29
Q8NB50 900 Zinc finger protein 62 ho no N/A 0.731 0.485 0.268 1e-28
>sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 Back     alignment and function desciption
 Score =  135 bits (341), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 150/603 (24%), Positives = 230/603 (38%), Gaps = 104/603 (17%)

Query: 52  DILLRKRPHKKKKARLLKEEVPVVMVRQAMVTCHTAVHQATPWQEVPGSIPSQAMN--PT 109
           DI+      K K A  ++ EV  V             H+   W ++   I S  +    +
Sbjct: 66  DIMKTATQRKGKSADKIQSEVETVP--------EAGRHEELYWGQIWKQIASDLIKYEDS 117

Query: 110 MLTTTRV---GNISLKIP-------------RCEECDINFPSKMRHTFHLQHHLEDPDLP 153
           M++ +R    G++S ++              +C+E   +F        H Q H  +    
Sbjct: 118 MISISRFPRQGDLSCQVRAGLYTTHTGQKFYQCDEYKKSFTDVFNFDLHQQLHSGEKS-- 175

Query: 154 VNFMHECRECGSQFADILKHSLETHLSFIHVQDNQLKCTICNKE---------------- 197
               H C ECG  F  I   +L  H   +H+ +   KC +C KE                
Sbjct: 176 ----HTCDECGKSFCYIS--ALHIHQR-VHMGEKCYKCDVCGKEFSQSSHLQTHQRVHTV 228

Query: 198 -----------NFKNQLSLSIHMRYHENVREYECEICKKKFINKSTLKEHSVSHMSVKPF 246
                       F  + +L++H + H   + Y CE C + FI+ S L+EH   H   KPF
Sbjct: 229 EKPFKCVECGKGFSRRSTLTVHCKLHSGEKPYNCEECGRAFIHASHLQEHQRIHTGEKPF 288

Query: 247 KCEICGHYLSRASRLRAHLKAHSVVASNNKVQNCKKCFKCCQVFPSNEENLRKHFEKVHF 306
           KC+ CG    R S L  H   H+      K ++C KCF C         NLR H ++VH 
Sbjct: 289 KCDTCGKNFRRRSALNNHCMVHT-GEKPYKCEDCGKCFTC-------SSNLRIH-QRVHT 339

Query: 307 DLEFDEAHFYDVVLKCVYRFRIVQY----------FLCELCDKTSIHYTYLCLHKKLKHS 356
               ++ +  +   KC  +    Q           ++C++C K  I+ +    H+ +   
Sbjct: 340 G---EKPYKCEECGKCFIQPSQFQAHRRIHTGEKPYVCKVCGKGFIYSSSFQAHQGV--- 393

Query: 357 NLTYGGESPV-CEPCNLTFKNEWQYLVHNRAVHELPPEPNSGAGSVLQNNPYPPLR-KAK 414
              + GE P  C  C  +F+ +  Y VH        P      G   + + Y  +  KA 
Sbjct: 394 ---HTGEKPYKCNECGKSFRMKIHYQVHLVVHTGEKPYKCEVCGKAFRQSSYLKIHLKAH 450

Query: 415 QHVKSVTCSVCEKAFSSKENCKAHYTRQHGNKEPKEPKSGEGLPALEQL-------LKMK 467
              K   C  C + F+     + H     G K  K  + G+G      L          K
Sbjct: 451 SVQKPFKCEECGQGFNQSSRLQIHQLIHTGEKPYKCEECGKGFSRRADLKIHCRIHTGEK 510

Query: 468 PYTCEICSKTYTVEGSLLTHYDMHSGEF-YQCDVCFKEFRSSVTLRNHTRRHDN---FSC 523
           PY CE C K ++    LLTH  +HSGE  ++C+ C K F  S  L+ H + H     + C
Sbjct: 511 PYNCEECGKVFSQASHLLTHQRVHSGEKPFKCEECGKSFSRSAHLQAHQKVHTGEKPYKC 570

Query: 524 DECSVECQDLNALRMHTLREHGYKILACEKCDVKFTHKALLAEHINTKHNTDVTLKCQLC 583
            EC    +    L MH     G K   C +C   F+  + L  H  + H  +   KC +C
Sbjct: 571 GECGKGFKWSLNLDMHQRVHTGEKPYTCGECGKHFSQASSLQLH-QSVHTGEKPYKCDVC 629

Query: 584 NVV 586
             V
Sbjct: 630 GKV 632




May be involved in transcriptional regulation.
Homo sapiens (taxid: 9606)
>sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 Back     alignment and function description
>sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 Back     alignment and function description
>sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=2 SV=1 Back     alignment and function description
>sp|Q4V348|Z658B_HUMAN Zinc finger protein 658B OS=Homo sapiens GN=ZNF658B PE=2 SV=1 Back     alignment and function description
>sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 Back     alignment and function description
>sp|Q5TYW1|ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens GN=ZNF658 PE=2 SV=2 Back     alignment and function description
>sp|Q02386|ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens GN=ZNF45 PE=2 SV=2 Back     alignment and function description
>sp|Q9HCG1|ZN160_HUMAN Zinc finger protein 160 OS=Homo sapiens GN=ZNF160 PE=2 SV=3 Back     alignment and function description
>sp|Q8NB50|ZFP62_HUMAN Zinc finger protein 62 homolog OS=Homo sapiens GN=ZFP62 PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query597
328711731588 PREDICTED: zinc finger protein 271-like 0.765 0.777 0.283 2e-34
432912348 1168 PREDICTED: zinc finger protein Xfin-like 0.715 0.365 0.291 7e-34
328726602 740 PREDICTED: zinc finger protein Xfin-like 0.812 0.655 0.249 4e-33
390478794 1513 PREDICTED: zinc finger protein 729-like 0.752 0.296 0.287 5e-33
260837236581 hypothetical protein BRAFLDRAFT_93654 [B 0.726 0.746 0.294 9e-33
358417009 1448 PREDICTED: LOW QUALITY PROTEIN: zinc fin 0.654 0.270 0.274 2e-32
338710160 708 PREDICTED: zinc finger protein 234 [Equu 0.723 0.610 0.278 3e-32
296477336 699 TPA: zinc finger protein 107 [Bos taurus 0.725 0.619 0.274 7e-32
260824663415 hypothetical protein BRAFLDRAFT_125176 [ 0.626 0.901 0.290 1e-31
328711363643 PREDICTED: zinc finger protein 845-like 0.651 0.604 0.283 3e-31
>gi|328711731|ref|XP_003244624.1| PREDICTED: zinc finger protein 271-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  154 bits (388), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 141/498 (28%), Positives = 206/498 (41%), Gaps = 41/498 (8%)

Query: 103 SQAMNPTMLTTTRVGNISLKIPRCEECDINFPSKMRHTFHLQHHL-EDPDLPVNFMHECR 161
           SQ+ N   LTT R  +   K   C+ C+++F      T H + H  E P       + C 
Sbjct: 67  SQSCN---LTTHRRTHTGEKPYICDVCNMSFSQSGSLTSHRRTHTGEKP-------YACD 116

Query: 162 ECGSQFADILKHSLETHLSFIHVQDNQLKCTICNKENFKNQLSLSIHMRYHENVREYECE 221
            C   F+D    +L+ H    H  +    C IC K +F    SL+ H R H   + Y C+
Sbjct: 117 ICEKSFSDSG--TLKKHRR-THTGEKPFTCDICEK-SFAESSSLTSHRRTHTGEKPYACD 172

Query: 222 ICKKKFINKSTLKEHSVSHMSVKPFKCEICGHYLSRASRLRAHLKAHSVVASNNKVQNCK 281
           IC+K F +  TLK+H  +H   KPF C+IC    S++  L  H + H    +  K   C 
Sbjct: 173 ICEKSFSDSGTLKKHRRTHTGEKPFACDICDKSFSQSCNLTTHRRTH----TGEKPYICD 228

Query: 282 KCFKCCQVFPSNEENLRKHFEKVHFDLEFDEAHFYDV-VLKCVYRFRIVQY-FLCELCDK 339
            C        S   + R H  +  +  +  E  F D   LK   R    +  F C++CD 
Sbjct: 229 VCNMSFSQSGSLTSHRRTHTGEKPYACDICEKSFSDSGTLKKHRRTHTGEKPFACDICDM 288

Query: 340 TSIHYTYLCLHKKLKHSNLTYGGESP-VCEPCNLTFKNEWQYLVHNRA-VHELPPEPNSG 397
           +     +L  H++      T+ GE P  C+ C  +F        H R    E P   +  
Sbjct: 289 SFSQSCHLTTHRR------THTGEKPYACDVCEKSFSKSGTLTSHRRTHTGEKPYACDVC 342

Query: 398 AGSVLQNNPYPPLRKAKQHVKSVTCSVCEKAFSSKENCKAHYTRQHGNK-------EPKE 450
             S  Q+      R+     K   C +C+K+F+   +   H     G+K       E   
Sbjct: 343 DMSFSQSGSLKKHRRTHTGEKPFECDICDKSFAESSSLTRHRRTHTGDKPYACDVCEMSF 402

Query: 451 PKSGEGLPALEQLLKMKPYTCEICSKTYTVEGSLLTHYDMHSGEF-YQCDVCFKEFRSSV 509
            K+G            KPY C++C K+++  G L TH   H+GE  Y CDVC K F  S 
Sbjct: 403 SKNGTLTSHRRSHTGEKPYICDVCDKSFSESGKLTTHQRTHTGEKPYACDVCEKSFSESG 462

Query: 510 TLRNHTRRHDN---FSCDECSVECQDLNALRMHTLREHGYKILACEKCDVKFTHKALLAE 566
           TL+ H R H     ++CD C       + L+ H     G K  AC+ CD  F   + L  
Sbjct: 463 TLKKHRRTHTGEKPYACDVCEKSFSGSDTLKKHRRTHTGEKPFACDICDKSFAESSSLTR 522

Query: 567 HINTKHNTDVTLKCQLCN 584
           H  T H  +    C +C+
Sbjct: 523 HRRT-HTGEKPYICDVCD 539




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|432912348|ref|XP_004078886.1| PREDICTED: zinc finger protein Xfin-like [Oryzias latipes] Back     alignment and taxonomy information
>gi|328726602|ref|XP_003248963.1| PREDICTED: zinc finger protein Xfin-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|390478794|ref|XP_003735581.1| PREDICTED: zinc finger protein 729-like [Callithrix jacchus] Back     alignment and taxonomy information
>gi|260837236|ref|XP_002613611.1| hypothetical protein BRAFLDRAFT_93654 [Branchiostoma floridae] gi|229298997|gb|EEN69620.1| hypothetical protein BRAFLDRAFT_93654 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|358417009|ref|XP_002702020.2| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein 91, partial [Bos taurus] Back     alignment and taxonomy information
>gi|338710160|ref|XP_003362320.1| PREDICTED: zinc finger protein 234 [Equus caballus] Back     alignment and taxonomy information
>gi|296477336|tpg|DAA19451.1| TPA: zinc finger protein 107 [Bos taurus] Back     alignment and taxonomy information
>gi|260824663|ref|XP_002607287.1| hypothetical protein BRAFLDRAFT_125176 [Branchiostoma floridae] gi|229292633|gb|EEN63297.1| hypothetical protein BRAFLDRAFT_125176 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|328711363|ref|XP_001946669.2| PREDICTED: zinc finger protein 845-like [Acyrthosiphon pisum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query597
UNIPROTKB|Q4V348819 ZNF658B "Zinc finger protein 6 0.793 0.578 0.273 3.5e-42
ZFIN|ZDB-GENE-060531-126 981 si:dkey-261j4.5 "si:dkey-261j4 0.726 0.442 0.280 3.8e-42
UNIPROTKB|Q14588700 ZNF234 "Zinc finger protein 23 0.731 0.624 0.281 6.8e-42
UNIPROTKB|F1N5W2922 ZNF226 "Uncharacterized protei 0.725 0.469 0.288 1.1e-41
UNIPROTKB|P17038809 ZNF43 "Zinc finger protein 43" 0.839 0.619 0.281 4.1e-41
UNIPROTKB|Q5TYW11059 ZNF658 "Zinc finger protein 65 0.793 0.447 0.271 4.3e-41
UNIPROTKB|Q05481 1191 ZNF91 "Zinc finger protein 91" 0.731 0.366 0.295 5.6e-41
UNIPROTKB|J9NSQ5 1029 ZNF197 "Uncharacterized protei 0.864 0.501 0.261 2.9e-40
UNIPROTKB|Q17RR6527 ZNF569 "ZNF569 protein" [Homo 0.726 0.823 0.276 5.3e-40
UNIPROTKB|F1RKN0686 ZNF569 "Uncharacterized protei 0.700 0.609 0.290 5.7e-39
UNIPROTKB|Q4V348 ZNF658B "Zinc finger protein 658B" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 454 (164.9 bits), Expect = 3.5e-42, P = 3.5e-42
 Identities = 141/516 (27%), Positives = 205/516 (39%)

Query:    85 HTAVHQATPWQEVPGSI----PSQAMNPTMLTTTRVGNISLKIPRCEECDINFPSKMRHT 140
             H +VHQ     E P        S   N  +    R+ +   K   C +C+  F       
Sbjct:   320 HLSVHQRVHTGEKPYECNDCGKSFTYNSALRAHQRI-HTGEKPYECSDCEKTFAHNSALR 378

Query:   141 FHLQHHLEDPDLPVNFMHECRECGSQFADILKHSLETHLSFIHVQDNQLKCTICNKENFK 200
              H  H +   + P    +EC ECG  FA I    L+ H   IH ++   +C  C + +F 
Sbjct:   379 AH--HRIHTGEKP----YECNECGRSFAHI--SVLKAHQR-IHTREKPYECNECGR-SFT 428

Query:   201 NQLSLSIHMRYHENVREYECEICKKKFINKSTLKEHSVSHMSVKPFKCEICGHYLSRASR 260
                +L  H R H   + YEC  C+K F + S LK H   H   KP+KC  C    +  S 
Sbjct:   429 YNSALRAHQRIHTGRKPYECSDCEKTFAHNSALKIHQRIHTGEKPYKCNECEKTFAHNSA 488

Query:   261 LRAHLKAHSVVASNNKVQNCKKCFKCCQVFPSNEENLRKHF-EKVHFDLEFDEAHFYDVV 319
             LRAH   H+      K+  C +C K          + R H  EK +   +  +       
Sbjct:   489 LRAHQNIHT----GEKLYECSECGKTFFQKTRLSTHRRIHTGEKPYECSKCGKTFSQKSY 544

Query:   320 LKCVYRFRIVQY-FLCELCDKTSIHYTYLCLHKKLKHSNLTYGGESPV-CEPCNLTFKNE 377
             L    R    +  + C +C KT ++   L +H+++ H+     GE P  C  C  TF   
Sbjct:   545 LSGHERIHTGEKPYECNVCGKTFVYKAALIVHQRI-HT-----GEKPYECNECGKTFSQR 598

Query:   378 WQYLVHNRAVH--ELPPEPNSGAGSVLQNNPYPPLRKAKQHVKSVTCSVCEKAFSSKENC 435
                  H R +H  E P E N    +   N+      +     K   C+ C K FS   + 
Sbjct:   599 THLCAHQR-IHTGEKPYECNECGKTFADNSALRAHHRIHTGEKPYECNDCGKTFSKTSHL 657

Query:   436 KAHYTRQHGNK-----EPKEPKSGEGLPALEQLLKM--KPYTCEICSKTYTVEGSLLTHY 488
             +AH   + G K     E  +  S +   +  Q +    KPY C +C K +    +L  H 
Sbjct:   658 RAHLRTRSGEKPYECSECGKTFSEKSYVSAHQRVHTGEKPYECNVCGKPFAHNSTLRVHQ 717

Query:   489 DMHSGE-FYQCDVCFKEFRSSVTLRNHTRRHDN---FSCDECSVECQDLNALRMHTLREH 544
              +H+GE  Y+C+ C K F     L  H R H     + C+EC       + LR+H     
Sbjct:   718 RIHTGEKSYECNDCGKTFSQKSHLSAHQRIHTGEKPYECNECGKAFAQNSTLRVHQRIHT 777

Query:   545 GYKILACEKCDVKFTHKALLAEHINTKHNTDVTLKC 580
             G K   C++C   F  KA L  H    H  + TL C
Sbjct:   778 GEKPYECDECGKTFVRKAALRVHHTRMHTREKTLAC 813


GO:0008270 "zinc ion binding" evidence=IEA
GO:0003677 "DNA binding" evidence=IEA
GO:0006351 "transcription, DNA-dependent" evidence=IEA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
ZFIN|ZDB-GENE-060531-126 si:dkey-261j4.5 "si:dkey-261j4.5" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q14588 ZNF234 "Zinc finger protein 234" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1N5W2 ZNF226 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P17038 ZNF43 "Zinc finger protein 43" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5TYW1 ZNF658 "Zinc finger protein 658" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q05481 ZNF91 "Zinc finger protein 91" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J9NSQ5 ZNF197 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q17RR6 ZNF569 "ZNF569 protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RKN0 ZNF569 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query597
COG5189423 COG5189, SFP1, Putative transcriptional repressor 0.002
>gnl|CDD|227516 COG5189, SFP1, Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
 Score = 40.9 bits (95), Expect = 0.002
 Identities = 25/98 (25%), Positives = 37/98 (37%), Gaps = 8/98 (8%)

Query: 387 VHELPPEPNSGAGSVLQNNP----YPPLRKAKQHVKSVTCSV--CEKAFSSKENCKAHYT 440
           V +LP   +S  G +          P      +  K   C V  C K + ++   K H  
Sbjct: 313 VRKLPCTNSSSNGKLAHGGERNIDTPSRMLKVKDGKPYKCPVEGCNKKYKNQNGLKYH-- 370

Query: 441 RQHGNKEPKEPKSGEGLPALEQLLKMKPYTCEICSKTY 478
             HG++  K  ++           K KPY CE+C K Y
Sbjct: 371 MLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRY 408


Length = 423

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 597
KOG1074|consensus958 99.96
KOG2462|consensus279 99.96
KOG1074|consensus958 99.95
KOG2462|consensus279 99.94
KOG3608|consensus467 99.92
KOG3623|consensus 1007 99.92
KOG3608|consensus467 99.92
KOG3623|consensus1007 99.9
KOG3576|consensus267 99.71
KOG3576|consensus267 99.67
PLN03086567 PRLI-interacting factor K; Provisional 99.27
PLN03086567 PRLI-interacting factor K; Provisional 99.16
PHA00733128 hypothetical protein 99.01
PHA00733128 hypothetical protein 99.01
PHA0276855 hypothetical protein; Provisional 98.95
PHA0276855 hypothetical protein; Provisional 98.89
KOG3993|consensus500 98.78
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.7
KOG3993|consensus500 98.65
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.53
PHA0073279 hypothetical protein 98.39
PHA0061644 hypothetical protein 98.38
PHA0061644 hypothetical protein 98.26
PHA0073279 hypothetical protein 98.25
KOG1146|consensus 1406 97.96
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.88
KOG1146|consensus1406 97.85
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.81
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.73
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.73
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.65
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.48
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.42
COG5189423 SFP1 Putative transcriptional repressor regulating 97.41
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.35
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.34
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.27
COG5189423 SFP1 Putative transcriptional repressor regulating 96.91
KOG2231|consensus 669 96.88
KOG2231|consensus 669 96.86
smart0035526 ZnF_C2H2 zinc finger. 96.53
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 96.47
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 96.43
smart0035526 ZnF_C2H2 zinc finger. 96.29
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.12
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.02
PRK04860160 hypothetical protein; Provisional 95.99
PRK04860160 hypothetical protein; Provisional 95.98
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 95.91
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 95.87
KOG2785|consensus 390 95.82
COG5236493 Uncharacterized conserved protein, contains RING Z 95.66
KOG2482|consensus423 95.34
KOG2482|consensus423 95.32
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 95.3
KOG2785|consensus390 95.24
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 95.02
COG5236493 Uncharacterized conserved protein, contains RING Z 94.83
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 92.63
KOG2893|consensus341 92.51
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 92.1
COG5048467 FOG: Zn-finger [General function prediction only] 92.02
KOG4173|consensus253 91.96
COG5048467 FOG: Zn-finger [General function prediction only] 91.39
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 90.59
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 90.57
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 89.8
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 89.73
COG404965 Uncharacterized protein containing archaeal-type C 89.15
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 88.85
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 87.45
KOG4173|consensus253 86.75
KOG2893|consensus 341 86.42
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 85.33
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 83.9
cd0072934 rubredoxin_SM Rubredoxin, Small Modular nonheme ir 80.11
>KOG1074|consensus Back     alignment and domain information
Probab=99.96  E-value=2.1e-30  Score=259.93  Aligned_cols=114  Identities=26%  Similarity=0.537  Sum_probs=89.0

Q ss_pred             cccccccccccCchhhhhhhccccccCccccCccchhhhchHHHHHHHHhhcccccCCcccCCccccccccCCCCchHHH
Q psy12199        218 YECEICKKKFINKSTLKEHSVSHMSVKPFKCEICGHYLSRASRLRAHLKAHSVVASNNKVQNCKKCFKCCQVFPSNEENL  297 (597)
Q Consensus       218 ~~C~~C~~~F~~~~~L~~H~~~H~~~~~~~C~~C~~~f~~~~~L~~H~~~H~~~~~~~~~~~C~~C~~c~~~f~~~~~~l  297 (597)
                      -+|-+|-++..-++.|+.|.++|+|||||+|.+||+.|.++++|+.||-+|.....-                       
T Consensus       606 NqCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~p~~-----------------------  662 (958)
T KOG1074|consen  606 NQCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHMSVHKAKPPA-----------------------  662 (958)
T ss_pred             cceeeeeecccchhhhhhhhhcccCcCccccccccchhccccchhhcccccccCccc-----------------------
Confidence            568899999999999999999999999999999999999999999998888522111                       


Q ss_pred             HhhhhhccCccccccccchhhhhcccccccccCeeecC---CCcccccchhhhHhHhhhcccCCCCCC----CC----CC
Q psy12199        298 RKHFEKVHFDLEFDEAHFYDVVLKCVYRFRIVQYFLCE---LCDKTSIHYTYLCLHKKLKHSNLTYGG----ES----PV  366 (597)
Q Consensus       298 ~~H~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~---~C~~~f~~~~~L~~H~~~~h~~~~~~~----~~----~~  366 (597)
                                                     ...|.|+   +|-+.|.+.-.|..|+++|..+.+-.+    +.    -+
T Consensus       663 -------------------------------R~q~ScP~~~ic~~kftn~V~lpQhIriH~~~~~s~g~~a~e~~~~adq  711 (958)
T KOG1074|consen  663 -------------------------------RVQFSCPSTFICQKKFTNAVTLPQHIRIHLGGQISNGGTAAEGILAADQ  711 (958)
T ss_pred             -------------------------------cccccCCchhhhcccccccccccceEEeecCCCCCCCcccccccchhcc
Confidence                                           1336777   888888888888888887765444333    22    27


Q ss_pred             CCcCccCCCCHHHHHHHHH
Q psy12199        367 CEPCNLTFKNEWQYLVHNR  385 (597)
Q Consensus       367 C~~C~~~f~~~~~L~~H~~  385 (597)
                      |..|.+.|.....+..++.
T Consensus       712 ~~~~qk~~~~a~~f~~~~s  730 (958)
T KOG1074|consen  712 CSSCQKTFSDARSFSQQIS  730 (958)
T ss_pred             cchhhhcccccccchhhhh
Confidence            9999999999888888887



>KOG2462|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG2462|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query597
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 4e-11
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 3e-10
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 1e-09
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 2e-08
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 4e-08
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 1e-04
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 1e-07
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 3e-07
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 7e-05
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 3e-07
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 4e-07
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 5e-07
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 7e-07
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 1e-06
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 1e-06
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 1e-06
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 2e-06
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 9e-05
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 3e-06
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 2e-04
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 7e-06
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 2e-05
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 2e-05
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 3e-05
2gli_A155 Five-Finger GliDNA COMPLEX Length = 155 8e-05
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 1e-04
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 2e-04
2csh_A110 Solution Structure Of Tandem Repeat Of The Zf-C2h2 1e-04
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 3e-04
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 5e-04
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 7e-04
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure

Iteration: 1

Score = 66.6 bits (161), Expect = 4e-11, Method: Compositional matrix adjust. Identities = 32/81 (39%), Positives = 47/81 (58%), Gaps = 1/81 (1%) Query: 189 LKCTICNKENFKNQLSLSIHMRYHENVREYECEICKKKFINKSTLKEHSVSHMSVKPFKC 248 C IC K +FK +LS H+ H + R Y C+ C K+F KS +K+H+ H KP KC Sbjct: 2 FDCKICGK-SFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKHTFIHTGEKPHKC 60 Query: 249 EICGHYLSRASRLRAHLKAHS 269 ++CG S++S L H + H+ Sbjct: 61 QVCGKAFSQSSNLITHSRKHT 81
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|2CSH|A Chain A, Solution Structure Of Tandem Repeat Of The Zf-C2h2 Domains Of Human Zinc Finger Protein 297b Length = 110 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query597
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-11
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 6e-10
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-06
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 9e-06
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 1e-05
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 9e-04
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 3e-11
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 1e-09
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 9e-07
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 5e-06
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 4e-04
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 5e-11
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 6e-11
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-10
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 3e-10
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 5e-10
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 4e-09
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 7e-09
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 4e-08
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 6e-07
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 3e-06
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 7e-05
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 5e-11
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 4e-10
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 2e-06
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 7e-05
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-10
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 2e-08
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 6e-06
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 7e-06
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 1e-10
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-10
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-10
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 5e-09
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 9e-08
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 1e-07
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 9e-06
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 1e-10
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 5e-08
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 5e-06
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 6e-06
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 5e-04
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 1e-10
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 3e-09
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 4e-08
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 9e-08
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-10
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 2e-10
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-09
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-08
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 4e-07
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 8e-06
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 6e-04
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-10
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 4e-08
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 1e-05
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 4e-10
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 2e-08
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 4e-05
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 7e-05
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 8e-10
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 4e-09
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-08
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-07
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 8e-10
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 4e-09
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 4e-06
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-09
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 5e-09
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 6e-09
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 1e-06
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 3e-09
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 3e-07
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 3e-07
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 6e-05
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 3e-09
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 8e-09
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 2e-08
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 1e-07
1tf6_A190 Protein (transcription factor IIIA); complex (tran 3e-09
1tf6_A190 Protein (transcription factor IIIA); complex (tran 2e-06
1tf6_A190 Protein (transcription factor IIIA); complex (tran 2e-06
1tf6_A190 Protein (transcription factor IIIA); complex (tran 8e-06
1tf6_A190 Protein (transcription factor IIIA); complex (tran 1e-05
1tf6_A190 Protein (transcription factor IIIA); complex (tran 2e-05
1tf6_A190 Protein (transcription factor IIIA); complex (tran 2e-04
1tf6_A190 Protein (transcription factor IIIA); complex (tran 3e-04
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 5e-09
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 9e-09
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 4e-08
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 5e-08
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 6e-09
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 7e-07
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 4e-04
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 1e-08
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 8e-08
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 4e-07
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 4e-06
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 4e-06
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 5e-06
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 2e-08
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 7e-07
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 9e-05
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 4e-08
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 4e-08
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 3e-07
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 6e-07
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 6e-08
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 3e-07
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 2e-05
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 1e-04
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 8e-08
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 2e-05
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 1e-04
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 1e-04
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 9e-08
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 2e-07
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 8e-06
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 2e-07
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 2e-06
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 5e-07
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 3e-05
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 5e-07
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 8e-05
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 5e-07
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 1e-06
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-06
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-05
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 5e-04
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 1e-06
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 1e-06
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 3e-04
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 5e-04
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 2e-06
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 5e-06
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 8e-04
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 5e-06
2epa_A72 Krueppel-like factor 10; transforming growth facto 3e-05
2epa_A72 Krueppel-like factor 10; transforming growth facto 2e-04
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-05
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-04
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 1e-04
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 2e-04
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-04
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 3e-04
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 8e-04
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-04
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-04
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 3e-04
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 3e-04
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-04
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-04
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-04
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 5e-04
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 5e-04
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-04
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-04
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-04
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-04
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-04
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-04
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-04
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 6e-04
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-04
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-04
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 7e-04
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 7e-04
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 7e-04
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 8e-04
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-04
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 8e-04
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 8e-04
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 8e-04
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-04
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-04
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 9e-04
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-04
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-04
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
 Score = 59.1 bits (144), Expect = 2e-11
 Identities = 21/65 (32%), Positives = 29/65 (44%), Gaps = 2/65 (3%)

Query: 204 SLSIHMRYHENVREYECEICKKKFINKSTLKEHSVSHM--SVKPFKCEICGHYLSRASRL 261
           S     R H   + YEC IC  +F    T+K H +     +V  F C  C   ++R S L
Sbjct: 2   SSGSSGRTHSGEKPYECYICHARFTQSGTMKMHILQKHTENVAKFHCPHCDTVIARKSDL 61

Query: 262 RAHLK 266
             HL+
Sbjct: 62  GVHLR 66


>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query597
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 100.0
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 100.0
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.96
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.96
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.92
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.92
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.9
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.89
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.89
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.88
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.88
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.88
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.87
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.86
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.85
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.84
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.79
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.75
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.75
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.75
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.74
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.73
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.73
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.72
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.72
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.71
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.71
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.71
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.71
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.71
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.71
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.67
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.67
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.65
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.64
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.64
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.64
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.63
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.62
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.61
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.6
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.56
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.56
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.54
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.54
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.54
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.53
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.51
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.49
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.49
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.48
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.48
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.47
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.47
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.47
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.46
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.46
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.45
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.45
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.45
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.44
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.44
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.41
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.41
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.4
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.4
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.4
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.39
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.39
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.38
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.36
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.36
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.36
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.34
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.31
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.31
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.3
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.28
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.28
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.26
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.25
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.24
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.24
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.24
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.24
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.23
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.23
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.23
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.23
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.23
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.23
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.23
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.22
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.22
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.22
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.22
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.22
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.22
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.22
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.22
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.22
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.22
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.22
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.22
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.22
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.22
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.22
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.22
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.22
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.22
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.21
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.21
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.21
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.21
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.21
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.21
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.21
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.21
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.21
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.2
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.2
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.2
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.19
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.19
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.19
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.19
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.19
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.18
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.18
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.18
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.18
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.18
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.18
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.17
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.17
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.17
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.17
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.17
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.17
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.17
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.17
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.17
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.16
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.16
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.16
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.16
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.16
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.16
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.16
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.16
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.16
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.16
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.16
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.16
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.16
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.16
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.16
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.16
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.16
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.15
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.15
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.15
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.15
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.15
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.15
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.14
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.14
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.14
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.14
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.14
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.14
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.14
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.13
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.13
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.13
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.13
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.13
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.12
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.12
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.11
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.11
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.11
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.11
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.11
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.11
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.11
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.1
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.1
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.1
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.1
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.1
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.09
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.09
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.09
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.09
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.09
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.09
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.09
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.09
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.09
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.09
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.09
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.08
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.08
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.08
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.08
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.07
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.07
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.07
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.07
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.07
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.07
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.07
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.06
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.06
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.06
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.06
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.06
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.06
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.06
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.06
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.06
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.06
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.05
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.04
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.04
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.04
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.04
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.04
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.03
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.03
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.03
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.03
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.03
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.02
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.02
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.02
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.02
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.02
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.02
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.02
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.02
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.02
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.02
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.02
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.02
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.02
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.01
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.01
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.01
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.01
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.01
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.0
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.0
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.0
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.0
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.0
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.0
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.0
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.0
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.0
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.99
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.99
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.99
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.98
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.98
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.98
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.98
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.98
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.98
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.97
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.97
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.97
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.97
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.96
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.96
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.95
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.95
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.93
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.92
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.91
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.91
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.91
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.91
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.91
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.89
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.89
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.88
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.88
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.88
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.84
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.7
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.7
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.69
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.68
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.67
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.67
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.65
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.63
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.6
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.56
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.56
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.55
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.54
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.52
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.52
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.51
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.48
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.46
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.42
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.42
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.41
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.41
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.4
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.4
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.4
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.38
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.38
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.38
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.36
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.34
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.32
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.32
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.31
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.3
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.3
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.28
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.28
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.27
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.27
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.24
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.18
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.18
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.16
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.14
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.11
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.09
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.08
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.07
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.07
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.07
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.06
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.06
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.04
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.3
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.03
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.03
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.03
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.28
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.02
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.01
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.01
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.0
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 97.99
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.98
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 97.98
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 97.96
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.96
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 97.96
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.96
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.95
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.93
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.91
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.91
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.12
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.12
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.89
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.88
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.09
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.07
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.7
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.56
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.49
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 96.63
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 96.23
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 95.81
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 95.76
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 95.39
2e72_A49 POGO transposable element with ZNF domain; zinc fi 94.8
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 94.66
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 94.4
2e72_A49 POGO transposable element with ZNF domain; zinc fi 93.4
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 92.91
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 90.79
2yuc_A76 TNF receptor-associated factor 4; ZF-TRAF, cystein 82.4
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 81.65
2k5c_A95 Uncharacterized protein PF0385; structural genomic 80.27
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
Probab=100.00  E-value=2.8e-34  Score=261.48  Aligned_cols=179  Identities=30%  Similarity=0.574  Sum_probs=136.7

Q ss_pred             hhhHhHhhhcccCCCCCCC-CCCCCcCccCCCCHHHHHHHHHHhcCCCCCCCCCCCccccCCCCCCcccccCccCceecc
Q psy12199        345 TYLCLHKKLKHSNLTYGGE-SPVCEPCNLTFKNEWQYLVHNRAVHELPPEPNSGAGSVLQNNPYPPLRKAKQHVKSVTCS  423 (597)
Q Consensus       345 ~~L~~H~~~~h~~~~~~~~-~~~C~~C~~~f~~~~~L~~H~~~~H~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~  423 (597)
                      ..|..|+.      .+.++ ++.|+.|++.|.+...|..|++ .|.       +                   +++|.|+
T Consensus         7 ~~l~~h~~------~~~~~~~~~C~~C~~~f~~~~~l~~H~~-~h~-------~-------------------~~~~~C~   53 (190)
T 2i13_A            7 SSSVAQAA------LEPGEKPYACPECGKSFSRSDHLAEHQR-THT-------G-------------------EKPYKCP   53 (190)
T ss_dssp             ------------------------------CCSSHHHHHGGG-CC-----------------------------CCEECT
T ss_pred             ccchhhhh------hcCCCCCCcCCCCccccCCHHHHHHHHH-HcC-------C-------------------CCCccCC
Confidence            45666665      33333 3488889988888888888887 443       1                   2679999


Q ss_pred             cCccccCChhhHHhHhhhccCCCCCCCCCCCCCcchhhhhcCCCceecccccccccchhhHHHHHHhccCc-cccCCcCh
Q psy12199        424 VCEKAFSSKENCKAHYTRQHGNKEPKEPKSGEGLPALEQLLKMKPYTCEICSKTYTVEGSLLTHYDMHSGE-FYQCDVCF  502 (597)
Q Consensus       424 ~C~~~f~~~~~L~~H~~~~h~~~~~~~~~~~~~~~~~~~~~~~k~~~C~~C~~~f~~~~~L~~H~~~H~~e-~y~C~~C~  502 (597)
                      .|++.|.+...|..|++.+++.                     ++|.|++|++.|.+...|..|+++|+++ +|.|+.|+
T Consensus        54 ~C~~~f~~~~~l~~H~~~h~~~---------------------~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~  112 (190)
T 2i13_A           54 ECGKSFSDKKDLTRHQRTHTGE---------------------KPYKCPECGKSFSQRANLRAHQRTHTGEKPYACPECG  112 (190)
T ss_dssp             TTCCEESSHHHHHHHHHHHHCC---------------------CCEECTTTCCEESCHHHHHHHHHHHHTCCCEECTTTC
T ss_pred             CcCchhCCHHHHHHHHHhcCCC---------------------CCccCcccCCccCCHHHHHHHHHhcCCCCCCcCCCCC
Confidence            9999999999999999966654                     7899999999999999999999999988 99999999


Q ss_pred             hccCCcHHHHHHhhhcC---CCCCCcCccccCChHHHHHHHHHhhccceeecCcCccccCChhHHHhhhcccCCCCccc
Q psy12199        503 KEFRSSVTLRNHTRRHD---NFSCDECSVECQDLNALRMHTLREHGYKILACEKCDVKFTHKALLAEHINTKHNTDVTL  578 (597)
Q Consensus       503 ~~F~~~~~L~~H~~~H~---~~~C~~C~~~f~~~~~L~~H~~~h~~~k~~~C~~C~~~F~~~~~L~~H~~~~H~~~~~~  578 (597)
                      +.|.+...|..|+++|+   +|.|++|++.|.+...|..|+++|++++||.|++|++.|.++..|..|+++ |++++||
T Consensus       113 ~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~H~~~~~~~C~~C~~~f~~~~~L~~H~~~-H~~~k~~  190 (190)
T 2i13_A          113 KSFSQLAHLRAHQRTHTGEKPYKCPECGKSFSREDNLHTHQRTHTGEKPYKCPECGKSFSRRDALNVHQRT-HTGKKTS  190 (190)
T ss_dssp             CEESSHHHHHHHHHHHHCCCCEECTTTCCEESCHHHHHHHHHHHHCCCCEECTTTCCEESSHHHHHHHHTT-C------
T ss_pred             CccCCHHHHHHHHHHhCCCCCeECCCCCcccCCHHHHHHHHHhcCCCCCeECCCCCCccCCHHHHHHHHHh-cCCCCCC
Confidence            99999999999999986   799999999999999999999999999999999999999999999999998 8898886



>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>2yuc_A TNF receptor-associated factor 4; ZF-TRAF, cysteine-rich domain associated with ring and TRAF domains protein 1, malignant 62; NMR {Homo sapiens} Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>2k5c_A Uncharacterized protein PF0385; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Pyrococcus furiosus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 597
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 2e-05
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 3e-04
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 0.002
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 6e-05
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 0.002
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 2e-04
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 0.003
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 0.002
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 0.002
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 40.4 bits (94), Expect = 2e-05
 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 1/51 (1%)

Query: 218 YECEICKKKFINKSTLKEHSVSHMSVKPFKCEICGHYLSRASRLRAHLKAH 268
           Y C+ C K F +KS    H   H+ ++P+ C +CG        L  H+K H
Sbjct: 4   YPCQ-CGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIH 53


>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query597
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.6
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.6
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.29
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.24
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.24
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.16
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.15
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.14
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.12
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.11
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.08
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.07
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.07
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.05
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.02
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.98
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.98
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.94
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.93
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.93
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.93
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.92
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.89
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.88
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.83
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.82
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.74
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.72
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.7
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.7
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.6
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.59
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.56
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.5
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.46
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.44
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.39
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.36
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.32
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.29
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.26
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.21
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.12
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.1
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.07
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.06
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.01
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.0
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.99
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.99
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.93
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.93
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.67
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.61
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.56
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.51
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.49
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.48
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.48
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.45
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.45
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.43
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.43
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.42
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.39
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.3
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.29
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.2
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.13
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.13
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.08
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.0
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 96.99
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.96
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.87
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.85
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 96.83
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.83
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 96.8
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.79
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 96.74
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.66
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.31
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.04
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.99
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.97
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.96
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 95.83
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 95.81
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 95.76
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 95.75
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 95.68
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.23
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 95.15
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 94.39
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 94.32
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 94.24
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 93.51
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 93.38
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 93.24
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 92.89
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 92.49
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 91.59
d1y0jb136 U-shaped transcription factor, different fingers { 91.4
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 91.08
d1tf3a331 Transcription factor IIIA, TFIIIA {Xenopus laevis 90.61
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 90.2
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 89.86
d1y0jb136 U-shaped transcription factor, different fingers { 89.55
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 87.89
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 87.59
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 87.58
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 87.14
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 87.11
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 86.97
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 86.85
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 85.88
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 84.28
d1x3ca161 Zinc finger protein 292, ZNF292 {Human (Homo sapie 84.0
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 83.55
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 81.05
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 81.02
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.60  E-value=2.3e-16  Score=106.32  Aligned_cols=52  Identities=37%  Similarity=0.666  Sum_probs=49.9

Q ss_pred             CCceecccccccccchhhHHHHHHhccCc-cccCCcChhccCCcHHHHHHhhhc
Q psy12199        466 MKPYTCEICSKTYTVEGSLLTHYDMHSGE-FYQCDVCFKEFRSSVTLRNHTRRH  518 (597)
Q Consensus       466 ~k~~~C~~C~~~f~~~~~L~~H~~~H~~e-~y~C~~C~~~F~~~~~L~~H~~~H  518 (597)
                      ||||.|+ ||++|.....|..|+++|+|+ ||.|++||++|.+.+.|..|+++|
T Consensus         1 EK~y~C~-Cgk~F~~~~~l~~H~~~Ht~ekpy~C~~C~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           1 DKLYPCQ-CGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             CCCEECT-TSCEESSHHHHHHHHHHHSCCCSEECTTTSCEESSSHHHHHHHTTT
T ss_pred             CcCCCCC-CCCeECCHHHhHHHhhccccccCCcCCCcCCEecCHHHHHHHHhcC
Confidence            4899995 999999999999999999999 999999999999999999999987



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1tf3a3 g.37.1.1 (A:71-101) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x3ca1 g.37.1.1 (A:8-68) Zinc finger protein 292, ZNF292 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure