Psyllid ID: psy12229

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440----
MSTITNISDSRLKQEPFVMREESEGGGGVKYKGYCIDLIEEIRKLVGFEYEIFVAPDNSFGNMDENGQWNGMIKELIEKRADIALGSLSVMAERENVVDFTVPYYDLVGITILMKKPKTPTSLFKFLTVLETGVWLCILAAYCNLDGEQMKYLIQVNPPGDILPEVIRAIILMQNITDAGILFDDSFSGGEAPKNLSGRLVAATWWLFGFIIIASYTANLAAFLTVSRLDTPIESLDDLSKQYKIQYAPLNGSAAMTYFQRMADIEGRFYEIWKDMSLNDSLSDVERAKLAVWDYPVSDKYTKMWQAMKEAKLPNSLEEAVQRVRDSKSSSEGFGYLGDATDIRYLVMTNCDLQMVGDEFSRKPYAIAVQQDRDARELFCNVHANILSIPFPFIGVDGTSVCSSIFDTDGKTKVSCPLKKDHVYRYINTFKILDRYPKCSKDLD
cccccEEEEEEEccccEEEEEcccccccccEEEEHHHHHHHHHHHcccEEEEEEEcccccccccccccccHHHHHHHcccccEEEEcccccHHHHccccccccccccccEEEEEEccccccccccccccccHHHHHHHHHHHHHHcccEEEEEccccccccccccccccccccccHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHccccEEEEEccccHHHHHHHHccccHHHHHHHHHHcccccccHHHHHHHHcccccccccHHHHHHHHHHHccccccHHHHHHHHHHccccccccEEEcccHHHHHHHHcccccEEEccccccccEEEEEccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccccc
cccccEEEEEEEEcccEEEEEccccccccccccHHHHHHHHHHHHcccEEEEEEEccccccccccccccccHHHHHHHccccEEEEcEEEEEEEHEEEccccccccEEEEEEEEEccccccccEcccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHccccccccEEEHHHHHHcccccccccHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHccEEEEccccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHEcccccHHHHHHHHHHHccccccccHHHHHHHHHccccccccEEEEEEcccHHHHHHcccccEEEcccccccccEEEcccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccEEEEEEcHHEEcccccccccccc
mstitnisdsrlkqepfvmreeseggggvkykgYCIDLIEEIRKLVGFEYeifvapdnsfgnmdengQWNGMIKELIEKRADIALGSLSVmaerenvvdftvpyYDLVGItilmkkpktptslFKFLTVLETGVWLCILAAYCNLDGEQMKYLIqvnppgdilPEVIRAIILMQNItdagilfddsfsggeapknlSGRLVAATWWLFGFIIIASYTANLAAFLTVsrldtpiesldDLSKQYKiqyaplngsaAMTYFQRMADIEGRFYEIWKDmslndslsdVERAKLAvwdypvsdKYTKMWQAMKEAKLPNSLEEAVQRVRdsksssegfgylgdatdIRYLVMTNcdlqmvgdefsrkpyAIAVQQDRDARELFCNVHAnilsipfpfigvdgtsvcssifdtdgktkvscplkkdhVYRYINTFKildrypkcskdld
mstitnisdsrlkqepfvmreeseggggvkykgYCIDLIEEIRKLVGFEYEIFVAPDNSFGNMDENGQWNGMIKELIEKRADIALGSLSVMAERENVVDFTVPYYDLVGITILMKKPKTPTSLFKFLTVLETGVWLCILAAYCNLDGEQMKYLIQVNPPGDILPEVIRAIILMQNITDAGILFDDSFSGGEAPKNLSGRLVAATWWLFGFIIIASYTANLAAFLTVSRLDTPIESLDDLSKQYKIQYAPLNGSAAMTYFQRMADIEGRFYEIWKDMSLNDSLSDVERAKLAVWDYPVSDKYTKMWQAMKEAKLPNSLEEAVQRVrdsksssegfgylgdaTDIRYLVMTNCDLQMVGDEFSRKPYAIAVQQDRDARELFCNVHANILSIPFPFIGVDGTSVCSSIFDTdgktkvscplkkdhvyryintfkildrypkcskdld
MSTITNISDSRLKQEPFVMREESEGGGGVKYKGYCIDLIEEIRKLVGFEYEIFVAPDNSFGNMDENGQWNGMIKELIEKRADIALGSLSVMAERENVVDFTVPYYDLVGITILMKKPKTPTSLFKFLTVLETGVWLCILAAYCNLDGEQMKYLIQVNPPGDILPEVIRAIILMQNITDAGILFDDSFSGGEAPKNLSGRLVAATWWLFGFIIIASYTANLAAFLTVSRLDTPIESLDDLSKQYKIQYAPLNGSAAMTYFQRMADIEGRFYEIWKDMSLNDSLSDVERAKLAVWDYPVSDKYTKMWQAMKEAKLPNSLEEAVQRVRDSKSSSEGFGYLGDATDIRYLVMTNCDLQMVGDEFSRKPYAIAVQQDRDARELFCNVHANILSIPFPFIGVDGTSVCSSIFDTDGKTKVSCPLKKDHVYRYINTFKILDRYPKCSKDLD
**************************GGVKYKGYCIDLIEEIRKLVGFEYEIFVAPDNSFGNMDENGQWNGMIKELIEKRADIALGSLSVMAERENVVDFTVPYYDLVGITILMKKPKTPTSLFKFLTVLETGVWLCILAAYCNLDGEQMKYLIQVNPPGDILPEVIRAIILMQNITDAGILFDDSFSGGEAPKNLSGRLVAATWWLFGFIIIASYTANLAAFLTVSRLDTPIESLDDLSKQYKIQYAPLNGSAAMTYFQRMADIEGRFYEIWKDMSLNDSLSDVERAKLAVWDYPVSDKYTKMWQA**************************FGYLGDATDIRYLVMTNCDLQMVGDEFSRKPYAIAVQQDRDARELFCNVHANILSIPFPFIGVDGTSVCSSIFDTDGKTKVSCPLKKDHVYRYINTFKILDRYP*******
**TITNISDSRLKQEPFVMREESEGGGGVKYKGYCIDLIEEIRKLVGFEYEIFVAPDNSFGNMDENGQWNGMIKELIEKRADIALGSLSVMAERENVVDFTVPYYDLVGITILMKKPKTPTSLFKFLTVLETGVWLCILAAYCNLDGEQMKYLIQVNPPGD***E*IRAIILMQNITDAGILFDDSFSGGEAPKNLSGRLVAATWWLFGFIIIASYTANLAAFLTVSRL********DLSKQYKIQYAPLNGSAAMTYFQRMADIEGRFYEIWKDMSLNDSLSDVERAKLAVWDYPVSDKYTKMWQAMKEAKLPNSLEEAVQRVRDSKSSSEGFGYLGDATDIRYLVMTNCDLQMVGDEFSRKPYAIAVQQDRDARELFCNVHANILSIPFPFIGVDGT**********************HVYRYINTFKILDRYPKCS****
MSTITNISDSRLKQEPFVMREESEGGGGVKYKGYCIDLIEEIRKLVGFEYEIFVAPDNSFGNMDENGQWNGMIKELIEKRADIALGSLSVMAERENVVDFTVPYYDLVGITILMKKPKTPTSLFKFLTVLETGVWLCILAAYCNLDGEQMKYLIQVNPPGDILPEVIRAIILMQNITDAGILFDDSFSGGEAPKNLSGRLVAATWWLFGFIIIASYTANLAAFLTVSRLDTPIESLDDLSKQYKIQYAPLNGSAAMTYFQRMADIEGRFYEIWKDMSLNDSLSDVERAKLAVWDYPVSDKYTKMWQAMKEAKLPN****************EGFGYLGDATDIRYLVMTNCDLQMVGDEFSRKPYAIAVQQDRDARELFCNVHANILSIPFPFIGVDGTSVCSSIFDTDGKTKVSCPLKKDHVYRYINTFKILDRYPKCSKDLD
**TITNISDSRLKQEPFVMREESEGGGGVKYKGYCIDLIEEIRKLVGFEYEIFVAPDNSFGNMDENGQWNGMIKELIEKRADIALGSLSVMAERENVVDFTVPYYDLVGITILMKKPKTPTSLFKFLTVLETGVWLCILAAYCNLDGEQMKYLIQVNPPGDILPEVIRAIILMQNITDAGILFDDSFSGGEAPKNLSGRLVAATWWLFGFIIIASYTANLAAFLTVSRLDTPIESLDDLSKQYKIQYAPLNGSAAMTYFQRMADIEGRFYEIWKDMSLNDSLSDVERAKLAVWDYPVSDKYTKMWQAMKEAKLPNSLEEAVQRVRDSKSSSEGFGYLGDATDIRYLVMTNCDLQMVGDEFSRKPYAIAVQQDRDARELFCNVHANILSIPFPFIGVDGTSVCSS****DGKTKVSCPLKKDHVYRYINTFKILDRYPKCS****
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSTITNISDSRLKQEPFVMREESEGGGGVKYKGYCIDLIEEIRKLVGFEYEIFVAPDNSFGNMDENGQWNGMIKELIEKRADIALGSLSVMAERENVVDFTVPYYDLVGITILMKKPKTPTSLFKFLTVLETGVWLCILAAYCNLDGEQMKYLIQVNPPGDILPEVIRAIILMQNITDAGILFDDSFSGGEAPKNLSGRLVAATWWLFGFIIIASYTANLAAFLTVSRLDTPIESLDDLSKQYKIQYAPLNGSAAMTYFQRMADIEGRFYEIWKDMSLNDSLSDVERAKLAVWDYPVSDKYTKMWQAMKEAKLPNSLEEAVQRVRDSKSSSEGFGYLGDATDIRYLVMTNCDLQMVGDEFSRKPYAIAVQQDRDARELFCNVHANILSIPFPFIGVDGTSVCSSIFDTDGKTKVSCPLKKDHVYRYINTFKILDRYPKCSKDLD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query444 2.2.26 [Sep-21-2011]
P42264919 Glutamate receptor ionotr yes N/A 0.718 0.347 0.336 5e-51
P39087908 Glutamate receptor ionotr yes N/A 0.713 0.349 0.338 8e-51
P42260908 Glutamate receptor ionotr no N/A 0.713 0.349 0.338 9e-51
B1AS29919 Glutamate receptor ionotr yes N/A 0.709 0.342 0.336 9e-51
Q13002908 Glutamate receptor ionotr yes N/A 0.713 0.349 0.338 1e-50
Q9ULK0 1009 Glutamate receptor ionotr no N/A 0.727 0.320 0.327 1e-50
Q38PU2919 Glutamate receptor ionotr N/A N/A 0.709 0.342 0.336 1e-50
Q13003919 Glutamate receptor ionotr no N/A 0.709 0.342 0.336 2e-50
Q61627 1009 Glutamate receptor ionotr no N/A 0.727 0.320 0.324 3e-50
Q62640 1009 Glutamate receptor ionotr no N/A 0.727 0.320 0.321 3e-50
>sp|P42264|GRIK3_RAT Glutamate receptor ionotropic, kainate 3 OS=Rattus norvegicus GN=Grik3 PE=1 SV=1 Back     alignment and function desciption
 Score =  202 bits (513), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 125/372 (33%), Positives = 194/372 (52%), Gaps = 53/372 (14%)

Query: 10  SRLKQEPFVMREESEGG--GGVKYKGYCIDLIEEIRKLVGFEYEIFVAPDNSFGNMDENG 67
           + L +EPFVM  +S+    G  +++GYCIDL++E+  ++GF YEI +  D  +G  D+ G
Sbjct: 439 TTLLEEPFVMFRKSDRTLYGNDRFEGYCIDLLKELAHILGFSYEIRLVEDGKYGAQDDKG 498

Query: 68  QWNGMIKELIEKRADIALGSLSVMAERENVVDFTVPYYDLVGITILMKKPK-TPTSLFKF 126
           QWNGM+KELI+ +AD+A+  L++   RE  +DF+ P+  L G++IL +KP  T  S+F F
Sbjct: 499 QWNGMVKELIDHKADLAVAPLTITHVREKAIDFSKPFMTL-GVSILYRKPNGTNPSVFSF 557

Query: 127 LTVLETGVWLCILAAYCNLDGEQMKYLIQVNP-------PGDILPEVIRAIILMQNITDA 179
           L  L   +W+ +L AY  +    +  + + +P       P +   EV+     + N    
Sbjct: 558 LNPLSPDIWMYVLLAYLGVSC-VLFVIARFSPYEWYDAHPCNPGSEVVENNFTLLNSFWF 616

Query: 180 GILFDDSFSGGEAPKNLSGRLVAATWWLFGFIIIASYTANLAAFLTVSRLDTPIESLDDL 239
           G+           PK LS R++   WW F  III+SYTANLAAFLTV R+++PI+S DDL
Sbjct: 617 GMGSLMQQGSELMPKALSTRIIGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDL 676

Query: 240 SKQYKIQYAPLNGSAAMTYFQRMADIEGRFYEIWKDMSLNDSLSDVERAKLAVWDYPVSD 299
           +KQ KI+Y  +   A MT+F+                          ++K++        
Sbjct: 677 AKQTKIEYGAVKDGATMTFFK--------------------------KSKIST------- 703

Query: 300 KYTKMWQAM--KEAKLPNSLEEAVQRVRDSKSSSEGFGYLGDATDIRYLVMTNCDLQMVG 357
            + KMW  M  K + L  + EE +QR     + +  +  L ++T I Y+   NC+L  +G
Sbjct: 704 -FEKMWAFMSSKPSALVKNNEEGIQR-----TLTADYALLMESTTIEYITQRNCNLTQIG 757

Query: 358 DEFSRKPYAIAV 369
                K Y I  
Sbjct: 758 GLIDSKGYGIGT 769
Receptor for glutamate that functions as ligand-gated ion channel in the central nervous system and plays an important role in excitatory synaptic transmission. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. The postsynaptic actions of Glu are mediated by a variety of receptors that are named according to their selective agonists. This receptor binds domoate > kainate >> L-glutamate = quisqualate >> AMPA = NMDA.
Rattus norvegicus (taxid: 10116)
>sp|P39087|GRIK2_MOUSE Glutamate receptor ionotropic, kainate 2 OS=Mus musculus GN=Grik2 PE=1 SV=4 Back     alignment and function description
>sp|P42260|GRIK2_RAT Glutamate receptor ionotropic, kainate 2 OS=Rattus norvegicus GN=Grik2 PE=1 SV=2 Back     alignment and function description
>sp|B1AS29|GRIK3_MOUSE Glutamate receptor ionotropic, kainate 3 OS=Mus musculus GN=Grik3 PE=2 SV=1 Back     alignment and function description
>sp|Q13002|GRIK2_HUMAN Glutamate receptor ionotropic, kainate 2 OS=Homo sapiens GN=GRIK2 PE=1 SV=1 Back     alignment and function description
>sp|Q9ULK0|GRID1_HUMAN Glutamate receptor ionotropic, delta-1 OS=Homo sapiens GN=GRID1 PE=2 SV=2 Back     alignment and function description
>sp|Q38PU2|GRIK3_MACFA Glutamate receptor ionotropic, kainate 3 OS=Macaca fascicularis GN=GRIK3 PE=2 SV=1 Back     alignment and function description
>sp|Q13003|GRIK3_HUMAN Glutamate receptor ionotropic, kainate 3 OS=Homo sapiens GN=GRIK3 PE=2 SV=3 Back     alignment and function description
>sp|Q61627|GRID1_MOUSE Glutamate receptor ionotropic, delta-1 OS=Mus musculus GN=Grid1 PE=1 SV=2 Back     alignment and function description
>sp|Q62640|GRID1_RAT Glutamate receptor ionotropic, delta-1 OS=Rattus norvegicus GN=Grid1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query444
328711396 966 PREDICTED: glutamate receptor, ionotropi 0.806 0.370 0.746 1e-161
357630725 921 hypothetical protein KGM_04141 [Danaus p 0.824 0.397 0.715 1e-150
379070092 923 putative ionotropic receptor IR25a [Cydi 0.824 0.396 0.705 1e-149
189234151 945 PREDICTED: similar to GA13857-PA [Tribol 0.804 0.377 0.700 1e-147
270002542 897 hypothetical protein TcasGA2_TC004850 [T 0.804 0.397 0.700 1e-147
242005162 887 glutamate receptor, putative [Pediculus 0.826 0.413 0.680 1e-144
21358761 936 ionotropic glutamate receptor subunit [H 0.833 0.395 0.665 1e-141
399163347 904 ionotropic receptor [Locusta migratoria] 0.824 0.404 0.677 1e-140
157124316 914 glutamate receptor 7 (ampa) [Aedes aegyp 0.797 0.387 0.663 1e-139
158299360 914 AGAP010272-PA [Anopheles gambiae str. PE 0.797 0.387 0.663 1e-139
>gi|328711396|ref|XP_001945524.2| PREDICTED: glutamate receptor, ionotropic kainate 4-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  573 bits (1476), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 286/383 (74%), Positives = 315/383 (82%), Gaps = 25/383 (6%)

Query: 14  QEPFVMREESEGGGGVKYKGYCIDLIEEIRKLVGFEYEIFVAPDNSFGNMDENGQWNGMI 73
           Q PF+++ + E G GVK+KGYCIDLIEEIRKL+GFEYEI++APDN+FGNMDENGQWNGM+
Sbjct: 466 QNPFMIQIDDEDGKGVKFKGYCIDLIEEIRKLIGFEYEIYIAPDNNFGNMDENGQWNGMV 525

Query: 74  KELIEKRADIALGSLSVMAERENVVDFTVPYYDLVGITILMKKPKTPTSLFKFLTVLETG 133
           KEL+EKRADIALGSLSVMAERENVVDFTVPYYDLVGITILMKKP+TPTSLFKFLTVLE  
Sbjct: 526 KELVEKRADIALGSLSVMAERENVVDFTVPYYDLVGITILMKKPQTPTSLFKFLTVLEND 585

Query: 134 VWLCILAAYC---------------NLDGEQMKYLIQVNPPGDILPEVIRAIILMQNITD 178
           VW+CIL AY                +    ++KY          L E +     M ++T 
Sbjct: 586 VWMCILGAYFFTSFLMWVFDRWSPYSYQNNRIKYKDDEEKREFNLKECL--WFCMTSLTP 643

Query: 179 AGILFDDSFSGGEAPKNLSGRLVAATWWLFGFIIIASYTANLAAFLTVSRLDTPIESLDD 238
            G        GGEAPKNLSGRLVAATWWLFGFIIIASYTANLAAFLTVSRLDTP+ESLDD
Sbjct: 644 QG--------GGEAPKNLSGRLVAATWWLFGFIIIASYTANLAAFLTVSRLDTPVESLDD 695

Query: 239 LSKQYKIQYAPLNGSAAMTYFQRMADIEGRFYEIWKDMSLNDSLSDVERAKLAVWDYPVS 298
           LSKQYKIQYAPLNGS+AMTYFQRMADIE RFYEIWKDMSLNDSLS+VERAKLAVWDYPVS
Sbjct: 696 LSKQYKIQYAPLNGSSAMTYFQRMADIETRFYEIWKDMSLNDSLSEVERAKLAVWDYPVS 755

Query: 299 DKYTKMWQAMKEAKLPNSLEEAVQRVRDSKSSSEGFGYLGDATDIRYLVMTNCDLQMVGD 358
           DKYTKMWQAMKEAKLPN+LEEA++RV+ SKSSSEGF YLGDATDIRY VM +C LQMVGD
Sbjct: 756 DKYTKMWQAMKEAKLPNTLEEAIERVQSSKSSSEGFAYLGDATDIRYQVMIDCHLQMVGD 815

Query: 359 EFSRKPYAIAVQQDRDARELFCN 381
           EFSRKPYAIAVQQ    ++ F N
Sbjct: 816 EFSRKPYAIAVQQGSPLKDQFNN 838

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|357630725|gb|EHJ78658.1| hypothetical protein KGM_04141 [Danaus plexippus] Back     alignment and taxonomy information
>gi|379070092|gb|AFC91757.1| putative ionotropic receptor IR25a [Cydia pomonella] Back     alignment and taxonomy information
>gi|189234151|ref|XP_971258.2| PREDICTED: similar to GA13857-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270002542|gb|EEZ98989.1| hypothetical protein TcasGA2_TC004850 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|242005162|ref|XP_002423441.1| glutamate receptor, putative [Pediculus humanus corporis] gi|212506519|gb|EEB10703.1| glutamate receptor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|21358761|gb|AAM47017.1| ionotropic glutamate receptor subunit [Homarus americanus] Back     alignment and taxonomy information
>gi|399163347|gb|AFP33229.1| ionotropic receptor [Locusta migratoria] Back     alignment and taxonomy information
>gi|157124316|ref|XP_001660418.1| glutamate receptor 7 (ampa) [Aedes aegypti] gi|108874039|gb|EAT38264.1| AAEL009813-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|158299360|ref|XP_319463.4| AGAP010272-PA [Anopheles gambiae str. PEST] gi|157014327|gb|EAA13931.5| AGAP010272-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query444
FB|FBgn0031634934 Ir25a "Ionotropic receptor 25a 0.833 0.396 0.658 3.7e-126
WB|WBGene00001618671 glr-7 [Caenorhabditis elegans 0.889 0.588 0.544 5.8e-105
FB|FBgn0052704 936 Ir8a "Ionotropic receptor 8a" 0.781 0.370 0.362 1.5e-59
FB|FBgn0038837853 CG3822 [Drosophila melanogaste 0.574 0.298 0.411 6.5e-54
RGD|71027919 Grik3 "glutamate receptor, ion 0.619 0.299 0.391 4.3e-52
UNIPROTKB|P42264919 Grik3 "Glutamate receptor iono 0.619 0.299 0.391 4.3e-52
UNIPROTKB|F1MCM2881 GRIK3 "Uncharacterized protein 0.594 0.299 0.399 6.6e-52
UNIPROTKB|F1SV43881 GRIK3 "Uncharacterized protein 0.594 0.299 0.399 6.6e-52
UNIPROTKB|F1P0L4891 GRIK3 "Uncharacterized protein 0.578 0.288 0.407 7.3e-52
UNIPROTKB|A9Z1Z8872 GRIK3 "Glutamate receptor, ion 0.594 0.302 0.395 7.8e-52
FB|FBgn0031634 Ir25a "Ionotropic receptor 25a" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 1239 (441.2 bits), Expect = 3.7e-126, P = 3.7e-126
 Identities = 251/381 (65%), Positives = 295/381 (77%)

Query:    14 QEPFVMREESEGGGGVKYKGYCIDLIEEIRKLVGFEYEIFVAPDNSFGNMDENGQWNGMI 73
             Q PF+MR+E+   G   YKGYCIDLI EI  +V F+Y I    D  FGNMDENGQWNG++
Sbjct:   435 QAPFIMRDETAPKG---YKGYCIDLINEIAAIVHFDYTIQEVEDGKFGNMDENGQWNGIV 491

Query:    74 KELIEKRADIALGSLSVMAERENVVDFTVPYYDLVGITILMKKPKTPTSLFKFLTVLETG 133
             K+L++K+ADI LGS+SVMAERE V+DFTVPYYDLVGITI+M++P +P+SLFKFLTVLET 
Sbjct:   492 KKLMDKQADIGLGSMSVMAEREIVIDFTVPYYDLVGITIMMQRPSSPSSLFKFLTVLETN 551

Query:   134 VWLCILAAYCNLD------GEQMKYLIQVNPPGDILPEVIRAIILMQNITDAGILFDDSF 187
             VWLCILAAY               Y  Q N       E  R   L + +           
Sbjct:   552 VWLCILAAYFFTSFLMWIFDRWSPYSYQNNREKYKDDEEKREFNLKECLWFCMTSLTPQ- 610

Query:   188 SGGEAPKNLSGRLVAATWWLFGFIIIASYTANLAAFLTVSRLDTPIESLDDLSKQYKIQY 247
              GGEAPKNLSGRLVAATWWLFGFIIIASYTANLAAFLTVSRLDTP+ESLDDL+KQYKI Y
Sbjct:   611 GGGEAPKNLSGRLVAATWWLFGFIIIASYTANLAAFLTVSRLDTPVESLDDLAKQYKILY 670

Query:   248 APLNGSAAMTYFQRMADIEGRFYEIWKDMSLNDSLSDVERAKLAVWDYPVSDKYTKMWQA 307
             APLNGS+AMTYF+RM++IE  FYEIWKD+SLNDSL+ VER+KLAVWDYPVSDKYTKMWQA
Sbjct:   671 APLNGSSAMTYFERMSNIEQMFYEIWKDLSLNDSLTAVERSKLAVWDYPVSDKYTKMWQA 730

Query:   308 MKEAKLPNSLEEAVQRVRDSKSSSEGFGYLGDATDIRYLVMTNCDLQMVGDEFSRKPYAI 367
             M+EAKLP +L+EAV RVR+S +++ GF +LGDATDIRYL +TNCDLQ+VG+EFSRKPYAI
Sbjct:   731 MQEAKLPATLDEAVARVRNSTAAT-GFAFLGDATDIRYLQLTNCDLQVVGEEFSRKPYAI 789

Query:   368 AVQQDRDARELFCNVHANILS 388
             AVQQ    ++ F N    +L+
Sbjct:   790 AVQQGSHLKDQFNNAILTLLN 810
GO:0005234 "extracellular-glutamate-gated ion channel activity" evidence=IEA;ISS
GO:0006811 "ion transport" evidence=IEA
GO:0004970 "ionotropic glutamate receptor activity" evidence=IEA
GO:0016020 "membrane" evidence=IEA
GO:0050907 "detection of chemical stimulus involved in sensory perception" evidence=IEP
GO:0015276 "ligand-gated ion channel activity" evidence=ISM
GO:0016021 "integral to membrane" evidence=ISM
GO:0071683 "sensory dendrite" evidence=IDA
GO:0005929 "cilium" evidence=IDA
GO:0007608 "sensory perception of smell" evidence=IMP
WB|WBGene00001618 glr-7 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
FB|FBgn0052704 Ir8a "Ionotropic receptor 8a" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0038837 CG3822 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
RGD|71027 Grik3 "glutamate receptor, ionotropic, kainate 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P42264 Grik3 "Glutamate receptor ionotropic, kainate 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1MCM2 GRIK3 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1SV43 GRIK3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1P0L4 GRIK3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|A9Z1Z8 GRIK3 "Glutamate receptor, ionotropic, kainate 3, isoform CRA_a" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query444
pfam00060268 pfam00060, Lig_chan, Ligand-gated ion channel 2e-38
pfam1061365 pfam10613, Lig_chan-Glu_bd, Ligated ion channel L- 1e-22
smart0091862 smart00918, Lig_chan-Glu_bd, Ligated ion channel L 2e-22
smart00079133 smart00079, PBPe, Eukaryotic homologues of bacteri 1e-19
pfam00497220 pfam00497, SBP_bac_3, Bacterial extracellular solu 1e-12
cd00134218 cd00134, PBPb, Bacterial periplasmic transport sys 1e-10
cd06383368 cd06383, PBP1_iGluR_AMPA_Like, N-terminal leucine/ 6e-10
smart00062219 smart00062, PBPb, Bacterial periplasmic substrate- 3e-08
COG0834275 COG0834, HisJ, ABC-type amino acid transport/signa 8e-08
PRK09495247 PRK09495, glnH, glutamine ABC transporter periplas 8e-07
cd00916123 cd00916, Npc2_like, Niemann-Pick type C2 (Npc2) is 9e-07
pfam02221132 pfam02221, E1_DerP2_DerF2, ML domain 6e-05
smart00737119 smart00737, ML, Domain involved in innate immunity 4e-04
TIGR01096250 TIGR01096, 3A0103s03R, lysine-arginine-ornithine-b 8e-04
PRK11260266 PRK11260, PRK11260, cystine transporter subunit; P 0.004
>gnl|CDD|215685 pfam00060, Lig_chan, Ligand-gated ion channel Back     alignment and domain information 
 Score =  139 bits (353), Expect = 2e-38
 Identities = 63/197 (31%), Positives = 90/197 (45%), Gaps = 41/197 (20%)

Query: 187 FSGGEAPKNLSGRLVAATWWLFGFIIIASYTANLAAFLTVSRLDTPIESLDDLSKQYKIQ 246
               E P++LSGR++   WW F  I+++SYTANLAAFLTV R+ +PI+SL+DL+KQ KI 
Sbjct: 54  QGHRELPRSLSGRILVGVWWFFALILLSSYTANLAAFLTVERMQSPIQSLEDLAKQNKIG 113

Query: 247 YAPLNGSAAMTYFQRMADIEGRFYEIWKDMSLNDSLSDVERAKLAVWDYPVSDKYTKMWQ 306
           Y  L G +   +F+   +                                    Y +MW+
Sbjct: 114 YGTLRGGSTFEFFKESKNPT----------------------------------YRRMWE 139

Query: 307 AMKEAK---LPNSLEEAVQRVRDSKSSSEGFGYLGDATDIRYLVMTN-CDLQMVGDEFSR 362
            M   K      S EE VQRVR        + +L ++  + Y V  + C L  VG+ F  
Sbjct: 140 YMISFKGEVNVESYEEGVQRVRKGNG---LYAFLMESAYLEYEVARDPCKLTTVGEVFGT 196

Query: 363 KPYAIAVQQDRDARELF 379
           K Y IA  +    R+  
Sbjct: 197 KGYGIAFPKGSPLRDKL 213

This family includes the four transmembrane regions of the ionotropic glutamate receptors and NMDA receptors. Length = 268
>gnl|CDD|204533 pfam10613, Lig_chan-Glu_bd, Ligated ion channel L-glutamate- and glycine-binding site Back     alignment and domain information
>gnl|CDD|214911 smart00918, Lig_chan-Glu_bd, Ligated ion channel L-glutamate- and glycine-binding site Back     alignment and domain information
>gnl|CDD|197504 smart00079, PBPe, Eukaryotic homologues of bacterial periplasmic substrate binding proteins Back     alignment and domain information
>gnl|CDD|215950 pfam00497, SBP_bac_3, Bacterial extracellular solute-binding proteins, family 3 Back     alignment and domain information
>gnl|CDD|238078 cd00134, PBPb, Bacterial periplasmic transport systems use membrane-bound complexes and substrate-bound, membrane-associated, periplasmic binding proteins (PBPs) to transport a wide variety of substrates, such as, amino acids, peptides, sugars, vitamins and inorganic ions Back     alignment and domain information
>gnl|CDD|107378 cd06383, PBP1_iGluR_AMPA_Like, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of uncharacterized AMPA-like receptors Back     alignment and domain information
>gnl|CDD|214497 smart00062, PBPb, Bacterial periplasmic substrate-binding proteins Back     alignment and domain information
>gnl|CDD|223904 COG0834, HisJ, ABC-type amino acid transport/signal transduction systems, periplasmic component/domain [Amino acid transport and metabolism / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|236540 PRK09495, glnH, glutamine ABC transporter periplasmic protein; Reviewed Back     alignment and domain information
>gnl|CDD|238458 cd00916, Npc2_like, Niemann-Pick type C2 (Npc2) is a lysosomal protein in which a mutation in the gene causes a rare form of Niemann-Pick type C disease, an autosomal recessive lipid storage disorder characterized by accumulation of low-density lipoprotein-derived cholesterol in lysosomes Back     alignment and domain information
>gnl|CDD|216934 pfam02221, E1_DerP2_DerF2, ML domain Back     alignment and domain information
>gnl|CDD|214796 smart00737, ML, Domain involved in innate immunity and lipid metabolism Back     alignment and domain information
>gnl|CDD|233269 TIGR01096, 3A0103s03R, lysine-arginine-ornithine-binding periplasmic protein Back     alignment and domain information
>gnl|CDD|183061 PRK11260, PRK11260, cystine transporter subunit; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 444
KOG1054|consensus897 100.0
KOG1053|consensus 1258 100.0
KOG1052|consensus656 100.0
KOG4440|consensus 993 100.0
PF00497225 SBP_bac_3: Bacterial extracellular solute-binding 99.86
PRK09495247 glnH glutamine ABC transporter periplasmic protein 99.85
PRK10797302 glutamate and aspartate transporter subunit; Provi 99.84
PRK11260266 cystine transporter subunit; Provisional 99.82
TIGR02995275 ectoine_ehuB ectoine/hydroxyectoine ABC transporte 99.8
PRK15007243 putative ABC transporter arginine-biding protein; 99.79
PRK15010260 ABC transporter lysine/arginine/ornithine binding 99.79
TIGR01096250 3A0103s03R lysine-arginine-ornithine-binding perip 99.78
PRK10859 482 membrane-bound lytic transglycosylase F; Provision 99.77
PRK15437259 histidine ABC transporter substrate-binding protei 99.76
PRK11917259 bifunctional adhesin/ABC transporter aspartate/glu 99.74
TIGR02285268 conserved hypothetical protein. Members of this fa 99.66
TIGR03870246 ABC_MoxJ methanol oxidation system protein MoxJ. T 99.66
PRK09959 1197 hybrid sensory histidine kinase in two-component r 99.64
COG0834275 HisJ ABC-type amino acid transport/signal transduc 99.61
smart00062219 PBPb Bacterial periplasmic substrate-binding prote 99.58
PRK09959 1197 hybrid sensory histidine kinase in two-component r 99.58
cd00134218 PBPb Bacterial periplasmic transport systems use m 99.56
TIGR03871232 ABC_peri_MoxJ_2 quinoprotein dehydrogenase-associa 99.53
COG4623 473 Predicted soluble lytic transglycosylase fused to 99.47
PF00060148 Lig_chan: Ligand-gated ion channel; InterPro: IPR0 99.42
smart00079134 PBPe Eukaryotic homologues of bacterial periplasmi 99.42
PF1061365 Lig_chan-Glu_bd: Ligated ion channel L-glutamate- 99.39
TIGR01098254 3A0109s03R phosphate/phosphite/phosphonate ABC tra 98.48
PRK00489287 hisG ATP phosphoribosyltransferase; Reviewed 98.39
TIGR03431288 PhnD phosphonate ABC transporter, periplasmic phos 97.59
PRK11553314 alkanesulfonate transporter substrate-binding subu 95.86
PF12974243 Phosphonate-bd: ABC transporter, phosphonate, peri 95.23
PF03466209 LysR_substrate: LysR substrate binding domain; Int 94.06
TIGR01729300 taurine_ABC_bnd taurine ABC transporter, periplasm 94.0
COG3221299 PhnD ABC-type phosphate/phosphonate transport syst 93.68
cd05466197 PBP2_LTTR_substrate The substrate binding domain o 92.71
PF0788579 Ion_trans_2: Ion channel; InterPro: IPR013099 This 92.54
cd08468202 PBP2_Pa0477 The C-terminal substrate biniding doma 91.82
cd08421198 PBP2_LTTR_like_1 The C-terminal substrate binding 91.56
cd08426199 PBP2_LTTR_like_5 The C-terminal substrate binding 91.23
cd08459201 PBP2_DntR_NahR_LinR_like The C-terminal substrate 91.22
cd08433198 PBP2_Nac The C-teminal substrate binding domain of 90.55
cd00918120 Der-p2_like Several group 2 allergen proteins belo 90.21
cd08412198 PBP2_PAO1_like The C-terminal substrate-binding do 90.19
cd08417200 PBP2_Nitroaromatics_like The C-terminal substrate 90.05
cd08462200 PBP2_NodD The C-terminal substsrate binding domain 89.99
cd08467200 PBP2_SyrM The C-terminal substrate binding of LysR 89.98
cd08418201 PBP2_TdcA The C-terminal substrate binding domain 89.97
cd08460200 PBP2_DntR_like_1 The C-terminal substrate binding 89.8
cd08419197 PBP2_CbbR_RubisCO_like The C-terminal substrate bi 89.74
PRK11151305 DNA-binding transcriptional regulator OxyR; Provis 89.63
cd08442193 PBP2_YofA_SoxR_like The C-terminal substrate bindi 89.24
cd08438197 PBP2_CidR The C-terminal substrate binding domain 89.14
PF12727193 PBP_like: PBP superfamily domain; InterPro: IPR024 89.12
KOG4063|consensus158 88.95
TIGR02122320 TRAP_TAXI TRAP transporter solute receptor, TAXI f 88.89
cd08466200 PBP2_LeuO The C-terminal substrate binding domain 88.75
cd08440197 PBP2_LTTR_like_4 TThe C-terminal substrate binding 88.45
PRK10837290 putative DNA-binding transcriptional regulator; Pr 88.22
cd08448197 PBP2_LTTR_aromatics_like_2 The C-terminal substrat 88.07
cd08420201 PBP2_CysL_like C-terminal substrate binding domain 88.03
cd08434195 PBP2_GltC_like The substrate binding domain of Lys 87.82
cd08427195 PBP2_LTTR_like_2 The C-terminal substrate binding 87.15
CHL00180305 rbcR LysR transcriptional regulator; Provisional 87.08
cd08463203 PBP2_DntR_like_4 The C-terminal substrate binding 86.96
cd08414197 PBP2_LTTR_aromatics_like The C-terminal substrate 86.38
COG1910223 Periplasmic molybdate-binding protein/domain [Inor 86.38
cd08461198 PBP2_DntR_like_3 The C-terminal substrate binding 86.32
cd08415196 PBP2_LysR_opines_like The C-terminal substrate-dom 86.29
cd08413198 PBP2_CysB_like The C-terminal substrate domain of 86.26
cd08411200 PBP2_OxyR The C-terminal substrate-binding domain 85.89
PRK11233305 nitrogen assimilation transcriptional regulator; P 85.31
PRK11242296 DNA-binding transcriptional regulator CynR; Provis 85.23
TIGR01728288 SsuA_fam ABC transporter, substrate-binding protei 84.26
cd08436194 PBP2_LTTR_like_3 The C-terminal substrate binding 84.16
cd08423200 PBP2_LTTR_like_6 The C-terminal substrate binding 84.14
cd08429204 PBP2_NhaR The C-terminal substrate binding domain 83.86
cd08464200 PBP2_DntR_like_2 The C-terminal substrate binding 83.61
PRK12684313 transcriptional regulator CysB-like protein; Revie 83.3
cd08435201 PBP2_GbpR The C-terminal substrate binding domain 83.18
cd08456196 PBP2_LysR The C-terminal substrate binding domain 83.13
cd08441198 PBP2_MetR The C-terminal substrate binding domain 82.9
PRK12682309 transcriptional regulator CysB-like protein; Revie 82.89
PRK09791302 putative DNA-binding transcriptional regulator; Pr 82.43
cd08453200 PBP2_IlvR The C-terminal substrate binding domain 82.02
PF13379252 NMT1_2: NMT1-like family; PDB: 2G29_A 3UN6_A 2I4C_ 81.95
PRK12683309 transcriptional regulator CysB-like protein; Revie 81.62
cd08465200 PBP2_ToxR The C-terminal substrate binding domain 80.7
cd08451199 PBP2_BudR The C-terminal substrate binding domain 80.67
>KOG1054|consensus Back     alignment and domain information 
Probab=100.00  E-value=7.5e-55  Score=425.47  Aligned_cols=359  Identities=34%  Similarity=0.607  Sum_probs=327.5

Q ss_pred             eeeEEEeccCCCeEEEecCCC--CCceeeeecHHHHHHHHHHHcCCeEEEEEcCCCCCccccCCCc-cchhHHHHhcccc
Q psy12229          5 TNISDSRLKQEPFVMREESEG--GGGVKYKGYCIDLIEEIRKLVGFEYEIFVAPDNSFGNMDENGQ-WNGMIKELIEKRA   81 (444)
Q Consensus         5 ~~l~V~~~~~~Pf~~~~~~~~--~~~~~~~G~~~dil~~la~~lnft~~~~~~~~~~~g~~~~ng~-~~g~i~~l~~g~~   81 (444)
                      +++.|++---.||++...+-.  .|+.++.|+++|++.++|+..+.+|++....+++||..++.++ |+||+|.|..|++
T Consensus       417 ~tvvvttiL~spyvm~kkn~~~~egn~ryEGyCvdLa~~iAkhi~~~Y~l~iv~dgkyGardaD~k~WnGMvGeLv~grA  496 (897)
T KOG1054|consen  417 RTVVVTTILESPYVMLKKNHEQLEGNERYEGYCVDLAAEIAKHIGIKYKLFIVGDGKYGARDADTKIWNGMVGELVYGRA  496 (897)
T ss_pred             ceEEEEEecCCchhHHHhhHHHhcCCcccceeHHHHHHHHHHhcCceEEEEEecCCcccccCCCcccccchhHHHhcCcc
Confidence            456667777778887766543  5777899999999999999999999999999999999999999 9999999999999


Q ss_pred             cEEeecccccccccccccccccceecccEEEEEeCC-CCCCcccccccccchhHHHHHHHHHHHHh------cceecccc
Q psy12229         82 DIALGSLSVMAERENVVDFTVPYYDLVGITILMKKP-KTPTSLFKFLTVLETGVWLCILAAYCNLD------GEQMKYLI  154 (444)
Q Consensus        82 Di~~~~~~~t~~r~~~~dfS~p~~~~~~~~ilvp~~-~~~~~~~~~l~pF~~~vWi~i~~~~~~~~------~~~~~~~~  154 (444)
                      |++++++++|.+|.+.+|||.|++. .++.+|+++| ++.+..+.|+.|....+|+|++++++-++      .+|+|++|
T Consensus       497 diavApLTIt~~REeviDFSKPfMs-lGISIMIKKPqKsk~gVFSFldPLa~eIWm~ivfaYiGVSvvlFLVSrFSPYEw  575 (897)
T KOG1054|consen  497 DIAVAPLTITLVREEVIDFSKPFMS-LGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEW  575 (897)
T ss_pred             ceEEeeeeeehhhhhhhccccchhh-cCeEEEEeCcccCCCCeeeecchhHHHHHHHHHHHHhcceEEEEEEeccCchhe
Confidence            9999999999999999999999999 9999999999 57899999999999999999999998876      68899999


Q ss_pred             ccCCC---CCCC-------cccchhhhhhhHhHhcccccccCCCCCCCCCChhhHHHHHHHHHHHHHHHHHhhhcchhhh
Q psy12229        155 QVNPP---GDIL-------PEVIRAIILMQNITDAGILFDDSFSGGEAPKNLSGRLVAATWWLFGFIIIASYTANLAAFL  224 (444)
Q Consensus       155 ~~~~~---~~~~-------~~~~~~~~~~~~l~~~g~~~~~~~~~~~~p~~~s~Rl~~~~w~l~~lvl~~~Y~a~L~s~L  224 (444)
                      +....   .+..       +..++.||.+++++.||        -+..|++.|+|++-++||+|.+|++++|+|+|+++|
T Consensus       576 h~Ee~~rg~~t~~~~~NeFgifNsLWFsLgAFMQQG--------~DI~PRslSGRIvggvWWFFTlIIiSSYTANLAAFL  647 (897)
T KOG1054|consen  576 HTEEFERGRFTPSDPPNEFGIFNSLWFSLGAFMQQG--------CDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFL  647 (897)
T ss_pred             eccccccCCCCCCCCCccchhhHHHHHHHHHHHhcC--------CCCCccccccceeccchhhhhhhhhhhhhhHHHHHH
Confidence            88543   2221       12479999999999999        999999999999999999999999999999999999


Q ss_pred             hcccCCCCCCChHHhhhCCceeeEecCCChhhHHhhhhhhhhhHHHHHHhhhccCCCCcHHHHhhhhcccCCcchhHHHH
Q psy12229        225 TVSRLDTPIESLDDLSKQYKIQYAPLNGSAAMTYFQRMADIEGRFYEIWKDMSLNDSLSDVERAKLAVWDYPVSDKYTKM  304 (444)
Q Consensus       225 t~~~~~~~I~sl~dL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~y~~~  304 (444)
                      |+.++.+||.|.+||++|+++.||+..+.++.+||+.+.                          +        +.|.+|
T Consensus       648 TvErMvsPIESaEDLAkQteIaYGt~~~GSTkeFFr~Sk--------------------------i--------avy~kM  693 (897)
T KOG1054|consen  648 TVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSK--------------------------I--------AVYEKM  693 (897)
T ss_pred             hHHhhcCcchhHHHHhhcceeeeeecCCCchHHHHhhhh--------------------------H--------HHHHHH
Confidence            999999999999999999999999999999999999763                          2        678889


Q ss_pred             HHHHHhcC---CCCCHHHHHHHHHhcCCCCCceEEEecccchhhhhc-CCCccEEeCCcccccceEEEecCCCchhhhhH
Q psy12229        305 WQAMKEAK---LPNSLEEAVQRVRDSKSSSEGFGYLGDATDIRYLVM-TNCDLQMVGDEFSRKPYAIAVQQDRDARELFC  380 (444)
Q Consensus       305 ~~~~~~~~---~~~~~~e~~~~v~~~~~~~~~~a~i~d~~~~~y~~~-~~c~l~~~~~~~~~~~~~~~~~k~sp~~~~in  380 (444)
                      |..|++.+   ++.+++|++++|++++   |+|||+.+..+-+|..+ ++|+-..++.++.+-+||++.||||.++..+|
T Consensus       694 W~yM~SaepsVFv~t~aeGv~rVRksK---GkyAfLLEsTmNey~eqRkPCDTMKVGgNLds~GYGiATp~Gsslr~~vN  770 (897)
T KOG1054|consen  694 WTYMKSAEPSVFVRTTAEGVARVRKSK---GKYAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLRNAVN  770 (897)
T ss_pred             HHHHhcCCcceeeehhhhHHHHHHhcC---CceEeehHhhhhhhhhccCCccceecccccCCcceeecCCCCcccccchh
Confidence            99998874   6889999999999997   69999999999999998 78999999999999999999999999999999


Q ss_pred             HHHHHHhcCCccccCCCCCcccccccccCCCCcccCCCC
Q psy12229        381 NVHANILSIPFPFIGVDGTSVCSSIFDTDGKTKVSCPLK  419 (444)
Q Consensus       381 ~~il~l~e~G~i~~~~~~~~~~~~kw~~~~~~~~~c~~~  419 (444)
                      .+++.|.|.|+++|+       ++|||.|.   ..|...
T Consensus       771 LAvLkL~E~G~LdKL-------kNKWWYDk---GeC~sg  799 (897)
T KOG1054|consen  771 LAVLKLNEQGLLDKL-------KNKWWYDK---GECGSG  799 (897)
T ss_pred             hhhhhhcccchHHHh-------hhhhcccc---cccCCC
Confidence            999999999999999       99999984   488643

>KOG1053|consensus Back     alignment and domain information
>KOG1052|consensus Back     alignment and domain information
>KOG4440|consensus Back     alignment and domain information
>PF00497 SBP_bac_3: Bacterial extracellular solute-binding proteins, family 3; InterPro: IPR001638 Bacterial high affinity transport systems are involved in active transport of solutes across the cytoplasmic membrane Back     alignment and domain information
>PRK09495 glnH glutamine ABC transporter periplasmic protein; Reviewed Back     alignment and domain information
>PRK10797 glutamate and aspartate transporter subunit; Provisional Back     alignment and domain information
>PRK11260 cystine transporter subunit; Provisional Back     alignment and domain information
>TIGR02995 ectoine_ehuB ectoine/hydroxyectoine ABC transporter solute-binding protein Back     alignment and domain information
>PRK15007 putative ABC transporter arginine-biding protein; Provisional Back     alignment and domain information
>PRK15010 ABC transporter lysine/arginine/ornithine binding periplasmic protein; Provisional Back     alignment and domain information
>TIGR01096 3A0103s03R lysine-arginine-ornithine-binding periplasmic protein Back     alignment and domain information
>PRK10859 membrane-bound lytic transglycosylase F; Provisional Back     alignment and domain information
>PRK15437 histidine ABC transporter substrate-binding protein HisJ; Provisional Back     alignment and domain information
>PRK11917 bifunctional adhesin/ABC transporter aspartate/glutamate-binding protein; Reviewed Back     alignment and domain information
>TIGR02285 conserved hypothetical protein Back     alignment and domain information
>TIGR03870 ABC_MoxJ methanol oxidation system protein MoxJ Back     alignment and domain information
>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>COG0834 HisJ ABC-type amino acid transport/signal transduction systems, periplasmic component/domain [Amino acid transport and metabolism / Signal transduction mechanisms] Back     alignment and domain information
>smart00062 PBPb Bacterial periplasmic substrate-binding proteins Back     alignment and domain information
>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>cd00134 PBPb Bacterial periplasmic transport systems use membrane-bound complexes and substrate-bound, membrane-associated, periplasmic binding proteins (PBPs) to transport a wide variety of substrates, such as, amino acids, peptides, sugars, vitamins and inorganic ions Back     alignment and domain information
>TIGR03871 ABC_peri_MoxJ_2 quinoprotein dehydrogenase-associated probable ABC transporter substrate-binding protein Back     alignment and domain information
>COG4623 Predicted soluble lytic transglycosylase fused to an ABC-type amino acid-binding protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF00060 Lig_chan: Ligand-gated ion channel; InterPro: IPR001320 The ability of synapses to modify their synaptic strength in response to activity is a fundamental property of the nervous system and may be an essential component of learning and memory Back     alignment and domain information
>smart00079 PBPe Eukaryotic homologues of bacterial periplasmic substrate binding proteins Back     alignment and domain information
>PF10613 Lig_chan-Glu_bd: Ligated ion channel L-glutamate- and glycine-binding site; InterPro: IPR019594 This entry, sometimes called the S1 domain, is the luminal domain just upstream of the first, M1, transmembrane region of transmembrane ion-channel proteins, and binds L-glutamate and glycine [, ] Back     alignment and domain information
>TIGR01098 3A0109s03R phosphate/phosphite/phosphonate ABC transporters, periplasmic binding protein Back     alignment and domain information
>PRK00489 hisG ATP phosphoribosyltransferase; Reviewed Back     alignment and domain information
>TIGR03431 PhnD phosphonate ABC transporter, periplasmic phosphonate binding protein Back     alignment and domain information
>PRK11553 alkanesulfonate transporter substrate-binding subunit; Provisional Back     alignment and domain information
>PF12974 Phosphonate-bd: ABC transporter, phosphonate, periplasmic substrate-binding protein ; PDB: 3N5L_B 3QUJ_C 3P7I_A 3QK6_A 3S4U_A Back     alignment and domain information
>PF03466 LysR_substrate: LysR substrate binding domain; InterPro: IPR005119 The structure of this domain is known and is similar to the periplasmic binding proteins [] Back     alignment and domain information
>TIGR01729 taurine_ABC_bnd taurine ABC transporter, periplasmic binding protein Back     alignment and domain information
>COG3221 PhnD ABC-type phosphate/phosphonate transport system, periplasmic component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd05466 PBP2_LTTR_substrate The substrate binding domain of LysR-type transcriptional regulators (LTTRs), a member of the type 2 periplasmic binding fold protein superfamily Back     alignment and domain information
>PF07885 Ion_trans_2: Ion channel; InterPro: IPR013099 This entry includes the two membrane helix type ion channels found in bacteria [] Back     alignment and domain information
>cd08468 PBP2_Pa0477 The C-terminal substrate biniding domain of an uncharacterized LysR-like transcriptional regulator Pa0477 related to DntR, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08421 PBP2_LTTR_like_1 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08426 PBP2_LTTR_like_5 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08459 PBP2_DntR_NahR_LinR_like The C-terminal substrate binding domain of LysR-type transcriptional regulators that are involved in the catabolism of dinitrotoluene, naphthalene and gamma-hexachlorohexane; contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08433 PBP2_Nac The C-teminal substrate binding domain of LysR-like nitrogen assimilation control (NAC) protein, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd00918 Der-p2_like Several group 2 allergen proteins belong to the ML domain family Back     alignment and domain information
>cd08412 PBP2_PAO1_like The C-terminal substrate-binding domain of putative LysR-type transcriptional regulator PAO1-like, a member of the type 2 periplasmic binding fold protein superfamily Back     alignment and domain information
>cd08417 PBP2_Nitroaromatics_like The C-terminal substrate binding domain of LysR-type transcriptional regulators that involved in the catabolism of nitroaromatic/naphthalene compounds and that of related regulators; contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08462 PBP2_NodD The C-terminal substsrate binding domain of NodD family of LysR-type transcriptional regulators that regulates the expression of nodulation (nod) genes; contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08467 PBP2_SyrM The C-terminal substrate binding of LysR-type symbiotic regulator SyrM, which activates expression of nodulation gene NodD3, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08418 PBP2_TdcA The C-terminal substrate binding domain of LysR-type transcriptional regulator TdcA, which is involved in the degradation of L-serine and L-threonine, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08460 PBP2_DntR_like_1 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator similar to DntR, which is involved in the catabolism of dinitrotoluene; contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08419 PBP2_CbbR_RubisCO_like The C-terminal substrate binding of LysR-type transcriptional regulator (CbbR) of RubisCO operon, which is involved in the carbon dioxide fixation, contains the type 2 periplasmic binding fold Back     alignment and domain information
>PRK11151 DNA-binding transcriptional regulator OxyR; Provisional Back     alignment and domain information
>cd08442 PBP2_YofA_SoxR_like The C-terminal substrate binding domain of LysR-type transcriptional regulators, YofA and SoxR, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08438 PBP2_CidR The C-terminal substrate binding domain of LysR-like transcriptional regulator CidR, contains the type 2 periplasmic binding fold Back     alignment and domain information
>PF12727 PBP_like: PBP superfamily domain; InterPro: IPR024370 This entry represents members of the periplasmic binding domain superfamily [] Back     alignment and domain information
>KOG4063|consensus Back     alignment and domain information
>TIGR02122 TRAP_TAXI TRAP transporter solute receptor, TAXI family Back     alignment and domain information
>cd08466 PBP2_LeuO The C-terminal substrate binding domain of LysR-type transcriptional regulator LeuO, an activator of leucine synthesis operon, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08440 PBP2_LTTR_like_4 TThe C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold Back     alignment and domain information
>PRK10837 putative DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>cd08448 PBP2_LTTR_aromatics_like_2 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator similar to regulators involved in the catabolism of aromatic compounds, contains type 2 periplasmic binding fold Back     alignment and domain information
>cd08420 PBP2_CysL_like C-terminal substrate binding domain of LysR-type transcriptional regulator CysL, which activates the transcription of the cysJI operon encoding sulfite reductase, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08434 PBP2_GltC_like The substrate binding domain of LysR-type transcriptional regulator GltC, which activates gltA expression of glutamate synthase operon, contains type 2 periplasmic binding fold Back     alignment and domain information
>cd08427 PBP2_LTTR_like_2 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold Back     alignment and domain information
>CHL00180 rbcR LysR transcriptional regulator; Provisional Back     alignment and domain information
>cd08463 PBP2_DntR_like_4 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator similar to DntR, which is involved in the catabolism of dinitrotoluene; contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08414 PBP2_LTTR_aromatics_like The C-terminal substrate binding domain of LysR-type transcriptional regulators involved in the catabolism of aromatic compounds and that of other related regulators, contains type 2 periplasmic binding fold Back     alignment and domain information
>COG1910 Periplasmic molybdate-binding protein/domain [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd08461 PBP2_DntR_like_3 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator similar to DntR, which is involved in the catabolism of dinitrotoluene; contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08415 PBP2_LysR_opines_like The C-terminal substrate-domain of LysR-type transcriptional regulators involved in the catabolism of opines and that of related regulators, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08413 PBP2_CysB_like The C-terminal substrate domain of LysR-type transcriptional regulators CysB-like contains type 2 periplasmic binding fold Back     alignment and domain information
>cd08411 PBP2_OxyR The C-terminal substrate-binding domain of the LysR-type transcriptional regulator OxyR, a member of the type 2 periplasmic binding fold protein superfamily Back     alignment and domain information
>PRK11233 nitrogen assimilation transcriptional regulator; Provisional Back     alignment and domain information
>PRK11242 DNA-binding transcriptional regulator CynR; Provisional Back     alignment and domain information
>TIGR01728 SsuA_fam ABC transporter, substrate-binding protein, aliphatic sulfonates family Back     alignment and domain information
>cd08436 PBP2_LTTR_like_3 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08423 PBP2_LTTR_like_6 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08429 PBP2_NhaR The C-terminal substrate binding domain of LysR-type transcriptional activator of the nhaA gene, encoding Na+/H+ antiporter, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08464 PBP2_DntR_like_2 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator similar to DntR, which is involved in the catabolism of dinitrotoluene; contains the type 2 periplasmic binding fold Back     alignment and domain information
>PRK12684 transcriptional regulator CysB-like protein; Reviewed Back     alignment and domain information
>cd08435 PBP2_GbpR The C-terminal substrate binding domain of galactose-binding protein regulator contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08456 PBP2_LysR The C-terminal substrate binding domain of LysR, transcriptional regulator for lysine biosynthesis, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08441 PBP2_MetR The C-terminal substrate binding domain of LysR-type transcriptional regulator metR, which regulates the expression of methionine biosynthetic genes, contains type 2 periplasmic binding fold Back     alignment and domain information
>PRK12682 transcriptional regulator CysB-like protein; Reviewed Back     alignment and domain information
>PRK09791 putative DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>cd08453 PBP2_IlvR The C-terminal substrate binding domain of LysR-type transcriptional regulator, IlvR, involved in the biosynthesis of isoleucine, leucine and valine; contains type 2 periplasmic binding fold Back     alignment and domain information
>PF13379 NMT1_2: NMT1-like family; PDB: 2G29_A 3UN6_A 2I4C_A 2I49_A 2I4B_A 2I48_A 3QSL_A Back     alignment and domain information
>PRK12683 transcriptional regulator CysB-like protein; Reviewed Back     alignment and domain information
>cd08465 PBP2_ToxR The C-terminal substrate binding domain of LysR-type transcriptional regulator ToxR regulates the expression of the toxoflavin biosynthesis genes; contains the type 2 periplasmic bindinig fold Back     alignment and domain information
>cd08451 PBP2_BudR The C-terminal substrate binding domain of LysR-type transcrptional regulator BudR, which is responsible for activation of the expression of the butanediol operon genes; contains the type 2 periplasmic binding fold Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query444
3kg2_A823 Ampa Subtype Ionotropic Glutamate Receptor In Compl 9e-50
2v3u_A265 Structure Of The Ligand-binding Core Of The Ionotro 4e-23
2v3t_A265 Structure Of The Ligand-Binding Core Of The Ionotro 2e-22
3u92_A257 Crystal Structure Of The Gluk3 Ligand Binding Domai 6e-22
3u92_A257 Crystal Structure Of The Gluk3 Ligand Binding Domai 3e-07
3s9e_A258 Crystal Structure Of The Kainate Receptor Gluk3 Lig 6e-22
3s9e_A258 Crystal Structure Of The Kainate Receptor Gluk3 Lig 3e-07
1yae_A312 Structure Of The Kainate Receptor Subunit Glur6 Ago 7e-22
1yae_A312 Structure Of The Kainate Receptor Subunit Glur6 Ago 4e-09
2f34_A258 Crystal Structure Of The Glur5 Ligand Binding Core 3e-21
2f34_A258 Crystal Structure Of The Glur5 Ligand Binding Core 5e-07
1txf_A258 Crystal Structure Of The Glur5 Ligand Binding Core 4e-21
1txf_A258 Crystal Structure Of The Glur5 Ligand Binding Core 5e-07
2wky_A258 Crystal Structure Of The Ligand-Binding Core Of Glu 4e-21
2wky_A258 Crystal Structure Of The Ligand-Binding Core Of Glu 5e-07
1ycj_A257 Crystal Structure Of The Kainate Receptor Glur5 Lig 4e-21
1ycj_A257 Crystal Structure Of The Kainate Receptor Glur5 Lig 6e-07
2zns_A256 Crystal Structure Of The Ligand-Binding Core Of The 4e-21
2zns_A256 Crystal Structure Of The Ligand-Binding Core Of The 8e-07
2i0c_A259 Crystal Structure Of The Glur6 Ligand Binding Core 2e-20
2i0c_A259 Crystal Structure Of The Glur6 Ligand Binding Core 1e-08
3qxm_A258 Crystal Structure Of Human Gluk2 Ligand-Binding Cor 3e-20
3qxm_A258 Crystal Structure Of Human Gluk2 Ligand-Binding Cor 1e-08
2xxw_A261 Crystal Structure Of The Gluk2 (Glur6) D776k Lbd Di 3e-20
2xxw_A261 Crystal Structure Of The Gluk2 (Glur6) D776k Lbd Di 1e-08
2xxu_A261 Crystal Structure Of The Gluk2 (Glur6) M770k Lbd Di 3e-20
2xxu_A261 Crystal Structure Of The Gluk2 (Glur6) M770k Lbd Di 1e-08
3g3h_A259 Crystal Structure Of The Glur6 Ligand Binding Domai 3e-20
3g3h_A259 Crystal Structure Of The Glur6 Ligand Binding Domai 5e-09
3g3g_A259 Crystal Structure Of The Glur6 Ligand Binding Domai 3e-20
3g3g_A259 Crystal Structure Of The Glur6 Ligand Binding Domai 5e-09
1s50_A259 X-Ray Structure Of The Glur6 Ligand Binding Core (S 3e-20
1s50_A259 X-Ray Structure Of The Glur6 Ligand Binding Core (S 1e-08
2xxr_A261 Crystal Structure Of The Gluk2 (Glur6) Wild-Type Lb 3e-20
2xxr_A261 Crystal Structure Of The Gluk2 (Glur6) Wild-Type Lb 2e-08
2i0b_A259 Crystal Structure Of The Glur6 Ligand Binding Core 3e-20
2i0b_A259 Crystal Structure Of The Glur6 Ligand Binding Core 1e-08
3g3k_A259 Crystal Structure Of The Glur6 Ligand Binding Domai 9e-20
3g3k_A259 Crystal Structure Of The Glur6 Ligand Binding Domai 5e-09
3g3i_A259 Crystal Structure Of The Glur6 Ligand Binding Domai 9e-20
3g3i_A259 Crystal Structure Of The Glur6 Ligand Binding Domai 1e-08
3g3j_A259 Crystal Structure Of The Glur6 Ligand Binding Domai 9e-20
3g3j_A259 Crystal Structure Of The Glur6 Ligand Binding Domai 5e-09
1gr2_A279 Structure Of A Glutamate Receptor Ligand Binding Co 5e-18
1gr2_A279 Structure Of A Glutamate Receptor Ligand Binding Co 3e-06
3en3_A257 Crystal Structure Of The Glur4 Ligand-Binding Domai 1e-17
3en3_A257 Crystal Structure Of The Glur4 Ligand-Binding Domai 4e-06
3kei_A257 Crystal Structure Of The Glua4 Ligand-Binding Domai 1e-17
3kei_A257 Crystal Structure Of The Glua4 Ligand-Binding Domai 8e-06
3fat_A260 X-Ray Structure Of Iglur4 Flip Ligand-Binding Core 2e-17
3fat_A260 X-Ray Structure Of Iglur4 Flip Ligand-Binding Core 2e-06
2gfe_A262 Crystal Structure Of The Glur2 A476e S673d Ligand B 2e-17
2gfe_A262 Crystal Structure Of The Glur2 A476e S673d Ligand B 1e-06
1mqh_A263 Crystal Structure Of The Glur2 Ligand Binding Core 4e-17
1mqh_A263 Crystal Structure Of The Glur2 Ligand Binding Core 8e-07
2xhd_A263 Crystal Structure Of N-((2s)-5-(6-Fluoro-3-Pyridiny 7e-17
2xhd_A263 Crystal Structure Of N-((2s)-5-(6-Fluoro-3-Pyridiny 5e-07
2i3v_A259 Measurement Of Conformational Changes Accompanying 7e-17
2i3v_A259 Measurement Of Conformational Changes Accompanying 2e-06
3o28_A263 Ligand-Binding Domain Of Glua2 (Flip) Ionotropic Gl 8e-17
3o28_A263 Ligand-Binding Domain Of Glua2 (Flip) Ionotropic Gl 9e-07
3o29_A263 Ligand-Binding Domain Of Glua2 (Flip) Ionotropic Gl 8e-17
3o29_A263 Ligand-Binding Domain Of Glua2 (Flip) Ionotropic Gl 9e-07
3ijo_B258 Crystal Structure Of The Ampa Subunit Glur2 Bound T 8e-17
3ijo_B258 Crystal Structure Of The Ampa Subunit Glur2 Bound T 1e-06
3t9x_B258 Glutamate Bound To A Double Cysteine Mutant (V484cE 8e-17
3t9x_B258 Glutamate Bound To A Double Cysteine Mutant (V484cE 8e-07
3h03_A258 Crystal Structure Of The Binding Domain Of The Ampa 8e-17
3h03_A258 Crystal Structure Of The Binding Domain Of The Ampa 9e-07
2i3w_A259 Measurement Of Conformational Changes Accompanying 8e-17
2i3w_A259 Measurement Of Conformational Changes Accompanying 2e-06
3rn8_A280 Crystal Structure Of Iglur2 Ligand Binding Domain A 9e-17
3rn8_A280 Crystal Structure Of Iglur2 Ligand Binding Domain A 8e-07
1lbc_A263 Crystal Structure Of Glur2 Ligand Binding Core (S1s 9e-17
1lbc_A263 Crystal Structure Of Glur2 Ligand Binding Core (S1s 9e-07
1mqd_A261 X-Ray Structure Of The Glur2 Ligand-Binding Core (S 9e-17
1mqd_A261 X-Ray Structure Of The Glur2 Ligand-Binding Core (S 9e-07
3pd8_A261 X-Ray Structure Of The Ligand-Binding Core Of Glua2 9e-17
3pd8_A261 X-Ray Structure Of The Ligand-Binding Core Of Glua2 9e-07
3dp6_A279 Crystal Structure Of The Binding Domain Of The Ampa 9e-17
3dp6_A279 Crystal Structure Of The Binding Domain Of The Ampa 9e-07
1lbb_A263 Crystal Structure Of The Glur2 Ligand Binding Domai 9e-17
1lbb_A263 Crystal Structure Of The Glur2 Ligand Binding Domai 9e-07
1p1n_A263 Glur2 Ligand Binding Core (S1s2j) Mutant L650t In C 9e-17
1p1n_A263 Glur2 Ligand Binding Core (S1s2j) Mutant L650t In C 3e-06
3r7x_A263 Crystal Structure Analysis Of A Quinazolinedione Su 9e-17
3r7x_A263 Crystal Structure Analysis Of A Quinazolinedione Su 5e-07
3b6t_A263 Crystal Structure Of The Glur2 Ligand Binding Core 9e-17
3b6t_A263 Crystal Structure Of The Glur2 Ligand Binding Core 9e-07
2uxa_A261 Crystal Structure Of The Glur2-Flip Ligand Binding 9e-17
2uxa_A261 Crystal Structure Of The Glur2-Flip Ligand Binding 5e-07
1fw0_A263 Crystal Structure Of The Glur2 Ligand Binding Core 9e-17
1fw0_A263 Crystal Structure Of The Glur2 Ligand Binding Core 8e-07
3pd9_A260 X-Ray Structure Of The Ligand-Binding Core Of Glua2 9e-17
3pd9_A260 X-Ray Structure Of The Ligand-Binding Core Of Glua2 9e-07
1m5d_A263 X-ray Structure Of The Glur2 Ligand Binding Core (s 9e-17
1m5d_A263 X-ray Structure Of The Glur2 Ligand Binding Core (s 2e-06
3b6w_C263 Crystal Structure Of The Glur2 Ligand Binding Core 9e-17
3b6w_C263 Crystal Structure Of The Glur2 Ligand Binding Core 1e-06
3rnn_A292 Crystal Structure Of Iglur2 Ligand Binding Domain W 1e-16
3rnn_A292 Crystal Structure Of Iglur2 Ligand Binding Domain W 7e-07
1p1w_A263 Crystal Structure Of The Glur2 Ligand-Binding Core 1e-16
1p1w_A263 Crystal Structure Of The Glur2 Ligand-Binding Core 3e-06
2xx7_A291 Crystal Structure Of 1-(4-(1-Pyrrolidinylcarbonyl)p 1e-16
2xx7_A291 Crystal Structure Of 1-(4-(1-Pyrrolidinylcarbonyl)p 8e-07
3tdj_A263 Crystal Structure Of The Glua2 Ligand-Binding Domai 1e-16
3tdj_A263 Crystal Structure Of The Glua2 Ligand-Binding Domai 9e-07
3t93_B258 Glutamate Bound To A Double Cysteine Mutant (A452cS 1e-16
3t93_B258 Glutamate Bound To A Double Cysteine Mutant (A452cS 2e-06
1lb8_A263 Crystal Structure Of The Non-Desensitizing Glur2 Li 1e-16
1lb8_A263 Crystal Structure Of The Non-Desensitizing Glur2 Li 9e-07
2anj_A263 Crystal Structure Of The Glur2 Ligand Binding Core 2e-16
2anj_A263 Crystal Structure Of The Glur2 Ligand Binding Core 1e-06
2rca_B292 Crystal Structure Of The Nr3b Ligand Binding Core C 3e-16
4f22_A258 Kainate Bound To The K660a Mutant Of The Ligand Bin 5e-16
4f22_A258 Kainate Bound To The K660a Mutant Of The Ligand Bin 4e-06
3lsw_A258 Aniracetam Bound To The Ligand Binding Domain Of Gl 6e-16
3lsw_A258 Aniracetam Bound To The Ligand Binding Domain Of Gl 5e-06
4f2o_A258 Quisqualate Bound To The D655a Mutant Of The Ligand 6e-16
4f2o_A258 Quisqualate Bound To The D655a Mutant Of The Ligand 9e-06
3dp4_A278 Crystal Structure Of The Binding Domain Of The Ampa 6e-16
3dp4_A278 Crystal Structure Of The Binding Domain Of The Ampa 5e-06
3m3f_A258 Pepa Bound To The Ligand Binding Domain Of Glua3 (F 7e-16
3m3f_A258 Pepa Bound To The Ligand Binding Domain Of Glua3 (F 5e-06
3oek_A286 Crystal Structure Of Glun2d Ligand-Binding Core In 1e-14
2a5s_A284 Crystal Structure Of The Nr2a Ligand Binding Core I 2e-13
2rc7_A294 Crystal Structure Of The Nr3a Ligand Binding Core C 2e-13
1pb8_A292 Crystal Structure Of The Nr1 Ligand Binding Core In 2e-11
1pb7_A292 Crystal Structure Of The Nr1 Ligand Binding Core In 3e-11
4io2_A248 Crystal Structure Of The Avglur1 Ligand Binding Dom 3e-05
4f3p_A249 Crystal Structure Of A Glutamine-Binding Periplasmi 3e-05
>pdb|3KG2|A Chain A, Ampa Subtype Ionotropic Glutamate Receptor In Complex With Competitive Antagonist Zk 200775 Length = 823 Back     alignment and structure 
Iteration: 1

 Score =  194 bits (493), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 129/375 (34%), Positives = 191/375 (50%), Gaps = 59/375 (15%)
Query: 14  QEPFVMREESEGG--GGVKYKGYCIDLIEEIRKLVGFEYEIFVAPDNSFGNMDENGQ-WN 70
           + P+VM + +     G  +Y+GYC+DL  EI K  GF+Y++ +  D  +G  D + + WN
Sbjct: 393 ESPYVMMKANHAALAGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKIWN 452
Query: 71  GMIKELIEKRADIALGSLSVMAERENVVDFTVPYYDLVGITILMKKP-KTPTSLFKFLTV 129
           GM+ EL+  +ADIA+  L++   RE V+DF+ P+  L GI+I++KKP K+   +F FL  
Sbjct: 453 GMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSL-GISIMIKKPQKSKPGVFSFLDP 511
Query: 130 LETGVWLCILAAYCNLDGEQMKYLIQVNPPGDILPEVI---RAIILMQNITDAGILFDDS 186
           L   +W+CI+ AY  +    + +L+    P +   E     R     ++  + GI     
Sbjct: 512 LAYEIWMCIVFAYIGVS--VVLFLVSRFSPYEWHTEEFEDGRETQSSESTNEFGIFNSLW 569
Query: 187 FSGGE--------APKNLSGRLVAATWWLFGFIIIASYTANLAAFLTVSRLDTPIESLDD 238
           FS G         +P++LSGR+V   WW F  III+SYTANLAAFLTV R+ +PIES +D
Sbjct: 570 FSLGAFMQQGADISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAED 629
Query: 239 LSKQYKIQYAPLNGSAAMTYFQRMADIEGRFYEIWKDMSLNDSLSDVERAKLAVWDYPVS 298
           LSKQ +I Y  L+  +   +F+                          R+K+AV+D    
Sbjct: 630 LSKQTEIAYGTLDSGSTKEFFR--------------------------RSKIAVFD---- 659
Query: 299 DKYTKMWQAMKEAK---LPNSLEEAVQRVRDSKSSSEGFGYLGDATDIRYLVMTN-CDLQ 354
               KMW  M+ A+      +  E V RVR SK     + YL ++T   Y+     CD  
Sbjct: 660 ----KMWTYMRSAEPSVFVRTTAEGVARVRKSKGK---YAYLLESTMNEYIEQRKPCDTM 712
Query: 355 MVGDEFSRKPYAIAV 369
            VG     K Y IA 
Sbjct: 713 KVGGNLDSKGYGIAT 727
>pdb|2V3U|A Chain A, Structure Of The Ligand-binding Core Of The Ionotropic Glutamate Receptor-like Glurdelta2 In Complex With D- Serine Length = 265 Back     alignment and structure
>pdb|2V3T|A Chain A, Structure Of The Ligand-Binding Core Of The Ionotropic Glutamate Receptor-Like Glurdelta2 In The Apo Form Length = 265 Back     alignment and structure
>pdb|3U92|A Chain A, Crystal Structure Of The Gluk3 Ligand Binding Domain Complex With Kainate And Zinc: P2221 Form Length = 257 Back     alignment and structure
>pdb|3U92|A Chain A, Crystal Structure Of The Gluk3 Ligand Binding Domain Complex With Kainate And Zinc: P2221 Form Length = 257 Back     alignment and structure
>pdb|3S9E|A Chain A, Crystal Structure Of The Kainate Receptor Gluk3 Ligand Binding Domain In Complex With (S)-Glutamate Length = 258 Back     alignment and structure
>pdb|3S9E|A Chain A, Crystal Structure Of The Kainate Receptor Gluk3 Ligand Binding Domain In Complex With (S)-Glutamate Length = 258 Back     alignment and structure
>pdb|1YAE|A Chain A, Structure Of The Kainate Receptor Subunit Glur6 Agonist Binding Domain Complexed With Domoic Acid Length = 312 Back     alignment and structure
>pdb|1YAE|A Chain A, Structure Of The Kainate Receptor Subunit Glur6 Agonist Binding Domain Complexed With Domoic Acid Length = 312 Back     alignment and structure
>pdb|2F34|A Chain A, Crystal Structure Of The Glur5 Ligand Binding Core Dimer With Ubp310 At 1.74 Angstroms Resolution Length = 258 Back     alignment and structure
>pdb|2F34|A Chain A, Crystal Structure Of The Glur5 Ligand Binding Core Dimer With Ubp310 At 1.74 Angstroms Resolution Length = 258 Back     alignment and structure
>pdb|1TXF|A Chain A, Crystal Structure Of The Glur5 Ligand Binding Core In Complex With Glutamate At 2.1 Angstrom Resolution Length = 258 Back     alignment and structure
>pdb|1TXF|A Chain A, Crystal Structure Of The Glur5 Ligand Binding Core In Complex With Glutamate At 2.1 Angstrom Resolution Length = 258 Back     alignment and structure
>pdb|2WKY|A Chain A, Crystal Structure Of The Ligand-Binding Core Of Glur5 In Complex With The Agonist 4-Ahcp Length = 258 Back     alignment and structure
>pdb|2WKY|A Chain A, Crystal Structure Of The Ligand-Binding Core Of Glur5 In Complex With The Agonist 4-Ahcp Length = 258 Back     alignment and structure
>pdb|1YCJ|A Chain A, Crystal Structure Of The Kainate Receptor Glur5 Ligand- Binding Core In Complex With (S)-Glutamate Length = 257 Back     alignment and structure
>pdb|1YCJ|A Chain A, Crystal Structure Of The Kainate Receptor Glur5 Ligand- Binding Core In Complex With (S)-Glutamate Length = 257 Back     alignment and structure
>pdb|2ZNS|A Chain A, Crystal Structure Of The Ligand-Binding Core Of The Human Ionotropic Glutamate Receptor, Glur5, In Complex With Glutamate Length = 256 Back     alignment and structure
>pdb|2ZNS|A Chain A, Crystal Structure Of The Ligand-Binding Core Of The Human Ionotropic Glutamate Receptor, Glur5, In Complex With Glutamate Length = 256 Back     alignment and structure
>pdb|2I0C|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Core Dimer Crosslinked By Disulfide Bonds Between Y490c And L752c At 2.25 Angstroms Resolution Length = 259 Back     alignment and structure
>pdb|2I0C|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Core Dimer Crosslinked By Disulfide Bonds Between Y490c And L752c At 2.25 Angstroms Resolution Length = 259 Back     alignment and structure
>pdb|3QXM|A Chain A, Crystal Structure Of Human Gluk2 Ligand-Binding Core In Complex With Novel Marine-Derived Toxins, Neodysiherbaine A Length = 258 Back     alignment and structure
>pdb|3QXM|A Chain A, Crystal Structure Of Human Gluk2 Ligand-Binding Core In Complex With Novel Marine-Derived Toxins, Neodysiherbaine A Length = 258 Back     alignment and structure
>pdb|2XXW|A Chain A, Crystal Structure Of The Gluk2 (Glur6) D776k Lbd Dimer In Complex With Glutamate Length = 261 Back     alignment and structure
>pdb|2XXW|A Chain A, Crystal Structure Of The Gluk2 (Glur6) D776k Lbd Dimer In Complex With Glutamate Length = 261 Back     alignment and structure
>pdb|2XXU|A Chain A, Crystal Structure Of The Gluk2 (Glur6) M770k Lbd Dimer In Complex With Glutamate Length = 261 Back     alignment and structure
>pdb|2XXU|A Chain A, Crystal Structure Of The Gluk2 (Glur6) M770k Lbd Dimer In Complex With Glutamate Length = 261 Back     alignment and structure
>pdb|3G3H|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Domain Dimer K665r I749l Q753k Mutant With Glutamate And Nacl At 1.5 Angstrom Resolution Length = 259 Back     alignment and structure
>pdb|3G3H|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Domain Dimer K665r I749l Q753k Mutant With Glutamate And Nacl At 1.5 Angstrom Resolution Length = 259 Back     alignment and structure
>pdb|3G3G|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Domain Dimer K665r Mutant With Glutamate And Nacl At 1.3 Angstrom Resolution Length = 259 Back     alignment and structure
>pdb|3G3G|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Domain Dimer K665r Mutant With Glutamate And Nacl At 1.3 Angstrom Resolution Length = 259 Back     alignment and structure
>pdb|1S50|A Chain A, X-Ray Structure Of The Glur6 Ligand Binding Core (S1s2a) In Complex With Glutamate At 1.65 A Resolution Length = 259 Back     alignment and structure
>pdb|1S50|A Chain A, X-Ray Structure Of The Glur6 Ligand Binding Core (S1s2a) In Complex With Glutamate At 1.65 A Resolution Length = 259 Back     alignment and structure
>pdb|2XXR|A Chain A, Crystal Structure Of The Gluk2 (Glur6) Wild-Type Lbd Dimer In Complex With Glutamate Length = 261 Back     alignment and structure
>pdb|2XXR|A Chain A, Crystal Structure Of The Gluk2 (Glur6) Wild-Type Lbd Dimer In Complex With Glutamate Length = 261 Back     alignment and structure
>pdb|2I0B|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Core Elkq Mutant Dimer At 1.96 Angstroms Resolution Length = 259 Back     alignment and structure
>pdb|2I0B|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Core Elkq Mutant Dimer At 1.96 Angstroms Resolution Length = 259 Back     alignment and structure
>pdb|3G3K|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Domain Dimer I442h K494e K665r I749l Q753k E757q Mutant With Glutamate And Nacl At 1.24 Angstrom Resolution Length = 259 Back     alignment and structure
>pdb|3G3K|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Domain Dimer I442h K494e K665r I749l Q753k E757q Mutant With Glutamate And Nacl At 1.24 Angstrom Resolution Length = 259 Back     alignment and structure
>pdb|3G3I|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Domain Dimer I442h K494e I749l Q753k Mutant With Glutamate And Nacl At 1.37 Angstrom Resolution Length = 259 Back     alignment and structure
>pdb|3G3I|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Domain Dimer I442h K494e I749l Q753k Mutant With Glutamate And Nacl At 1.37 Angstrom Resolution Length = 259 Back     alignment and structure
>pdb|3G3J|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Domain Dimer I442h K494e K665r I749l Q753k Mutant With Glutamate And Nacl At 1.32 Angstrom Resolution Length = 259 Back     alignment and structure
>pdb|3G3J|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Domain Dimer I442h K494e K665r I749l Q753k Mutant With Glutamate And Nacl At 1.32 Angstrom Resolution Length = 259 Back     alignment and structure
>pdb|1GR2|A Chain A, Structure Of A Glutamate Receptor Ligand Binding Core (Glur2) Complexed With Kainate Length = 279 Back     alignment and structure
>pdb|1GR2|A Chain A, Structure Of A Glutamate Receptor Ligand Binding Core (Glur2) Complexed With Kainate Length = 279 Back     alignment and structure
>pdb|3EN3|A Chain A, Crystal Structure Of The Glur4 Ligand-Binding Domain In Complex With Kainate Length = 257 Back     alignment and structure
>pdb|3EN3|A Chain A, Crystal Structure Of The Glur4 Ligand-Binding Domain In Complex With Kainate Length = 257 Back     alignment and structure
>pdb|3KEI|A Chain A, Crystal Structure Of The Glua4 Ligand-Binding Domain L651v Mutant In Complex With Glutamate Length = 257 Back     alignment and structure
>pdb|3KEI|A Chain A, Crystal Structure Of The Glua4 Ligand-Binding Domain L651v Mutant In Complex With Glutamate Length = 257 Back     alignment and structure
>pdb|3FAT|A Chain A, X-Ray Structure Of Iglur4 Flip Ligand-Binding Core (S1s2) In Complex With (S)-Ampa At 1.90a Resolution Length = 260 Back     alignment and structure
>pdb|3FAT|A Chain A, X-Ray Structure Of Iglur4 Flip Ligand-Binding Core (S1s2) In Complex With (S)-Ampa At 1.90a Resolution Length = 260 Back     alignment and structure
>pdb|2GFE|A Chain A, Crystal Structure Of The Glur2 A476e S673d Ligand Binding Core Mutant At 1.54 Angstroms Resolution Length = 262 Back     alignment and structure
>pdb|2GFE|A Chain A, Crystal Structure Of The Glur2 A476e S673d Ligand Binding Core Mutant At 1.54 Angstroms Resolution Length = 262 Back     alignment and structure
>pdb|1MQH|A Chain A, Crystal Structure Of The Glur2 Ligand Binding Core (S1s2j) In Complex With Bromo-Willardiine At 1.8 Angstroms Resolution Length = 263 Back     alignment and structure
>pdb|1MQH|A Chain A, Crystal Structure Of The Glur2 Ligand Binding Core (S1s2j) In Complex With Bromo-Willardiine At 1.8 Angstroms Resolution Length = 263 Back     alignment and structure
>pdb|2XHD|A Chain A, Crystal Structure Of N-((2s)-5-(6-Fluoro-3-Pyridinyl)-2,3- Dihydro-1h-Inden-2-Yl)-2-Propanesulfonamide In Complex With The Ligand Binding Domain Of The Human Glua2 Receptor Length = 263 Back     alignment and structure
>pdb|2XHD|A Chain A, Crystal Structure Of N-((2s)-5-(6-Fluoro-3-Pyridinyl)-2,3- Dihydro-1h-Inden-2-Yl)-2-Propanesulfonamide In Complex With The Ligand Binding Domain Of The Human Glua2 Receptor Length = 263 Back     alignment and structure
>pdb|2I3V|A Chain A, Measurement Of Conformational Changes Accompanying Desensitization In An Ionotropic Glutamate Receptor: Structure Of G725c Mutant Length = 259 Back     alignment and structure
>pdb|2I3V|A Chain A, Measurement Of Conformational Changes Accompanying Desensitization In An Ionotropic Glutamate Receptor: Structure Of G725c Mutant Length = 259 Back     alignment and structure
>pdb|3O28|A Chain A, Ligand-Binding Domain Of Glua2 (Flip) Ionotropic Glutamate Receptor In Complex With An Allosteric Modulator Length = 263 Back     alignment and structure
>pdb|3O28|A Chain A, Ligand-Binding Domain Of Glua2 (Flip) Ionotropic Glutamate Receptor In Complex With An Allosteric Modulator Length = 263 Back     alignment and structure
>pdb|3O29|A Chain A, Ligand-Binding Domain Of Glua2 (Flip) Ionotropic Glutamate Receptor In Complex With An Allosteric Modulator Length = 263 Back     alignment and structure
>pdb|3O29|A Chain A, Ligand-Binding Domain Of Glua2 (Flip) Ionotropic Glutamate Receptor In Complex With An Allosteric Modulator Length = 263 Back     alignment and structure
>pdb|3IJO|B Chain B, Crystal Structure Of The Ampa Subunit Glur2 Bound To The Allosteric Modulator, Althiazide Length = 258 Back     alignment and structure
>pdb|3IJO|B Chain B, Crystal Structure Of The Ampa Subunit Glur2 Bound To The Allosteric Modulator, Althiazide Length = 258 Back     alignment and structure
>pdb|3T9X|B Chain B, Glutamate Bound To A Double Cysteine Mutant (V484cE657C) OF THE Ligand Binding Domain Of Glua2 Length = 258 Back     alignment and structure
>pdb|3T9X|B Chain B, Glutamate Bound To A Double Cysteine Mutant (V484cE657C) OF THE Ligand Binding Domain Of Glua2 Length = 258 Back     alignment and structure
>pdb|3H03|A Chain A, Crystal Structure Of The Binding Domain Of The Ampa Subunit Glur2 Bound To Ubp277 Length = 258 Back     alignment and structure
>pdb|3H03|A Chain A, Crystal Structure Of The Binding Domain Of The Ampa Subunit Glur2 Bound To Ubp277 Length = 258 Back     alignment and structure
>pdb|2I3W|A Chain A, Measurement Of Conformational Changes Accompanying Desensitization In An Ionotropic Glutamate Receptor: Structure Of S729c Mutant Length = 259 Back     alignment and structure
>pdb|2I3W|A Chain A, Measurement Of Conformational Changes Accompanying Desensitization In An Ionotropic Glutamate Receptor: Structure Of S729c Mutant Length = 259 Back     alignment and structure
>pdb|3RN8|A Chain A, Crystal Structure Of Iglur2 Ligand Binding Domain And Symmetrical Carboxyl Containing Potentiator Length = 280 Back     alignment and structure
>pdb|3RN8|A Chain A, Crystal Structure Of Iglur2 Ligand Binding Domain And Symmetrical Carboxyl Containing Potentiator Length = 280 Back     alignment and structure
>pdb|1LBC|A Chain A, Crystal Structure Of Glur2 Ligand Binding Core (S1s2j- N775s) In Complex With Cyclothiazide (Ctz) As Well As Glutamate At 1.8 A Resolution Length = 263 Back     alignment and structure
>pdb|1LBC|A Chain A, Crystal Structure Of Glur2 Ligand Binding Core (S1s2j- N775s) In Complex With Cyclothiazide (Ctz) As Well As Glutamate At 1.8 A Resolution Length = 263 Back     alignment and structure
>pdb|1MQD|A Chain A, X-Ray Structure Of The Glur2 Ligand-Binding Core (S1s2j) In Complex With (S)-Des-Me-Ampa At 1.46 A Resolution. Crystallization In The Presence Of Lithium Sulfate. Length = 261 Back     alignment and structure
>pdb|1MQD|A Chain A, X-Ray Structure Of The Glur2 Ligand-Binding Core (S1s2j) In Complex With (S)-Des-Me-Ampa At 1.46 A Resolution. Crystallization In The Presence Of Lithium Sulfate. Length = 261 Back     alignment and structure
>pdb|3PD8|A Chain A, X-Ray Structure Of The Ligand-Binding Core Of Glua2 In Complex With (S)-7-Hpca At 2.5 A Resolution Length = 261 Back     alignment and structure
>pdb|3PD8|A Chain A, X-Ray Structure Of The Ligand-Binding Core Of Glua2 In Complex With (S)-7-Hpca At 2.5 A Resolution Length = 261 Back     alignment and structure
>pdb|3DP6|A Chain A, Crystal Structure Of The Binding Domain Of The Ampa Subunit Glur2 Bound To Glutamate Length = 279 Back     alignment and structure
>pdb|3DP6|A Chain A, Crystal Structure Of The Binding Domain Of The Ampa Subunit Glur2 Bound To Glutamate Length = 279 Back     alignment and structure
>pdb|1LBB|A Chain A, Crystal Structure Of The Glur2 Ligand Binding Domain Mutant (s1s2j-n754d) In Complex With Kainate At 2.1 A Resolution Length = 263 Back     alignment and structure
>pdb|1LBB|A Chain A, Crystal Structure Of The Glur2 Ligand Binding Domain Mutant (s1s2j-n754d) In Complex With Kainate At 2.1 A Resolution Length = 263 Back     alignment and structure
>pdb|1P1N|A Chain A, Glur2 Ligand Binding Core (S1s2j) Mutant L650t In Complex With Kainate Length = 263 Back     alignment and structure
>pdb|1P1N|A Chain A, Glur2 Ligand Binding Core (S1s2j) Mutant L650t In Complex With Kainate Length = 263 Back     alignment and structure
>pdb|3R7X|A Chain A, Crystal Structure Analysis Of A Quinazolinedione Sulfonamide Bound To Human Glur2: A Novel Class Of Competitive Ampa Receptor Antagonists With Oral Activity Length = 263 Back     alignment and structure
>pdb|3R7X|A Chain A, Crystal Structure Analysis Of A Quinazolinedione Sulfonamide Bound To Human Glur2: A Novel Class Of Competitive Ampa Receptor Antagonists With Oral Activity Length = 263 Back     alignment and structure
>pdb|3B6T|A Chain A, Crystal Structure Of The Glur2 Ligand Binding Core (S1s2j) T686a Mutant In Complex With Quisqualate At 2.1 Resolution Length = 263 Back     alignment and structure
>pdb|3B6T|A Chain A, Crystal Structure Of The Glur2 Ligand Binding Core (S1s2j) T686a Mutant In Complex With Quisqualate At 2.1 Resolution Length = 263 Back     alignment and structure
>pdb|2UXA|A Chain A, Crystal Structure Of The Glur2-Flip Ligand Binding Domain, RG UNEDITED. Length = 261 Back     alignment and structure
>pdb|2UXA|A Chain A, Crystal Structure Of The Glur2-Flip Ligand Binding Domain, RG UNEDITED. Length = 261 Back     alignment and structure
>pdb|1FW0|A Chain A, Crystal Structure Of The Glur2 Ligand Binding Core (S1s2j) In Complex With Kainate At 2.0 A Resolution Length = 263 Back     alignment and structure
>pdb|1FW0|A Chain A, Crystal Structure Of The Glur2 Ligand Binding Core (S1s2j) In Complex With Kainate At 2.0 A Resolution Length = 263 Back     alignment and structure
>pdb|3PD9|A Chain A, X-Ray Structure Of The Ligand-Binding Core Of Glua2 In Complex With (R)-5-Hpca At 2.1 A Resolution Length = 260 Back     alignment and structure
>pdb|3PD9|A Chain A, X-Ray Structure Of The Ligand-Binding Core Of Glua2 In Complex With (R)-5-Hpca At 2.1 A Resolution Length = 260 Back     alignment and structure
>pdb|1M5D|A Chain A, X-ray Structure Of The Glur2 Ligand Binding Core (s1s2j- Y702f) In Complex With Br-hibo At 1.73 A Resolution Length = 263 Back     alignment and structure
>pdb|1M5D|A Chain A, X-ray Structure Of The Glur2 Ligand Binding Core (s1s2j- Y702f) In Complex With Br-hibo At 1.73 A Resolution Length = 263 Back     alignment and structure
>pdb|3B6W|C Chain C, Crystal Structure Of The Glur2 Ligand Binding Core (S1s2j) T686s Mutant In Complex With Glutamate At 1.7 Resolution Length = 263 Back     alignment and structure
>pdb|3B6W|C Chain C, Crystal Structure Of The Glur2 Ligand Binding Core (S1s2j) T686s Mutant In Complex With Glutamate At 1.7 Resolution Length = 263 Back     alignment and structure
>pdb|3RNN|A Chain A, Crystal Structure Of Iglur2 Ligand Binding Domain With Symmetric Sulfonamide Containing Potentiator Length = 292 Back     alignment and structure
>pdb|3RNN|A Chain A, Crystal Structure Of Iglur2 Ligand Binding Domain With Symmetric Sulfonamide Containing Potentiator Length = 292 Back     alignment and structure
>pdb|1P1W|A Chain A, Crystal Structure Of The Glur2 Ligand-Binding Core (S1s2j) With The L483y And L650t Mutations And In Complex With Ampa Length = 263 Back     alignment and structure
>pdb|1P1W|A Chain A, Crystal Structure Of The Glur2 Ligand-Binding Core (S1s2j) With The L483y And L650t Mutations And In Complex With Ampa Length = 263 Back     alignment and structure
>pdb|2XX7|A Chain A, Crystal Structure Of 1-(4-(1-Pyrrolidinylcarbonyl)phenyl)-3- (Trifluoromethyl)-4,5,6,7-Tetrahydro-1h-Indazole In Complex With The Ligand Binding Domain Of The Rat Glua2 Receptor And Glutamate At 2.2a Resolution. Length = 291 Back     alignment and structure
>pdb|2XX7|A Chain A, Crystal Structure Of 1-(4-(1-Pyrrolidinylcarbonyl)phenyl)-3- (Trifluoromethyl)-4,5,6,7-Tetrahydro-1h-Indazole In Complex With The Ligand Binding Domain Of The Rat Glua2 Receptor And Glutamate At 2.2a Resolution. Length = 291 Back     alignment and structure
>pdb|3TDJ|A Chain A, Crystal Structure Of The Glua2 Ligand-Binding Domain (S1s2j-L483y- N754s) In Complex With Glutamate And Bpam-97 At 1.95 A Resolution Length = 263 Back     alignment and structure
>pdb|3TDJ|A Chain A, Crystal Structure Of The Glua2 Ligand-Binding Domain (S1s2j-L483y- N754s) In Complex With Glutamate And Bpam-97 At 1.95 A Resolution Length = 263 Back     alignment and structure
>pdb|3T93|B Chain B, Glutamate Bound To A Double Cysteine Mutant (A452cS652C) OF THE Ligand Binding Domain Of Glua2 Length = 258 Back     alignment and structure
>pdb|3T93|B Chain B, Glutamate Bound To A Double Cysteine Mutant (A452cS652C) OF THE Ligand Binding Domain Of Glua2 Length = 258 Back     alignment and structure
>pdb|1LB8|A Chain A, Crystal Structure Of The Non-Desensitizing Glur2 Ligand Binding Core Mutant (S1s2j-L483y) In Complex With Ampa At 2.3 Resolution Length = 263 Back     alignment and structure
>pdb|1LB8|A Chain A, Crystal Structure Of The Non-Desensitizing Glur2 Ligand Binding Core Mutant (S1s2j-L483y) In Complex With Ampa At 2.3 Resolution Length = 263 Back     alignment and structure
>pdb|2ANJ|A Chain A, Crystal Structure Of The Glur2 Ligand Binding Core (S1s2j- Y450w) Mutant In Complex With The Partial Agonist Kainic Acid At 2.1 A Resolution Length = 263 Back     alignment and structure
>pdb|2ANJ|A Chain A, Crystal Structure Of The Glur2 Ligand Binding Core (S1s2j- Y450w) Mutant In Complex With The Partial Agonist Kainic Acid At 2.1 A Resolution Length = 263 Back     alignment and structure
>pdb|2RCA|B Chain B, Crystal Structure Of The Nr3b Ligand Binding Core Complex With Glycine At 1.58 Angstrom Resolution Length = 292 Back     alignment and structure
>pdb|4F22|A Chain A, Kainate Bound To The K660a Mutant Of The Ligand Binding Domain Of Glua3 Length = 258 Back     alignment and structure
>pdb|4F22|A Chain A, Kainate Bound To The K660a Mutant Of The Ligand Binding Domain Of Glua3 Length = 258 Back     alignment and structure
>pdb|3LSW|A Chain A, Aniracetam Bound To The Ligand Binding Domain Of Glua3 Length = 258 Back     alignment and structure
>pdb|3LSW|A Chain A, Aniracetam Bound To The Ligand Binding Domain Of Glua3 Length = 258 Back     alignment and structure
>pdb|4F2O|A Chain A, Quisqualate Bound To The D655a Mutant Of The Ligand Binding Domain Of Glua3 Length = 258 Back     alignment and structure
>pdb|4F2O|A Chain A, Quisqualate Bound To The D655a Mutant Of The Ligand Binding Domain Of Glua3 Length = 258 Back     alignment and structure
>pdb|3DP4|A Chain A, Crystal Structure Of The Binding Domain Of The Ampa Subunit Glur3 Bound To Ampa Length = 278 Back     alignment and structure
>pdb|3DP4|A Chain A, Crystal Structure Of The Binding Domain Of The Ampa Subunit Glur3 Bound To Ampa Length = 278 Back     alignment and structure
>pdb|3M3F|A Chain A, Pepa Bound To The Ligand Binding Domain Of Glua3 (Flop Form) Length = 258 Back     alignment and structure
>pdb|3M3F|A Chain A, Pepa Bound To The Ligand Binding Domain Of Glua3 (Flop Form) Length = 258 Back     alignment and structure
>pdb|3OEK|A Chain A, Crystal Structure Of Glun2d Ligand-Binding Core In Complex With L- Aspartate Length = 286 Back     alignment and structure
>pdb|2A5S|A Chain A, Crystal Structure Of The Nr2a Ligand Binding Core In Complex With Glutamate Length = 284 Back     alignment and structure
>pdb|2RC7|A Chain A, Crystal Structure Of The Nr3a Ligand Binding Core Complex With Glycine At 1.58 Angstrom Resolution Length = 294 Back     alignment and structure
>pdb|1PB8|A Chain A, Crystal Structure Of The Nr1 Ligand Binding Core In Complex With D-Serine At 1.45 Angstroms Resolution Length = 292 Back     alignment and structure
>pdb|1PB7|A Chain A, Crystal Structure Of The Nr1 Ligand Binding Core In Complex With Glycine At 1.35 Angstroms Resolution Length = 292 Back     alignment and structure
>pdb|4IO2|A Chain A, Crystal Structure Of The Avglur1 Ligand Binding Domain Complex With Glutamate At 1.37 Angstrom Resolution Length = 248 Back     alignment and structure
>pdb|4F3P|A Chain A, Crystal Structure Of A Glutamine-Binding Periplasmic Protein From Burkholderia Pseudomallei In Complex With Glutamine Length = 249 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query444
3kg2_A823 Glutamate receptor 2; ION channel, membrane protei 2e-74
1yae_A312 Glutamate receptor, ionotropic kainate 2; kainate 4e-34
1yae_A312 Glutamate receptor, ionotropic kainate 2; kainate 2e-16
2v3u_A265 Glutamate receptor delta-2 subunit; postsynaptic m 3e-33
2v3u_A265 Glutamate receptor delta-2 subunit; postsynaptic m 3e-09
3g3k_A259 Glutamate receptor, ionotropic kainate 2; membrane 5e-32
3g3k_A259 Glutamate receptor, ionotropic kainate 2; membrane 1e-08
1mqi_A263 Glutamate receptor 2; GLUR2, ligand binding core, 1e-26
1mqi_A263 Glutamate receptor 2; GLUR2, ligand binding core, 2e-10
1pb7_A292 N-methyl-D-aspartate receptor subunit 1; ligand bi 8e-22
1pb7_A292 N-methyl-D-aspartate receptor subunit 1; ligand bi 9e-05
2a5s_A284 N-methyl-D-aspartate receptor nmdar2A subunit, NMD 2e-20
2rc8_A294 Glutamate [NMDA] receptor subunit 3A; membrane pro 3e-20
2pyy_A228 Ionotropic glutamate receptor bacterial homologue; 1e-12
4f3p_A249 Glutamine-binding periplasmic protein; ssgcid, str 2e-12
2pvu_A272 ARTJ; basic amino acid binding protein, ABC transp 3e-12
3k4u_A245 Binding component of ABC transporter; structural g 4e-12
1wdn_A226 GLNBP, glutamine binding protein; closed form, com 4e-12
3del_B242 Arginine binding protein; alpha and beta protein ( 4e-12
2iee_A271 ORF2, probable ABC transporter extracellular-bindi 6e-12
3kzg_A237 Arginine 3RD transport system periplasmic binding 1e-11
4dz1_A259 DALS D-alanine transporter; D-alanine binding, per 1e-11
1ii5_A233 SLR1257 protein; membrane protein; HET: GLU; 1.60A 1e-11
2y7i_A229 STM4351; arginine-binding protein; HET: ARG; 1.90A 2e-11
3h7m_A234 Sensor protein; histidine kinase sensor domain, ki 2e-11
3hv1_A268 Polar amino acid ABC uptake transporter substrate 4e-11
2o1m_A258 Probable amino-acid ABC transporter extracellular- 4e-11
3kbr_A239 Cyclohexadienyl dehydratase; pseudomonas aeruginos 4e-11
3qax_A268 Probable ABC transporter arginine-binding protein; 7e-11
3tql_A227 Arginine-binding protein; transport and binding pr 2e-10
3mpk_A267 Virulence sensor protein BVGS; venus flytrap, sens 4e-10
2q88_A257 EHUB, putative ABC transporter amino acid-binding 5e-10
2yln_A283 Putative ABC transporter, periplasmic binding Pro 5e-10
3i6v_A232 Periplasmic His/Glu/Gln/Arg/opine family-binding; 6e-10
1lst_A239 Lysine, arginine, ornithine-binding protein; amino 9e-10
1xwv_A129 DER F II; beta sheets, allergen; HET: PE3 XPE; 1.8 8e-09
4eq9_A246 ABC transporter substrate-binding protein-amino A 2e-08
2yjp_A291 Putative ABC transporter, periplasmic binding Pro 8e-08
1nep_A130 EPV20, BNPC2, epididymal secretory protein E1; nie 9e-07
1xt8_A292 Putative amino-acid transporter periplasmic solut 7e-06
2vha_A287 Periplasmic binding transport protein; periplasmic 1e-05
2v25_A259 Major cell-binding factor; antigen, adhesin, aspar 2e-04
>3kg2_A Glutamate receptor 2; ION channel, membrane protein, cell membrane, glycoprotein, transport, membrane, postsynaptic cell membrane, editing; HET: ZK1 NAG BMA; 3.60A {Rattus norvegicus} Length = 823 Back     alignment and structure
 Score =  248 bits (633), Expect = 2e-74
 Identities = 119/377 (31%), Positives = 178/377 (47%), Gaps = 57/377 (15%)

Query: 14  QEPFVMREESEG--GGGVKYKGYCIDLIEEIRKLVGFEYEIFVAPDNSFGNMD-ENGQWN 70
           + P+VM + +     G  +Y+GYC+DL  EI K  GF+Y++ +  D  +G  D +   WN
Sbjct: 393 ESPYVMMKANHAALAGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKIWN 452

Query: 71  GMIKELIEKRADIALGSLSVMAERENVVDFTVPYYDLVGITILMKKP-KTPTSLFKFLTV 129
           GM+ EL+  +ADIA+  L++   RE V+DF+ P+  L GI+I++KKP K+   +F FL  
Sbjct: 453 GMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSL-GISIMIKKPQKSKPGVFSFLDP 511

Query: 130 LETGVWLCILAAYCNLDGEQMKYLIQVNPPGDILPEVIRAIILMQNITDAGILFDDSF-- 187
           L   +W+CI+ AY       +  + + +P      E         + +       +S   
Sbjct: 512 LAYEIWMCIVFAYI-GVSVVLFLVSRFSPYEWHTEEFEDGRETQSSESTNEFGIFNSLWF 570

Query: 188 --------SGGEAPKNLSGRLVAATWWLFGFIIIASYTANLAAFLTVSRLDTPIESLDDL 239
                       +P++LSGR+V   WW F  III+SYTANLAAFLTV R+ +PIES +DL
Sbjct: 571 SLGAFMQQGADISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDL 630

Query: 240 SKQYKIQYAPLNGSAAMTYFQRMADIEGRFYEIWKDMSLNDSLSDVERAKLAVWDYPVSD 299
           SKQ +I Y  L+  +   +F+R                                      
Sbjct: 631 SKQTEIAYGTLDSGSTKEFFRRSKI----------------------------------A 656

Query: 300 KYTKMWQAMKEAK---LPNSLEEAVQRVRDSKSSSEGFGYLGDATDIRYLVM-TNCDLQM 355
            + KMW  M+ A+      +  E V RVR SK     + YL ++T   Y+     CD   
Sbjct: 657 VFDKMWTYMRSAEPSVFVRTTAEGVARVRKSK---GKYAYLLESTMNEYIEQRKPCDTMK 713

Query: 356 VGDEFSRKPYAIAVQQD 372
           VG     K Y IA  + 
Sbjct: 714 VGGNLDSKGYGIATPKG 730
>1yae_A Glutamate receptor, ionotropic kainate 2; kainate receptor, membrane protein; HET: NAG FUC DOQ; 3.11A {Rattus norvegicus} SCOP: c.94.1.1 Length = 312 Back     alignment and structure
>1yae_A Glutamate receptor, ionotropic kainate 2; kainate receptor, membrane protein; HET: NAG FUC DOQ; 3.11A {Rattus norvegicus} SCOP: c.94.1.1 Length = 312 Back     alignment and structure
>2v3u_A Glutamate receptor delta-2 subunit; postsynaptic membrane, ionotropic glutamate receptors, transmembrane, membrane protein; 1.74A {Rattus norvegicus} PDB: 2v3t_A Length = 265 Back     alignment and structure
>2v3u_A Glutamate receptor delta-2 subunit; postsynaptic membrane, ionotropic glutamate receptors, transmembrane, membrane protein; 1.74A {Rattus norvegicus} PDB: 2v3t_A Length = 265 Back     alignment and structure
>3g3k_A Glutamate receptor, ionotropic kainate 2; membrane protein, cell junction, cell membrane, glycoprotein, ION transport, ionic channel, membrane; HET: GLU IPA; 1.24A {Rattus norvegicus} PDB: 3g3j_A* 3g3i_A* 2i0b_A* 3g3h_A* 3g3g_A* 3g3f_A* 1s7y_A* 1s9t_A* 1sd3_A* 1tt1_A* 1s50_A* 2xxr_A* 2xxt_A* 2xxx_A* 2xxw_A* 2xxy_A* 2xxu_A* 2xxv_A* 3qxm_A* 2i0c_A* ... Length = 259 Back     alignment and structure
>3g3k_A Glutamate receptor, ionotropic kainate 2; membrane protein, cell junction, cell membrane, glycoprotein, ION transport, ionic channel, membrane; HET: GLU IPA; 1.24A {Rattus norvegicus} PDB: 3g3j_A* 3g3i_A* 2i0b_A* 3g3h_A* 3g3g_A* 3g3f_A* 1s7y_A* 1s9t_A* 1sd3_A* 1tt1_A* 1s50_A* 2xxr_A* 2xxt_A* 2xxx_A* 2xxw_A* 2xxy_A* 2xxu_A* 2xxv_A* 3qxm_A* 2i0c_A* ... Length = 259 Back     alignment and structure
>1mqi_A Glutamate receptor 2; GLUR2, ligand binding core, S1S2, partial agonist, WILLARDIINES, fluoro-WILLARDIINE, membrane protein; HET: FWD; 1.35A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 1ftj_A* 1ftl_A* 1fto_A 1fw0_A* 1m5b_A* 1ftm_A* 1m5c_A* 1mm6_A* 1mm7_A* 1mqg_A* 1m5e_A* 1mqj_A* 1ms7_A* 1mxu_A* 1mxv_A 1mxw_A 1mxx_A 1mxy_A 1mxz_A 1my0_A ... Length = 263 Back     alignment and structure
>1mqi_A Glutamate receptor 2; GLUR2, ligand binding core, S1S2, partial agonist, WILLARDIINES, fluoro-WILLARDIINE, membrane protein; HET: FWD; 1.35A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 1ftj_A* 1ftl_A* 1fto_A 1fw0_A* 1m5b_A* 1ftm_A* 1m5c_A* 1mm6_A* 1mm7_A* 1mqg_A* 1m5e_A* 1mqj_A* 1ms7_A* 1mxu_A* 1mxv_A 1mxw_A 1mxx_A 1mxy_A 1mxz_A 1my0_A ... Length = 263 Back     alignment and structure
>1pb7_A N-methyl-D-aspartate receptor subunit 1; ligand binding receptor, NR1, ligand binding protein; 1.35A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 1pbq_A* 1y1m_A 1y1z_A 1y20_A 2a5t_A* 1pb8_A 1pb9_A Length = 292 Back     alignment and structure
>1pb7_A N-methyl-D-aspartate receptor subunit 1; ligand binding receptor, NR1, ligand binding protein; 1.35A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 1pbq_A* 1y1m_A 1y1z_A 1y20_A 2a5t_A* 1pb8_A 1pb9_A Length = 292 Back     alignment and structure
>2a5s_A N-methyl-D-aspartate receptor nmdar2A subunit, NMDA receptor nmdar2A; protein-ligand complex, metal transport,membrane protein; HET: GLU; 1.70A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 2a5t_B* 3oen_A* 3oel_A* 3oem_A* 3oek_A* Length = 284 Back     alignment and structure
>2rc8_A Glutamate [NMDA] receptor subunit 3A; membrane protein, cell junction, glycoprotein, ION transport channel, magnesium; 1.45A {Rattus norvegicus} PDB: 2rc7_A 2rc9_A 2rca_A 2rcb_A Length = 294 Back     alignment and structure
>2pyy_A Ionotropic glutamate receptor bacterial homologue; GLUR0 ligand binding domain, transport protein; HET: GLU; 2.10A {Nostoc punctiforme} Length = 228 Back     alignment and structure
>4f3p_A Glutamine-binding periplasmic protein; ssgcid, structural genomics, GLUT seattle structural genomics center for infectious disease; 2.40A {Burkholderia pseudomallei} Length = 249 Back     alignment and structure
>2pvu_A ARTJ; basic amino acid binding protein, ABC transport system, THER bacterium, transport protein; HET: LYS; 1.79A {Geobacillus stearothermophilus} PDB: 2q2a_A* 2q2c_A* Length = 272 Back     alignment and structure
>3k4u_A Binding component of ABC transporter; structural genomics, protein structure INI NEW YORK structural genomix research consortium, nysgxrc; HET: LYS; 2.62A {Wolinella succinogenes} Length = 245 Back     alignment and structure
>1wdn_A GLNBP, glutamine binding protein; closed form, complex, peptide, complex (binding protein/peptide); 1.94A {Escherichia coli} SCOP: c.94.1.1 PDB: 1ggg_A Length = 226 Back     alignment and structure
>3del_B Arginine binding protein; alpha and beta protein (A/B), periplasmic protein, arginine protein binding, transport protein; 1.92A {Chlamydia trachomatis} Length = 242 Back     alignment and structure
>2iee_A ORF2, probable ABC transporter extracellular-binding protein YCKB; SR574, NESG, X-RAY, structural genomics, PSI-2; 2.20A {Bacillus subtilis} Length = 271 Back     alignment and structure
>3kzg_A Arginine 3RD transport system periplasmic binding protein; arginine transport system, protein structure initiative II(PSI II); 2.06A {Legionella pneumophila subsp} Length = 237 Back     alignment and structure
>4dz1_A DALS D-alanine transporter; D-alanine binding, periplasmic, transport protein; 1.90A {Salmonella enterica} PDB: 3r39_A 4f3s_A Length = 259 Back     alignment and structure
>1ii5_A SLR1257 protein; membrane protein; HET: GLU; 1.60A {Synechocystis SP} SCOP: c.94.1.1 PDB: 1iit_A 1iiw_A Length = 233 Back     alignment and structure
>2y7i_A STM4351; arginine-binding protein; HET: ARG; 1.90A {Salmonella enterica subsp} Length = 229 Back     alignment and structure
>3h7m_A Sensor protein; histidine kinase sensor domain, kinase, phosphoprotein, transferase; 2.40A {Geobacter sulfurreducens} Length = 234 Back     alignment and structure
>3hv1_A Polar amino acid ABC uptake transporter substrate binding protein; protein structure initiative II(PSI II), nysgxrc; 1.90A {Streptococcus thermophilus lmg 18311} Length = 268 Back     alignment and structure
>2o1m_A Probable amino-acid ABC transporter extracellular-binding protein YTMK; NESG X-RAY O34852 YTMK_bacsu, structural genomics, PSI-2; 2.00A {Bacillus subtilis} Length = 258 Back     alignment and structure
>3kbr_A Cyclohexadienyl dehydratase; pseudomonas aeruginos structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Pseudomonas aeruginosa} Length = 239 Back     alignment and structure
>3qax_A Probable ABC transporter arginine-binding protein; periplasmic, transport PR; HET: ARG; 2.00A {Chlamydophila pneumoniae} PDB: 3g41_A* 3n26_A* Length = 268 Back     alignment and structure
>3tql_A Arginine-binding protein; transport and binding proteins, transport protein; HET: MSE ARG; 1.59A {Coxiella burnetii} Length = 227 Back     alignment and structure
>3mpk_A Virulence sensor protein BVGS; venus flytrap, sensor domain, signaling protein; 2.04A {Bordetella pertussis} PDB: 3mpl_A Length = 267 Back     alignment and structure
>2q88_A EHUB, putative ABC transporter amino acid-binding prote; substrate-binding protein, compatible solues, ABC-transporte osmoprotection; HET: 4CS; 1.90A {Sinorhizobium meliloti} PDB: 2q89_A* Length = 257 Back     alignment and structure
>2yln_A Putative ABC transporter, periplasmic binding Pro amino acid; transport protein, solute-BIND protein; HET: CYS GOL; 1.12A {Neisseria gonorrhoeae} PDB: 3zsf_A Length = 283 Back     alignment and structure
>3i6v_A Periplasmic His/Glu/Gln/Arg/opine family-binding; structural genomics, transporter, PSI-2, protein structure initiative; HET: LYS; 2.00A {Silicibacter pomeroyi} Length = 232 Back     alignment and structure
>1lst_A Lysine, arginine, ornithine-binding protein; amino-acid binding protein; HET: LYS; 1.80A {Salmonella typhimurium} SCOP: c.94.1.1 PDB: 2lao_A 1lag_E* 1lah_E 1laf_E 1hsl_A* 1hpb_P* Length = 239 Back     alignment and structure
>1xwv_A DER F II; beta sheets, allergen; HET: PE3 XPE; 1.83A {Dermatophagoides farinae} SCOP: b.1.18.7 PDB: 1ahk_A 1ahm_A 1wrf_A 2f08_A* 1a9v_A 1ktj_A Length = 129 Back     alignment and structure
>4eq9_A ABC transporter substrate-binding protein-amino A transport; structural genomics, niaid; HET: GSH; 1.40A {Streptococcus pneumoniae} Length = 246 Back     alignment and structure
>2yjp_A Putative ABC transporter, periplasmic binding Pro amino acid; transport protein, solute-binding protein; 2.26A {Neisseria gonorrhoeae} Length = 291 Back     alignment and structure
>1nep_A EPV20, BNPC2, epididymal secretory protein E1; niemann-PICK C2, LDL, cholesterol, lipid bindin; HET: NAG; 1.70A {Bos taurus} SCOP: b.1.18.7 PDB: 2hka_A* Length = 130 Back     alignment and structure
>1xt8_A Putative amino-acid transporter periplasmic solut protein; ABC transport, cysteine uptake; 2.00A {Campylobacter jejuni} SCOP: c.94.1.1 Length = 292 Back     alignment and structure
>2vha_A Periplasmic binding transport protein; periplasmic binding protein, ligand binding, ultrahigh resolution; HET: GLU; 1.00A {Shigella flexneri} PDB: 2ia4_A* Length = 287 Back     alignment and structure
>2v25_A Major cell-binding factor; antigen, adhesin, aspartate, glutamate, transport, ABC transport, virulence factor, receptor; 1.49A {Campylobacter jejuni} Length = 259 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query444
3kg2_A823 Glutamate receptor 2; ION channel, membrane protei 100.0
1yae_A312 Glutamate receptor, ionotropic kainate 2; kainate 99.97
3g3k_A259 Glutamate receptor, ionotropic kainate 2; membrane 99.96
1pb7_A292 N-methyl-D-aspartate receptor subunit 1; ligand bi 99.95
2rc8_A294 Glutamate [NMDA] receptor subunit 3A; membrane pro 99.95
2a5s_A284 N-methyl-D-aspartate receptor nmdar2A subunit, NMD 99.94
2v3u_A265 Glutamate receptor delta-2 subunit; postsynaptic m 99.94
1mqi_A263 Glutamate receptor 2; GLUR2, ligand binding core, 99.94
4gvo_A243 LMO2349 protein; structural genomics, IDP05245, L- 99.89
4h5g_A243 Amino acid ABC superfamily ATP binding cassette tr 99.89
3k4u_A245 Binding component of ABC transporter; structural g 99.88
3i6v_A232 Periplasmic His/Glu/Gln/Arg/opine family-binding; 99.87
3kzg_A237 Arginine 3RD transport system periplasmic binding 99.86
4f3p_A249 Glutamine-binding periplasmic protein; ssgcid, str 99.86
3hv1_A268 Polar amino acid ABC uptake transporter substrate 99.86
1ii5_A233 SLR1257 protein; membrane protein; HET: GLU; 1.60A 99.86
3del_B242 Arginine binding protein; alpha and beta protein ( 99.85
3kbr_A239 Cyclohexadienyl dehydratase; pseudomonas aeruginos 99.85
4eq9_A246 ABC transporter substrate-binding protein-amino A 99.83
3tql_A227 Arginine-binding protein; transport and binding pr 99.83
1wdn_A226 GLNBP, glutamine binding protein; closed form, com 99.83
2pyy_A228 Ionotropic glutamate receptor bacterial homologue; 99.83
2y7i_A229 STM4351; arginine-binding protein; HET: ARG; 1.90A 99.82
1lst_A239 Lysine, arginine, ornithine-binding protein; amino 99.82
3h7m_A234 Sensor protein; histidine kinase sensor domain, ki 99.82
3mpk_A267 Virulence sensor protein BVGS; venus flytrap, sens 99.82
4dz1_A259 DALS D-alanine transporter; D-alanine binding, per 99.82
2q88_A257 EHUB, putative ABC transporter amino acid-binding 99.81
2iee_A271 ORF2, probable ABC transporter extracellular-bindi 99.8
3qax_A268 Probable ABC transporter arginine-binding protein; 99.79
4i62_A269 Amino acid ABC transporter, periplasmic amino ACI 99.78
2pvu_A272 ARTJ; basic amino acid binding protein, ABC transp 99.77
2yln_A283 Putative ABC transporter, periplasmic binding Pro 99.77
2vha_A287 Periplasmic binding transport protein; periplasmic 99.77
1xt8_A292 Putative amino-acid transporter periplasmic solut 99.77
2yjp_A291 Putative ABC transporter, periplasmic binding Pro 99.76
2v25_A259 Major cell-binding factor; antigen, adhesin, aspar 99.65
2ozz_A231 Hypothetical protein YHFZ; alpha-beta structure, s 98.23
3n5l_A310 Binding protein component of ABC phosphonate TRAN; 98.03
3p7i_A321 PHND, subunit of alkylphosphonate ABC transporter; 97.91
3uif_A348 Sulfonate ABC transporter, periplasmic sulfonate- 96.84
2x26_A308 Periplasmic aliphatic sulphonates-binding protein; 96.77
3qsl_A346 Putative exported protein; unknown, structural gen 96.41
3ksx_A324 Nitrate transport protein; SSUA, alkanesulfonate-b 96.29
2dvz_A314 BUGE, putative exported protein; periplamsic bindi 96.11
2qpq_A301 Protein BUG27; alpha/beta domain, venus flytrap, t 95.82
2k1e_A103 Water soluble analogue of potassium channel, KCSA; 95.66
2f5x_A312 BUGD; periplasmic binding protein, transport prote 95.61
3eff_K139 Voltage-gated potassium channel; FULL length KCSA, 95.27
2ih3_C122 Voltage-gated potassium channel; ION channel D-ami 95.25
4h33_A137 LMO2059 protein; bilayers, KVLM, lipidic cubic pha 95.17
3un6_A341 Hypothetical protein saouhsc_00137; structural gen 94.99
2a9h_A155 Voltage-gated potassium channel; potassium channel 94.97
3jv9_A219 OXYR, transcriptional regulator, LYSR family; LYSR 94.68
4ab5_A222 Transcriptional regulator, LYSR family; transcript 94.49
3ix1_A302 N-formyl-4-amino-5-aminomethyl-2-methylpyrimidine 94.02
3ho7_A232 OXYR; beta-alpha-barrels, DNA-binding, transcripti 93.37
3ouf_A97 Potassium channel protein; ION channel, membrane, 92.41
3oxn_A241 Putative transcriptional regulator, LYSR family; s 91.57
3ldc_A82 Calcium-gated potassium channel MTHK; transmembran 91.37
3pjs_K166 KCSA, voltage-gated potassium channel; ION channel 91.19
1p7b_A333 Integral membrane channel and cytosolic domains; t 91.18
2x7q_A321 Ca3427, possible thiamine biosynthesis enzyme; unk 91.18
4ddd_A327 Immunogenic protein; ssgcid, structural genomics, 90.85
2q67_A114 Potassium channel protein; inverted teepee, helix 90.61
3fzv_A306 Probable transcriptional regulator; LYSR, structur 90.55
1orq_C223 Potassium channel; voltage-dependent, KVAP, FAB co 89.92
3vou_A148 ION transport 2 domain protein, voltage-gated SOD 88.8
2y7p_A218 LYSR-type regulatory protein; transcription regula 88.65
2fyi_A228 HTH-type transcriptional regulator CBL; Lys-R fami 88.29
1xl4_A301 Inward rectifier potassium channel; integral membr 88.28
2qks_A321 KIR3.1-prokaryotic KIR channel chimera; G-protein 87.21
1i6a_A219 OXYR, hydrogen peroxide-inducible genes activator; 86.58
2ql3_A209 Probable transcriptional regulator, LYSR family P; 86.03
1al3_A324 Cys regulon transcriptional activator CYSB; LYSR f 85.55
2esn_A310 Probable transcriptional regulator; PA0477, APC582 85.52
2hxr_A238 HTH-type transcriptional regulator CYNR; CYNR tran 85.12
3fxq_A305 LYSR type regulator of TSAMBCD; transcriptional re 83.81
3beh_A355 MLL3241 protein; transmembrane protein, membrane p 82.36
1us5_A314 Putative GLUR0 ligand binding core; receptor, memb 81.33
1uth_A315 LYSR-type regulatory protein; transcription regula 80.79
2h98_A313 HTH-type transcriptional regulator CATM; BENM, LTT 80.62
1nep_A130 EPV20, BNPC2, epididymal secretory protein E1; nie 80.47
2h9b_A312 HTH-type transcriptional regulator BENM; LTTR, tra 80.24
>3kg2_A Glutamate receptor 2; ION channel, membrane protein, cell membrane, glycoprotein, transport, membrane, postsynaptic cell membrane, editing; HET: ZK1 NAG BMA; 3.60A {Rattus norvegicus} Back     alignment and structure
Probab=100.00  E-value=3.4e-48  Score=425.36  Aligned_cols=361  Identities=33%  Similarity=0.592  Sum_probs=302.1

Q ss_pred             eeeeEEEeccCCCeEEEecCC--CCCceeeeecHHHHHHHHHHHcCCeEEEEEcCCCCCcccc-CCCccchhHHHHhccc
Q psy12229          4 ITNISDSRLKQEPFVMREESE--GGGGVKYKGYCIDLIEEIRKLVGFEYEIFVAPDNSFGNMD-ENGQWNGMIKELIEKR   80 (444)
Q Consensus         4 ~~~l~V~~~~~~Pf~~~~~~~--~~~~~~~~G~~~dil~~la~~lnft~~~~~~~~~~~g~~~-~ng~~~g~i~~l~~g~   80 (444)
                      -++|+|++...|||.+...+.  .++..++.|+++|+++++|+++|++++++..++++||... .||+|+|++++|.+|+
T Consensus       383 ~~~l~v~~~~~~P~~~~~~~~~~~~~~~~~~G~~~dl~~~~a~~l~~~~~~~~~~~~~~g~~~~~~g~~~~~~~~l~~~~  462 (823)
T 3kg2_A          383 QKTVVVTTILESPYVMMKANHAALAGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVYGK  462 (823)
T ss_dssp             CCCEEEEECCCTTTSEECTTGGGCCGGGGEESHHHHHHHHHHHHHTCCEEEEECSSCCCCCBCTTTCCBCHHHHHHHTTS
T ss_pred             CCEEEEEEecCCCcEEEecCccccCCCCceEEEHHHHHHHHHHHcCCcEEEEEccCCcccccCCCCCchhhHHHhhcccc
Confidence            357899999999999985321  2344589999999999999999999999999999999864 5789999999999999


Q ss_pred             ccEEeecccccccccccccccccceecccEEEEEeCCC-CCCcccccccccchhHHHHHHHHHHHHh------cceeccc
Q psy12229         81 ADIALGSLSVMAERENVVDFTVPYYDLVGITILMKKPK-TPTSLFKFLTVLETGVWLCILAAYCNLD------GEQMKYL  153 (444)
Q Consensus        81 ~Di~~~~~~~t~~r~~~~dfS~p~~~~~~~~ilvp~~~-~~~~~~~~l~pF~~~vWi~i~~~~~~~~------~~~~~~~  153 (444)
                      +|+++++++++.+|.+.+|||.||+. +++++++|++. ..++++.|++||++.+|+++++++++++      .++.+++
T Consensus       463 ~D~~~~~~~~t~~R~~~~dfs~py~~-~~~~~~v~~~~~~~~~~~~fl~Pf~~~vW~~i~~~~~~~~~~l~~~~~~~p~~  541 (823)
T 3kg2_A          463 ADIAIAPLTITLVREEVIDFSKPFMS-LGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYE  541 (823)
T ss_dssp             CSEECSCCBCCHHHHTTEEECSCSEE-ECEEEEEECCCCCCCCGGGTTTTSCHHHHHHHHHHHHHHHTTGGGTC------
T ss_pred             CcEEecceecchhheeeEEeccchhh-CCEEEEEECCCcccccchHhhcCCchhHHHHHHHHHHHHHHHHHHHHhcChhh
Confidence            99999999999999999999999999 99999999986 4578999999999999999999988877      2334444


Q ss_pred             cccCCCCCC--------C---cccchhhhhhhHhHhcccccccCCCCCCCCCChhhHHHHHHHHHHHHHHHHHhhhcchh
Q psy12229        154 IQVNPPGDI--------L---PEVIRAIILMQNITDAGILFDDSFSGGEAPKNLSGRLVAATWWLFGFIIIASYTANLAA  222 (444)
Q Consensus       154 ~~~~~~~~~--------~---~~~~~~~~~~~~l~~~g~~~~~~~~~~~~p~~~s~Rl~~~~w~l~~lvl~~~Y~a~L~s  222 (444)
                      |+..+....        .   ....++|+.+++++.||        ....|++.++|+++++||+++++++++|+|+|+|
T Consensus       542 w~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~g--------~~~~p~~~~~R~~~~~w~~~~lil~~~Yta~L~s  613 (823)
T 3kg2_A          542 WHTEEFEDGRETQSSESTNEFGIFNSLWFSLGAFMQQG--------ADISPRSLSGRIVGGVWWFFTLIIISSYTANLAA  613 (823)
T ss_dssp             -----------------CHHHHHHHHHHHTTTTSCC--------------CCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             ccCcccccccccccccccccccHHHHHHHHHHHHHhcC--------CCcCCcchhhhhHHHHHHHHHHHHHHHHHHHHHH
Confidence            443221110        0   12367889999999999        8899999999999999999999999999999999


Q ss_pred             hhhcccCCCCCCChHHhhhCCceeeEecCCChhhHHhhhhhhhhhHHHHHHhhhccCCCCcHHHHhhhhcccCCcchhHH
Q psy12229        223 FLTVSRLDTPIESLDDLSKQYKIQYAPLNGSAAMTYFQRMADIEGRFYEIWKDMSLNDSLSDVERAKLAVWDYPVSDKYT  302 (444)
Q Consensus       223 ~Lt~~~~~~~I~sl~dL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~y~  302 (444)
                      +||++++.++|+|++||.+++++++++..++...++|+++..                                  ..|+
T Consensus       614 ~Lt~~~~~~~I~s~~dL~~~~~i~~~~~~~~~~~~~~~~~~~----------------------------------~~~~  659 (823)
T 3kg2_A          614 FLTVERMVSPIESAEDLSKQTEIAYGTLDSGSTKEFFRRSKI----------------------------------AVFD  659 (823)
T ss_dssp             HHHHHHHCCCCCSSHHHHHCCSSEEECBSSSHHHHHHHHCCC----------------------------------HHHH
T ss_pred             HhcccccCCCCCCHHHHhhCCCeeEEEEeCCcHHHHHHhccc----------------------------------hHHH
Confidence            999999999999999999987889999988889999887531                                  6678


Q ss_pred             HHHHHHHhcC---CCCCHHHHHHHHHhcCCCCCceEEEecccchhhhhcCC-CccEEeCCcccccceEEEecCCCchhhh
Q psy12229        303 KMWQAMKEAK---LPNSLEEAVQRVRDSKSSSEGFGYLGDATDIRYLVMTN-CDLQMVGDEFSRKPYAIAVQQDRDAREL  378 (444)
Q Consensus       303 ~~~~~~~~~~---~~~~~~e~~~~v~~~~~~~~~~a~i~d~~~~~y~~~~~-c~l~~~~~~~~~~~~~~~~~k~sp~~~~  378 (444)
                      +++..+++..   ++.+.+|+++++++.+   +.+|++.+...+.|..+++ |+++.+++.+...++++++||||||++.
T Consensus       660 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~A~~~~~~~~~y~~~~~~c~l~~v~~~~~~~~~~~~~~k~spl~~~  736 (823)
T 3kg2_A          660 KMWTYMRSAEPSVFVRTTAEGVARVRKSK---GKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLGTP  736 (823)
T ss_dssp             HHHHHHHHCSSCCCBSSHHHHHHHHHTTT---TSEEEEEEHHHHHHHHTSTTCCEEEESCCSSCEEECCEEETTCSSHHH
T ss_pred             HHHHHHHhcCCccccCCHHHHHHHHhccC---CceEEEechHHHHHHHhcCCCceEEccccccccceeEeecCCChHHHH
Confidence            8888888754   5679999999997322   3899999999999988765 9999999999999999999999999999


Q ss_pred             hHHHHHHHhcCCccccCCCCCcccccccccCCCCcccCCCCC
Q psy12229        379 FCNVHANILSIPFPFIGVDGTSVCSSIFDTDGKTKVSCPLKK  420 (444)
Q Consensus       379 in~~il~l~e~G~i~~~~~~~~~~~~kw~~~~~~~~~c~~~~  420 (444)
                      ||++|++|+|+|++++|       .++|+.+.   ..|....
T Consensus       737 ~~~~il~l~e~G~~~~~-------~~~w~~~~---~~c~~~~  768 (823)
T 3kg2_A          737 VNLAVLKLSEQGLLDKL-------KNKWWYDK---GECGAKD  768 (823)
T ss_dssp             HHHHHHHHHHTTHHHHH-------HHHHHTTS---CSCSSTT
T ss_pred             HHHHHHHHHhCCcHHHH-------HHhhCcCC---CCCCCCC
Confidence            99999999999999999       99999864   4787653
>1yae_A Glutamate receptor, ionotropic kainate 2; kainate receptor, membrane protein; HET: NAG FUC DOQ; 3.11A {Rattus norvegicus} SCOP: c.94.1.1 Back     alignment and structure
>3g3k_A Glutamate receptor, ionotropic kainate 2; membrane protein, cell junction, cell membrane, glycoprotein, ION transport, ionic channel, membrane; HET: GLU IPA; 1.24A {Rattus norvegicus} PDB: 3g3j_A* 3g3i_A* 2i0b_A* 3g3h_A* 3g3g_A* 3g3f_A* 1s7y_A* 1s9t_A* 1sd3_A* 1tt1_A* 1s50_A* 2xxr_A* 2xxt_A* 2xxx_A* 2xxw_A* 2xxy_A* 2xxu_A* 2xxv_A* 3qxm_A* 2i0c_A* ... Back     alignment and structure
>1pb7_A N-methyl-D-aspartate receptor subunit 1; ligand binding receptor, NR1, ligand binding protein; 1.35A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 1pbq_A* 1y1m_A 1y1z_A 1y20_A 2a5t_A* 1pb8_A 1pb9_A Back     alignment and structure
>2rc8_A Glutamate [NMDA] receptor subunit 3A; membrane protein, cell junction, glycoprotein, ION transport channel, magnesium; 1.45A {Rattus norvegicus} PDB: 2rc7_A 2rc9_A 2rca_A 2rcb_A Back     alignment and structure
>2a5s_A N-methyl-D-aspartate receptor nmdar2A subunit, NMDA receptor nmdar2A; protein-ligand complex, metal transport,membrane protein; HET: GLU; 1.70A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 2a5t_B* 3oen_A* 3oel_A* 3oem_A* 3oek_A* Back     alignment and structure
>2v3u_A Glutamate receptor delta-2 subunit; postsynaptic membrane, ionotropic glutamate receptors, transmembrane, membrane protein; 1.74A {Rattus norvegicus} PDB: 2v3t_A Back     alignment and structure
>1mqi_A Glutamate receptor 2; GLUR2, ligand binding core, S1S2, partial agonist, WILLARDIINES, fluoro-WILLARDIINE, membrane protein; HET: FWD; 1.35A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 1ftj_A* 1ftl_A* 1fto_A 1fw0_A* 1m5b_A* 1ftm_A* 1m5c_A* 1mm6_A* 1mm7_A* 1mqg_A* 1m5e_A* 1mqj_A* 1ms7_A* 1mxu_A* 1mxv_A 1mxw_A 1mxx_A 1mxy_A 1mxz_A 1my0_A ... Back     alignment and structure
>4gvo_A LMO2349 protein; structural genomics, IDP05245, L-cystine, ABC transporter, periplasmic binding protein, niaid; HET: HIS; 1.45A {Listeria monocytogenes} PDB: 2o1m_A Back     alignment and structure
>4h5g_A Amino acid ABC superfamily ATP binding cassette transporter, binding protein; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases; HET: ARG; 1.78A {Streptococcus pneumoniae} PDB: 4h5f_A* Back     alignment and structure
>3k4u_A Binding component of ABC transporter; structural genomics, protein structure INI NEW YORK structural genomix research consortium, nysgxrc; HET: LYS; 2.62A {Wolinella succinogenes} SCOP: c.94.1.0 Back     alignment and structure
>3i6v_A Periplasmic His/Glu/Gln/Arg/opine family-binding; structural genomics, transporter, PSI-2, protein structure initiative; HET: LYS; 2.00A {Silicibacter pomeroyi} SCOP: c.94.1.0 Back     alignment and structure
>3kzg_A Arginine 3RD transport system periplasmic binding protein; arginine transport system, protein structure initiative II(PSI II); 2.06A {Legionella pneumophila subsp} SCOP: c.94.1.0 Back     alignment and structure
>4f3p_A Glutamine-binding periplasmic protein; ssgcid, structural genomics, GLUT seattle structural genomics center for infectious disease; 2.40A {Burkholderia pseudomallei} Back     alignment and structure
>3hv1_A Polar amino acid ABC uptake transporter substrate binding protein; protein structure initiative II(PSI II), nysgxrc; 1.90A {Streptococcus thermophilus lmg 18311} Back     alignment and structure
>1ii5_A SLR1257 protein; membrane protein; HET: GLU; 1.60A {Synechocystis SP} SCOP: c.94.1.1 PDB: 1iit_A 1iiw_A Back     alignment and structure
>3del_B Arginine binding protein; alpha and beta protein (A/B), periplasmic protein, arginine protein binding, transport protein; 1.92A {Chlamydia trachomatis} SCOP: c.94.1.0 Back     alignment and structure
>3kbr_A Cyclohexadienyl dehydratase; pseudomonas aeruginos structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Pseudomonas aeruginosa} Back     alignment and structure
>4eq9_A ABC transporter substrate-binding protein-amino A transport; structural genomics, niaid; HET: GSH; 1.40A {Streptococcus pneumoniae} Back     alignment and structure
>3tql_A Arginine-binding protein; transport and binding proteins, transport protein; HET: MSE ARG; 1.59A {Coxiella burnetii} SCOP: c.94.1.0 Back     alignment and structure
>1wdn_A GLNBP, glutamine binding protein; closed form, complex, peptide, complex (binding protein/peptide); 1.94A {Escherichia coli} SCOP: c.94.1.1 PDB: 1ggg_A Back     alignment and structure
>2pyy_A Ionotropic glutamate receptor bacterial homologue; GLUR0 ligand binding domain, transport protein; HET: GLU; 2.10A {Nostoc punctiforme} Back     alignment and structure
>2y7i_A STM4351; arginine-binding protein; HET: ARG; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>1lst_A Lysine, arginine, ornithine-binding protein; amino-acid binding protein; HET: LYS; 1.80A {Salmonella typhimurium} SCOP: c.94.1.1 PDB: 2lao_A 1lag_E* 1lah_E 1laf_E 1hsl_A* 1hpb_P* Back     alignment and structure
>3h7m_A Sensor protein; histidine kinase sensor domain, kinase, phosphoprotein, transferase; 2.40A {Geobacter sulfurreducens} SCOP: c.94.1.0 Back     alignment and structure
>3mpk_A Virulence sensor protein BVGS; venus flytrap, sensor domain, signaling protein; 2.04A {Bordetella pertussis} PDB: 3mpl_A Back     alignment and structure
>4dz1_A DALS D-alanine transporter; D-alanine binding, periplasmic, transport protein; 1.90A {Salmonella enterica} PDB: 3r39_A 4f3s_A Back     alignment and structure
>2q88_A EHUB, putative ABC transporter amino acid-binding prote; substrate-binding protein, compatible solues, ABC-transporte osmoprotection; HET: 4CS; 1.90A {Sinorhizobium meliloti} PDB: 2q89_A* Back     alignment and structure
>2iee_A ORF2, probable ABC transporter extracellular-binding protein YCKB; SR574, NESG, X-RAY, structural genomics, PSI-2; 2.20A {Bacillus subtilis} Back     alignment and structure
>3qax_A Probable ABC transporter arginine-binding protein; periplasmic, transport PR; HET: ARG; 2.00A {Chlamydophila pneumoniae} PDB: 3g41_A* 3n26_A* Back     alignment and structure
>4i62_A Amino acid ABC transporter, periplasmic amino ACI protein, putative; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases (NIAI niaid; HET: ARG; 1.05A {Streptococcus pneumoniae} Back     alignment and structure
>2pvu_A ARTJ; basic amino acid binding protein, ABC transport system, THER bacterium, transport protein; HET: LYS; 1.79A {Geobacillus stearothermophilus} PDB: 2q2a_A* 2q2c_A* Back     alignment and structure
>2yln_A Putative ABC transporter, periplasmic binding Pro amino acid; transport protein, solute-BIND protein; HET: CYS GOL; 1.12A {Neisseria gonorrhoeae} PDB: 3zsf_A Back     alignment and structure
>2vha_A Periplasmic binding transport protein; periplasmic binding protein, ligand binding, ultrahigh resolution; HET: GLU; 1.00A {Shigella flexneri} PDB: 2ia4_A* Back     alignment and structure
>1xt8_A Putative amino-acid transporter periplasmic solut protein; ABC transport, cysteine uptake; 2.00A {Campylobacter jejuni} SCOP: c.94.1.1 Back     alignment and structure
>2yjp_A Putative ABC transporter, periplasmic binding Pro amino acid; transport protein, solute-binding protein; 2.26A {Neisseria gonorrhoeae} Back     alignment and structure
>2v25_A Major cell-binding factor; antigen, adhesin, aspartate, glutamate, transport, ABC transport, virulence factor, receptor; 1.49A {Campylobacter jejuni} Back     alignment and structure
>2ozz_A Hypothetical protein YHFZ; alpha-beta structure, structural genomics, PSI-2, protein structure initiative; 2.30A {Shigella flexneri 2A} SCOP: c.94.1.1 Back     alignment and structure
>3n5l_A Binding protein component of ABC phosphonate TRAN; structural genomics, joint center for structural genomics; HET: UNL; 1.97A {Pseudomonas aeruginosa} Back     alignment and structure
>3p7i_A PHND, subunit of alkylphosphonate ABC transporter; phosphonate binding protein, transport protein; 1.71A {Escherichia coli UTI89} PDB: 3qk6_A 3quj_A* 3s4u_A Back     alignment and structure
>3uif_A Sulfonate ABC transporter, periplasmic sulfonate- protein SSUA; structural genomics; 2.60A {Methylobacillus flagellatus} Back     alignment and structure
>2x26_A Periplasmic aliphatic sulphonates-binding protein; transport protein; 1.75A {Escherichia coli} Back     alignment and structure
>3qsl_A Putative exported protein; unknown, structural genomics, PSI-biology, midwest center FO structural genomics, MCSG, unknown function; HET: MSE CIT; 2.00A {Bordetella bronchiseptica} Back     alignment and structure
>3ksx_A Nitrate transport protein; SSUA, alkanesulfonate-binding protein, periplasmic-binding P transport protein; HET: MPO; 1.70A {Xanthomonas axonopodis PV} PDB: 3e4r_A* 3ksj_A* Back     alignment and structure
>2dvz_A BUGE, putative exported protein; periplamsic binding proteins, carboxylate binding, glutamate, transport protein; HET: GLU; 2.30A {Bordetella pertussis} Back     alignment and structure
>2qpq_A Protein BUG27; alpha/beta domain, venus flytrap, transport protein; HET: CIT; 1.92A {Bordetella pertussis} Back     alignment and structure
>2k1e_A Water soluble analogue of potassium channel, KCSA; homotetramer, ION transport, ionic channel, membrane, transmembrane, transport; NMR {Escherichia coli} PDB: 2kb1_A Back     alignment and structure
>2f5x_A BUGD; periplasmic binding protein, transport protein; 1.72A {Bordetella pertussis tohama I} Back     alignment and structure
>3eff_K Voltage-gated potassium channel; FULL length KCSA, bulge helix, cell membrane, ION transport, ionic channel, membrane, transmembrane; 3.80A {Streptomyces lividans} Back     alignment and structure
>2ih3_C Voltage-gated potassium channel; ION channel D-amino acid semi-synthetic, membrane protein; HET: 1EM; 1.72A {Streptomyces lividans} PDB: 2ih1_C* 1r3j_C* 1k4d_C* 1r3i_C* 1k4c_C* 1r3k_C* 1r3l_C* 2bob_C* 2boc_C* 2hvj_C* 2hvk_C* 2itc_C 2itd_C 3gb7_C* 3iga_C* 1jvm_A 1s5h_C* 3ifx_A* 1j95_A 2jk5_C* ... Back     alignment and structure
>4h33_A LMO2059 protein; bilayers, KVLM, lipidic cubic phase (LCP), pore module, ION membrane protein; HET: OLC; 3.10A {Listeria monocytogenes} PDB: 4h37_A Back     alignment and structure
>3un6_A Hypothetical protein saouhsc_00137; structural genomics, center for structural genomics of infec diseases, csgid; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>2a9h_A Voltage-gated potassium channel; potassium channel, KCSA, structure, membrane protein, metal transport; HET: PCA; NMR {Streptomyces lividans} SCOP: f.14.1.1 Back     alignment and structure
>3jv9_A OXYR, transcriptional regulator, LYSR family; LYSR-type transcriptional regulator, LTTR, redox, structural genomics, OPPF; 2.39A {Neisseria meningitidis} Back     alignment and structure
>4ab5_A Transcriptional regulator, LYSR family; transcription factors; 2.51A {Neisseria meningitidis serogroup B} PDB: 4ab6_A Back     alignment and structure
>3ix1_A N-formyl-4-amino-5-aminomethyl-2-methylpyrimidine protein; periplasmic N-formyl-4-amino-5-aminomethyl-2-methylpyrimidin protein; HET: NFM; 2.40A {Bacillus halodurans c-125} Back     alignment and structure
>3ho7_A OXYR; beta-alpha-barrels, DNA-binding, transcription, transcriptio regulation; 1.58A {Porphyromonas gingivalis} Back     alignment and structure
>3ouf_A Potassium channel protein; ION channel, membrane, membrane protein; 1.55A {Bacillus cereus} PDB: 3t4z_A 3tcu_A 3t1c_A 3tet_A 3t4d_A 3t2m_A 3e86_A 3e83_A 3e89_A 3e8b_A 3e8f_A 3e8g_A 3e8h_A 3k0d_A 3k0g_A 3k06_A 3k08_A 3k04_A 3k03_A Back     alignment and structure
>3oxn_A Putative transcriptional regulator, LYSR family; structural genomics, PSI-2, protein structure initiative; 2.70A {Vibrio parahaemolyticus} Back     alignment and structure
>3ldc_A Calcium-gated potassium channel MTHK; transmembrane, ION channel, open conformation, IO transport; 1.45A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3lde_A 4hyo_A 4hz3_D 3r65_A 3ous_A 3ldd_A Back     alignment and structure
>3pjs_K KCSA, voltage-gated potassium channel; ION channel, conducts K+ IONS, cell membrane, transport PROT; 3.80A {Streptomyces lividans} PDB: 1f6g_A Back     alignment and structure
>1p7b_A Integral membrane channel and cytosolic domains; transmembrane helices, ION conduction, immunoglobulin fold, assembly; 3.65A {Burkholderia pseudomallei} SCOP: b.1.18.16 f.14.1.1 PDB: 2wll_B* 2wll_A* Back     alignment and structure
>2x7q_A Ca3427, possible thiamine biosynthesis enzyme; unknown function; 2.00A {Candida albicans} PDB: 2x7p_A Back     alignment and structure
>4ddd_A Immunogenic protein; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, immune system; 1.90A {Ehrlichia chaffeensis} Back     alignment and structure
>2q67_A Potassium channel protein; inverted teepee, helix bundle, tetramer, central cavity, ION metal transport, membrane protein; 2.30A {Bacillus cereus} PDB: 2q68_A 2q6a_A 2q69_A 2ahy_A 2ahz_A Back     alignment and structure
>3fzv_A Probable transcriptional regulator; LYSR, structural genomics, PSI-2, structure initiative; 2.71A {Pseudomonas aeruginosa PA01} Back     alignment and structure
>1orq_C Potassium channel; voltage-dependent, KVAP, FAB complex, MEM protein; 3.20A {Aeropyrum pernix} SCOP: f.14.1.1 PDB: 2a0l_A Back     alignment and structure
>3vou_A ION transport 2 domain protein, voltage-gated SOD channel; 4-helical bundle, ION channel, membrane, transport protein; 3.20A {Bacillus weihenstephanensis} Back     alignment and structure
>2y7p_A LYSR-type regulatory protein; transcription regulator, DNA-binding, transcription, transcr factor, transcription regulation; HET: SAL PEU; 1.85A {Burkholderia SP} PDB: 2y7k_A* 2y84_A 2y7w_A 2y7r_A Back     alignment and structure
>2fyi_A HTH-type transcriptional regulator CBL; Lys-R family, cofactor-binding DO cysteine biosynthesis; 2.80A {Escherichia coli K12} SCOP: c.94.1.1 Back     alignment and structure
>1xl4_A Inward rectifier potassium channel; integral membrane protein, ION channel, inwardly rectifying channel, metal transport; 2.60A {Magnetospirillum magnetotacticum} SCOP: b.1.18.16 f.14.1.1 PDB: 1xl6_A* 2wlh_A 2wli_B 2wlj_A* 2wlk_A* 2wlm_A 2wlo_A 2wln_A 3zrs_A 2wli_A 2x6c_A* 2x6b_A* 2x6a_A* Back     alignment and structure
>2qks_A KIR3.1-prokaryotic KIR channel chimera; G-protein gated inward rectifier, potassium channel selectivity filter, metal transport; HET: BNG; 2.20A {Burkholderia xenovorans} Back     alignment and structure
>1i6a_A OXYR, hydrogen peroxide-inducible genes activator; OXYR regulatory domain, oxidized form, transcription; 2.30A {Escherichia coli} SCOP: c.94.1.1 PDB: 1i69_A Back     alignment and structure
>2ql3_A Probable transcriptional regulator, LYSR family P; APC7314, rhodococcus RHA1, structural genomics, PSI-2; HET: MSE; 2.05A {Rhodococcus SP} Back     alignment and structure
>1al3_A Cys regulon transcriptional activator CYSB; LYSR family, cysteine biosynthesis, transcription regulation; 1.80A {Klebsiella aerogenes} SCOP: c.94.1.1 Back     alignment and structure
>2esn_A Probable transcriptional regulator; PA0477, APC5828,transcription, PSI, protein struc initiative, MCSG; 2.10A {Pseudomonas aeruginosa} SCOP: a.4.5.37 c.94.1.1 Back     alignment and structure
>2hxr_A HTH-type transcriptional regulator CYNR; CYNR transcriptional regulator LYSR struc genomics, PSI-2, protein structure initiative; 2.05A {Escherichia coli} PDB: 3hfu_A Back     alignment and structure
>3fxq_A LYSR type regulator of TSAMBCD; transcriptional regulator, LTTR, TSAR, WHTH, DNA- transcription, transcription regulation; 1.85A {Comamonas testosteroni} PDB: 3fxr_A* 3fxu_A* 3fzj_A 3n6t_A 3n6u_A* Back     alignment and structure
>3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* Back     alignment and structure
>1us5_A Putative GLUR0 ligand binding core; receptor, membrane protein, glutamate receptor, L-glutamate; HET: GLU; 1.5A {Thermus thermophilus} SCOP: c.94.1.1 PDB: 1us4_A* Back     alignment and structure
>1uth_A LYSR-type regulatory protein; transcription regulation, transcriptional regulator; 2.2A {Burkholderia SP} SCOP: c.94.1.1 PDB: 1utb_A 1utb_B 1uth_B 2uyf_A 2uye_A Back     alignment and structure
>2h98_A HTH-type transcriptional regulator CATM; BENM, LTTR; 1.80A {Acinetobacter SP} PDB: 2h9q_A* 2f7b_A 2f7c_A* 3glb_A* 3m1e_A Back     alignment and structure
>1nep_A EPV20, BNPC2, epididymal secretory protein E1; niemann-PICK C2, LDL, cholesterol, lipid bindin; HET: NAG; 1.70A {Bos taurus} SCOP: b.1.18.7 PDB: 2hka_A* Back     alignment and structure
>2h9b_A HTH-type transcriptional regulator BENM; LTTR, transcriptional activator, LYSR-type transcripti regulator; 1.80A {Acinetobacter SP} PDB: 2h99_A 3k1m_A 3k1n_A 3k1p_A 2f7a_A* 2f6p_A 2f78_A 2f6g_A* 2f8d_A 2f97_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 444
d2a5sa1277 c.94.1.1 (A:7-142,A:145-285) N-methyl-D-aspartate 2e-15
d1mqia_260 c.94.1.1 (A:) Glutamate receptor ligand binding co 4e-15
d1mqia_260 c.94.1.1 (A:) Glutamate receptor ligand binding co 0.003
d1pb7a_289 c.94.1.1 (A:) N-methyl-D-aspartate receptor subuni 6e-13
d1pb7a_289 c.94.1.1 (A:) N-methyl-D-aspartate receptor subuni 0.002
d2f34a1246 c.94.1.1 (A:5-116,A:119-252) Glutamate receptor li 2e-12
d1xwva_129 b.1.18.7 (A:) Major mite allergen {House-dust mite 1e-08
d1wdna_223 c.94.1.1 (A:) Glutamine-binding protein {Escherich 3e-05
d1nepa_130 b.1.18.7 (A:) Epididymal secretory protein E1 (Nie 3e-04
d1ii5a_226 c.94.1.1 (A:) Glutamate receptor ligand binding co 0.003
>d2a5sa1 c.94.1.1 (A:7-142,A:145-285) N-methyl-D-aspartate receptor subunit 1 {Rat (Rattus norvegicus), subtype 2A [TaxId: 10116]} Length = 277 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Periplasmic binding protein-like II
superfamily: Periplasmic binding protein-like II
family: Phosphate binding protein-like
domain: N-methyl-D-aspartate receptor subunit 1
species: Rat (Rattus norvegicus), subtype 2A [TaxId: 10116]

 Score = 73.9 bits (180), Expect = 2e-15
 Identities = 41/153 (26%), Positives = 74/153 (48%), Gaps = 28/153 (18%)

Query: 12  LKQEPFVMREESEGGGGV--------------------------KYKGYCIDLIEEIRKL 45
           L++ PFV+ E+ +                                 KG+CID+++++ + 
Sbjct: 8   LEEAPFVIVEDIDPLTETCVRNTVPCRKFVKINNSTNEGMNVKKCCKGFCIDILKKLSRT 67

Query: 46  VGFEYEIFVAPDNSFGNMDENGQWNGMIKELIEKRADIALGSLSVMAERENVVDFTVPYY 105
           V F Y++++  +   G    N  WNGMI E++ +RA +A+GSL++  ER  VVDF+VP+ 
Sbjct: 68  VKFTYDLYLVTNGKHGKKV-NNVWNGMIGEVVYQRAVMAVGSLTINEERSEVVDFSVPFV 126

Query: 106 DLVGITILMKKPKTPTSLFKFLTVLETGVWLCI 138
           +  GI++++ +  T  S  KF    +       
Sbjct: 127 E-TGISVMVSRQVTGLSDKKFQRPHDYSPPFRF 158
>d1mqia_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR2 [TaxId: 10116]} Length = 260 Back     information, alignment and structure
>d1mqia_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR2 [TaxId: 10116]} Length = 260 Back     information, alignment and structure
>d1pb7a_ c.94.1.1 (A:) N-methyl-D-aspartate receptor subunit 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 289 Back     information, alignment and structure
>d1pb7a_ c.94.1.1 (A:) N-methyl-D-aspartate receptor subunit 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 289 Back     information, alignment and structure
>d2f34a1 c.94.1.1 (A:5-116,A:119-252) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR5 [TaxId: 10116]} Length = 246 Back     information, alignment and structure
>d1xwva_ b.1.18.7 (A:) Major mite allergen {House-dust mite (Dermatophagoides farinae), Der f 2 [TaxId: 6954]} Length = 129 Back     information, alignment and structure
>d1wdna_ c.94.1.1 (A:) Glutamine-binding protein {Escherichia coli [TaxId: 562]} Length = 223 Back     information, alignment and structure
>d1nepa_ b.1.18.7 (A:) Epididymal secretory protein E1 (Niemann-Pick C2 protein) {Cow (Bos taurus) [TaxId: 9913]} Length = 130 Back     information, alignment and structure
>d1ii5a_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Synechocystis sp., GluR0 [TaxId: 1143]} Length = 226 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query444
d2a5sa1277 N-methyl-D-aspartate receptor subunit 1 {Rat (Ratt 99.96
d1mqia_260 Glutamate receptor ligand binding core {Rat (Rattu 99.94
d1pb7a_289 N-methyl-D-aspartate receptor subunit 1 {Rat (Ratt 99.94
d2f34a1246 Glutamate receptor ligand binding core {Rat (Rattu 99.91
d1wdna_223 Glutamine-binding protein {Escherichia coli [TaxId 99.9
d1ii5a_226 Glutamate receptor ligand binding core {Synechocys 99.89
d1xt8a1248 Putative amino-acid transporter CjaA {Campylobacte 99.84
d1lsta_238 Lysine-,arginine-,ornithine-binding (LAO) protein 99.82
d2ozza1228 Hypothetical protein YhfZ {Shigella flexneri [TaxI 96.73
d1r3jc_103 Potassium channel protein {Streptomyces coelicolor 96.13
d1al3a_237 Cofactor-binding fragment of LysR-type protein Cys 94.89
d1xl4a2116 Inward rectifier potassium channel kirbac3.1 {Magn 94.2
d2fyia1220 LysR-type regulatory protein Cbl {Escherichia coli 93.87
d1p7ba2116 Inward rectifier potassium channel Kirbac1.1 {Burk 92.39
d1i6aa_212 Hydrogen peroxide-inducible genes LysR-type activa 85.68
d1lnqa280 Potassium channel-related protein MthK {Archaeon M 82.32
d2esna2212 Probable LysR-type transcriptional regulator PA047 81.21
>d2a5sa1 c.94.1.1 (A:7-142,A:145-285) N-methyl-D-aspartate receptor subunit 1 {Rat (Rattus norvegicus), subtype 2A [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Periplasmic binding protein-like II
superfamily: Periplasmic binding protein-like II
family: Phosphate binding protein-like
domain: N-methyl-D-aspartate receptor subunit 1
species: Rat (Rattus norvegicus), subtype 2A [TaxId: 10116]

Probab=99.96  E-value=7.3e-30  Score=242.31  Aligned_cols=243  Identities=25%  Similarity=0.406  Sum_probs=196.2

Q ss_pred             eeEEEeccCCCeEEEecCCCC--------------------------CceeeeecHHHHHHHHHHHcCCeEEEEEcCCCC
Q psy12229          6 NISDSRLKQEPFVMREESEGG--------------------------GGVKYKGYCIDLIEEIRKLVGFEYEIFVAPDNS   59 (444)
Q Consensus         6 ~l~V~~~~~~Pf~~~~~~~~~--------------------------~~~~~~G~~~dil~~la~~lnft~~~~~~~~~~   59 (444)
                      ||||+|.+.|||++.......                          +...+.|+++|+++++|++||++++++..++++
T Consensus         2 hl~v~t~~~~Pfv~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G~~iDl~~~ia~~lg~~~e~~~v~~~~   81 (277)
T d2a5sa1           2 HLSIVTLEEAPFVIVEDIDPLTETCVRNTVPCRKFVKINNSTNEGMNVKKCCKGFCIDILKKLSRTVKFTYDLYLVTNGK   81 (277)
T ss_dssp             CEEEEECCBTTTBEEEECCCC-CCCCTTCEEEEEEEESSSSSSCEEEEEEEEESHHHHHHHHHHHHHTCCEEEEECCSSS
T ss_pred             ceEEEEEecCCeEEEeccCcccCcccCCCcccceecccccCCCCCcccccceeeeHHHHHHHHHHHhCCCEEEEEccCCC
Confidence            899999999999987642211                          123578999999999999999999999999999


Q ss_pred             CccccCCCccchhHHHHhcccccEEeecccccccccccccccccceecccEEEEEeCCCCCCcccccccccchhHHHHHH
Q psy12229         60 FGNMDENGQWNGMIKELIEKRADIALGSLSVMAERENVVDFTVPYYDLVGITILMKKPKTPTSLFKFLTVLETGVWLCIL  139 (444)
Q Consensus        60 ~g~~~~ng~~~g~i~~l~~g~~Di~~~~~~~t~~r~~~~dfS~p~~~~~~~~ilvp~~~~~~~~~~~l~pF~~~vWi~i~  139 (444)
                      ||.. .+++|++++++|.+|++|++++++++|++|.+.++||.||+. .+..++++++........+..|+         
T Consensus        82 ~g~~-~~~~w~~~l~~l~~g~~Di~i~~~tit~eR~~~v~Fs~Py~~-~~~~ilv~k~~~~~~~~~~~~~~---------  150 (277)
T d2a5sa1          82 HGKK-VNNVWNGMIGEVVYQRAVMAVGSLTINEERSEVVDFSVPFVE-TGISVMVSRQVTGLSDKKFQRPH---------  150 (277)
T ss_dssp             SCCE-ETTEECHHHHHHHTTSCSEECSSCBCCHHHHTTEEECCCCEE-ECEEEEEETCCCSTTSHHHHSGG---------
T ss_pred             cCcc-CCCCHHHHHhhhhcccEEEEEEccEeehhhhhhhcccCCcee-cceEEEEecCcccCChhHhcCcc---------
Confidence            9986 589999999999999999999999999999999999999999 99999999875332222221111         


Q ss_pred             HHHHHHhcceeccccccCCCCCCCcccchhhhhhhHhHhcccccccCCCCCCCCCChhhHHHHHHHHHHHHHHHHHhhhc
Q psy12229        140 AAYCNLDGEQMKYLIQVNPPGDILPEVIRAIILMQNITDAGILFDDSFSGGEAPKNLSGRLVAATWWLFGFIIIASYTAN  219 (444)
Q Consensus       140 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~g~~~~~~~~~~~~p~~~s~Rl~~~~w~l~~lvl~~~Y~a~  219 (444)
                                                                                                      
T Consensus       151 --------------------------------------------------------------------------------  150 (277)
T d2a5sa1         151 --------------------------------------------------------------------------------  150 (277)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             chhhhhcccCCCCCCChHHhhhCCceeeEecCCChhhHHhhhhhhhhhHHHHHHhhhccCCCCcHHHHhhhhcccCCcch
Q psy12229        220 LAAFLTVSRLDTPIESLDDLSKQYKIQYAPLNGSAAMTYFQRMADIEGRFYEIWKDMSLNDSLSDVERAKLAVWDYPVSD  299 (444)
Q Consensus       220 L~s~Lt~~~~~~~I~sl~dL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~  299 (444)
                                        |+  +.+.++|+..++...+++++..                                    
T Consensus       151 ------------------~~--~~~~~~g~v~~~~~~~~~~~~~------------------------------------  174 (277)
T d2a5sa1         151 ------------------DY--SPPFRFGTVPNGSTERNIRNNY------------------------------------  174 (277)
T ss_dssp             ------------------GS--SSCCCEECCTTSHHHHHHHTTC------------------------------------
T ss_pred             ------------------cc--chheeeeccchhhHHHHHHHhh------------------------------------
Confidence                              11  1235688888888888887532                                    


Q ss_pred             hHHHHHHHHHhcCCCCCHHHHHHHHHhcCCCCCceEEEecccchhhhhcC--CCccEEeCC--cccccceEEEecCCCch
Q psy12229        300 KYTKMWQAMKEAKLPNSLEEAVQRVRDSKSSSEGFGYLGDATDIRYLVMT--NCDLQMVGD--EFSRKPYAIAVQQDRDA  375 (444)
Q Consensus       300 ~y~~~~~~~~~~~~~~~~~e~~~~v~~~~~~~~~~a~i~d~~~~~y~~~~--~c~l~~~~~--~~~~~~~~~~~~k~sp~  375 (444)
                        +++...+.. ....+.++++++|.+|+    .+|++.|...+.|+.++  .|++..++.  .+...+|+++++||+|+
T Consensus       175 --~~~~~~~~~-~~~~~~~~~~~~l~~G~----~Da~i~d~~~~~y~~~~~~~~~l~~~~~~~~~~~~~ygia~~k~s~l  247 (277)
T d2a5sa1         175 --PYMHQYMTR-FNQRGVEDALVSLKTGK----LDAFIYDAAVLNYKAGRDEGCKLVTIGSGYIFATTGYGIALQKGSPW  247 (277)
T ss_dssp             --HHHHHHHGG-GCCSSHHHHHHHHHTTS----CSEEEEEHHHHHHHHHTCTTSCEEEEECCCGGGCEEECCEEETTCTT
T ss_pred             --hhhcceEEE-ecCCCHHHHHHHHHcCC----cceecccHHHHHHHHhhCCCCcEEEecCCCCcCcceEEEEEeCChHH
Confidence              222222211 23568999999999997    89999999999998875  477777653  56778899999999999


Q ss_pred             hhhhHHHHHHHhcCCccccCCCCCcccccccccC
Q psy12229        376 RELFCNVHANILSIPFPFIGVDGTSVCSSIFDTD  409 (444)
Q Consensus       376 ~~~in~~il~l~e~G~i~~~~~~~~~~~~kw~~~  409 (444)
                      ++.||++|.+|.++|.++++       .+|||+.
T Consensus       248 ~~~in~al~~l~~~G~~~~L-------~~KW~~g  274 (277)
T d2a5sa1         248 KRQIDLALLQFVGDGEMEEL-------ETLWLTG  274 (277)
T ss_dssp             HHHHHHHHHHHHHHTHHHHH-------HHHHTCC
T ss_pred             HHHHHHHHHHHHHCCHHHHH-------HhhhcCC
Confidence            99999999999999999999       9999975
>d1mqia_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR2 [TaxId: 10116]} Back     information, alignment and structure
>d1pb7a_ c.94.1.1 (A:) N-methyl-D-aspartate receptor subunit 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2f34a1 c.94.1.1 (A:5-116,A:119-252) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR5 [TaxId: 10116]} Back     information, alignment and structure
>d1wdna_ c.94.1.1 (A:) Glutamine-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ii5a_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Synechocystis sp., GluR0 [TaxId: 1143]} Back     information, alignment and structure
>d1xt8a1 c.94.1.1 (A:10-257) Putative amino-acid transporter CjaA {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1lsta_ c.94.1.1 (A:) Lysine-,arginine-,ornithine-binding (LAO) protein {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2ozza1 c.94.1.1 (A:1-228) Hypothetical protein YhfZ {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d1r3jc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1al3a_ c.94.1.1 (A:) Cofactor-binding fragment of LysR-type protein CysB {Klebsiella aerogenes [TaxId: 28451]} Back     information, alignment and structure
>d1xl4a2 f.14.1.1 (A:23-138) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]} Back     information, alignment and structure
>d2fyia1 c.94.1.1 (A:88-307) LysR-type regulatory protein Cbl {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p7ba2 f.14.1.1 (A:36-151) Inward rectifier potassium channel Kirbac1.1 {Burkholderia pseudomallei [TaxId: 28450]} Back     information, alignment and structure
>d1i6aa_ c.94.1.1 (A:) Hydrogen peroxide-inducible genes LysR-type activator OxyR, regulatory domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lnqa2 f.14.1.1 (A:19-98) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d2esna2 c.94.1.1 (A:92-303) Probable LysR-type transcriptional regulator PA0477 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure