Psyllid ID: psy12232
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 202 | ||||||
| 242005162 | 887 | glutamate receptor, putative [Pediculus | 0.589 | 0.134 | 0.655 | 2e-45 | |
| 328711396 | 966 | PREDICTED: glutamate receptor, ionotropi | 0.589 | 0.123 | 0.663 | 3e-45 | |
| 189234151 | 945 | PREDICTED: similar to GA13857-PA [Tribol | 0.589 | 0.125 | 0.546 | 2e-36 | |
| 270002542 | 897 | hypothetical protein TcasGA2_TC004850 [T | 0.589 | 0.132 | 0.546 | 2e-36 | |
| 379070092 | 923 | putative ionotropic receptor IR25a [Cydi | 0.594 | 0.130 | 0.590 | 9e-36 | |
| 357630725 | 921 | hypothetical protein KGM_04141 [Danaus p | 0.569 | 0.124 | 0.598 | 4e-35 | |
| 399163347 | 904 | ionotropic receptor [Locusta migratoria] | 0.584 | 0.130 | 0.546 | 9e-32 | |
| 21358761 | 936 | ionotropic glutamate receptor subunit [H | 0.653 | 0.141 | 0.507 | 3e-31 | |
| 195147686 | 949 | GL18750 [Drosophila persimilis] gi|19410 | 0.584 | 0.124 | 0.553 | 4e-31 | |
| 194856275 | 921 | GG24350 [Drosophila erecta] gi|190660580 | 0.584 | 0.128 | 0.553 | 4e-31 |
| >gi|242005162|ref|XP_002423441.1| glutamate receptor, putative [Pediculus humanus corporis] gi|212506519|gb|EEB10703.1| glutamate receptor, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 187 bits (476), Expect = 2e-45, Method: Compositional matrix adjust.
Identities = 78/119 (65%), Positives = 106/119 (89%)
Query: 81 NLDGEQMKYLIQVNPPGDILPEVIRAIILMQNITDAGILFDDSFIFDHKYKSLLQNIPTR 140
NLD E KYLI + PPGD++PEV+R+++L QNI++A ILFDDSF+ DHKYKSLLQN+PTR
Sbjct: 91 NLDKEDEKYLIHIMPPGDLIPEVVRSLVLAQNISNAAILFDDSFVMDHKYKSLLQNVPTR 150
Query: 141 HIIAPVEDSRSVKRQLFRFKDLDIVNYFILGRLQTIKMILDSANVNKFFGRKFAWHAIT 199
H+I+PVE+S+++K+QL + DLD+VN+FILGR+ TIKM+LD AN+NK+FG+K++WHAIT
Sbjct: 151 HVISPVENSKTIKKQLTKMIDLDVVNFFILGRMSTIKMVLDHANINKYFGKKYSWHAIT 209
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|328711396|ref|XP_001945524.2| PREDICTED: glutamate receptor, ionotropic kainate 4-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|189234151|ref|XP_971258.2| PREDICTED: similar to GA13857-PA [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|270002542|gb|EEZ98989.1| hypothetical protein TcasGA2_TC004850 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|379070092|gb|AFC91757.1| putative ionotropic receptor IR25a [Cydia pomonella] | Back alignment and taxonomy information |
|---|
| >gi|357630725|gb|EHJ78658.1| hypothetical protein KGM_04141 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|399163347|gb|AFP33229.1| ionotropic receptor [Locusta migratoria] | Back alignment and taxonomy information |
|---|
| >gi|21358761|gb|AAM47017.1| ionotropic glutamate receptor subunit [Homarus americanus] | Back alignment and taxonomy information |
|---|
| >gi|195147686|ref|XP_002014810.1| GL18750 [Drosophila persimilis] gi|194106763|gb|EDW28806.1| GL18750 [Drosophila persimilis] | Back alignment and taxonomy information |
|---|
| >gi|194856275|ref|XP_001968713.1| GG24350 [Drosophila erecta] gi|190660580|gb|EDV57772.1| GG24350 [Drosophila erecta] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 202 | ||||||
| FB|FBgn0031634 | 934 | Ir25a "Ionotropic receptor 25a | 0.584 | 0.126 | 0.545 | 2.2e-30 | |
| UNIPROTKB|P18461 | 823 | FGFR2 "Fibroblast growth facto | 0.242 | 0.059 | 0.566 | 2e-08 | |
| UNIPROTKB|F1NV76 | 824 | FGFR2 "Fibroblast growth facto | 0.242 | 0.059 | 0.566 | 2e-08 | |
| UNIPROTKB|F1NV77 | 825 | FGFR2 "Fibroblast growth facto | 0.242 | 0.059 | 0.566 | 2.1e-08 | |
| UNIPROTKB|F1NEE9 | 830 | FGFR2 "Fibroblast growth facto | 0.242 | 0.059 | 0.566 | 2.1e-08 | |
| UNIPROTKB|F1PPH0 | 707 | FGFR2 "Fibroblast growth facto | 0.242 | 0.069 | 0.566 | 8.2e-08 | |
| UNIPROTKB|E7EVR7 | 707 | FGFR2 "Fibroblast growth facto | 0.242 | 0.069 | 0.566 | 8.2e-08 | |
| UNIPROTKB|P21802 | 821 | FGFR2 "Fibroblast growth facto | 0.242 | 0.059 | 0.566 | 1e-07 | |
| UNIPROTKB|F1PPD8 | 822 | FGFR2 "Fibroblast growth facto | 0.242 | 0.059 | 0.566 | 1e-07 | |
| UNIPROTKB|F1Q2E3 | 841 | FGFR2 "Fibroblast growth facto | 0.242 | 0.058 | 0.566 | 1e-07 |
| FB|FBgn0031634 Ir25a "Ionotropic receptor 25a" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 346 (126.9 bits), Expect = 2.2e-30, P = 2.2e-30
Identities = 66/121 (54%), Positives = 90/121 (74%)
Query: 81 NLDGEQMKYLIQVNPPGDILPEVIRAIILMQNITDAGILFDDSFIFDHKYKSLLQNIPTR 140
+LD + KYL+QV PP DI+PE IR+I++ NIT+A IL+DDSF+ DHKYKSLLQNI TR
Sbjct: 133 DLDEAKQKYLLQVMPPADIIPEAIRSIVIHMNITNAAILYDDSFVMDHKYKSLLQNIQTR 192
Query: 141 HIIAPV--EDSRSVKRQLFRFKDLDIVNYFILGRLQTIKMILDSANVNKFFGRKFAWHAI 198
H+I + + R + Q+ + ++LDI N+FILG LQ+I+M+L+S +F R FAWHAI
Sbjct: 193 HVITAIAKDGKREREEQIEKLRNLDINNFFILGTLQSIRMVLESVKP-AYFERNFAWHAI 251
Query: 199 T 199
T
Sbjct: 252 T 252
|
|
| UNIPROTKB|P18461 FGFR2 "Fibroblast growth factor receptor 2" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NV76 FGFR2 "Fibroblast growth factor receptor" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NV77 FGFR2 "Fibroblast growth factor receptor" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NEE9 FGFR2 "Fibroblast growth factor receptor" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PPH0 FGFR2 "Fibroblast growth factor receptor" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E7EVR7 FGFR2 "Fibroblast growth factor receptor" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P21802 FGFR2 "Fibroblast growth factor receptor 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PPD8 FGFR2 "Fibroblast growth factor receptor" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1Q2E3 FGFR2 "Fibroblast growth factor receptor" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 202 | |||
| cd06383 | 368 | cd06383, PBP1_iGluR_AMPA_Like, N-terminal leucine/ | 8e-38 | |
| cd05100 | 334 | cd05100, PTKc_FGFR3, Catalytic domain of the Prote | 3e-10 | |
| cd05101 | 304 | cd05101, PTKc_FGFR2, Catalytic domain of the Prote | 2e-08 | |
| cd05098 | 307 | cd05098, PTKc_FGFR1, Catalytic domain of the Prote | 1e-07 | |
| cd05099 | 314 | cd05099, PTKc_FGFR4, Catalytic domain of the Prote | 4e-07 | |
| cd05053 | 293 | cd05053, PTKc_FGFR, Catalytic domain of the Protei | 6e-07 | |
| cd05033 | 266 | cd05033, PTKc_EphR, Catalytic domain of Ephrin Rec | 3e-05 | |
| cd06351 | 328 | cd06351, PBP1_iGluR_N_LIVBP_like, N-terminal leuci | 4e-05 | |
| cd00192 | 262 | cd00192, PTKc, Catalytic domain of Protein Tyrosin | 1e-04 | |
| pfam07714 | 258 | pfam07714, Pkinase_Tyr, Protein tyrosine kinase | 5e-04 | |
| smart00219 | 257 | smart00219, TyrKc, Tyrosine kinase, catalytic doma | 6e-04 | |
| cd05056 | 270 | cd05056, PTKc_FAK, Catalytic domain of the Protein | 6e-04 | |
| smart00221 | 258 | smart00221, STYKc, Protein kinase; unclassified sp | 0.001 | |
| cd05066 | 267 | cd05066, PTKc_EphR_A, Catalytic domain of the Prot | 0.001 | |
| cd05032 | 277 | cd05032, PTKc_InsR_like, Catalytic domain of Insul | 0.002 | |
| cd05039 | 256 | cd05039, PTKc_Csk_like, Catalytic domain of C-term | 0.003 | |
| cd05038 | 284 | cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domai | 0.004 |
| >gnl|CDD|107378 cd06383, PBP1_iGluR_AMPA_Like, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of uncharacterized AMPA-like receptors | Back alignment and domain information |
|---|
Score = 133 bits (337), Expect = 8e-38
Identities = 56/121 (46%), Positives = 73/121 (60%), Gaps = 2/121 (1%)
Query: 81 NLDGEQMKYLIQVNPPGDILPEVIRAIILMQNITDAGILFDDSFIFDHKYKSLLQNIPTR 140
+ YLIQ+ PP D + E IR I+ NIT+A IL+DD F+ DHKYKSLLQN PTR
Sbjct: 101 QEGDLEQPYLIQLMPPADDIVEAIRDIVSYYNITNAAILYDDDFVMDHKYKSLLQNWPTR 160
Query: 141 HIIAPVEDSRS-VKRQLFRFKDLDIVNYFILGRL-QTIKMILDSANVNKFFGRKFAWHAI 198
H+I + V+ Q+ R ++LDI N FILG + I+ +LD A F GRK+AW
Sbjct: 161 HVITIINSIIDEVREQIKRLRNLDIKNIFILGSTEEIIRYVLDQALAEGFMGRKYAWFLG 220
Query: 199 T 199
Sbjct: 221 N 221
|
N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of uncharacterized AMPA-like receptors. While this N-terminal domain belongs to the periplasmic-binding fold type I superfamily, the glutamate-binding domain of the iGluR is structurally homologous to the periplasmic-binding fold type II. The LIVBP-like domain of iGluRs is thought to play a role in the initial assembly of iGluR subunits, but it is not well understood how this domain is arranged and functions in intact iGluR. AMPA receptors consist of four types of subunits (GluR1, GluR2, GluR3, and GluR4) which combine to form a tetramer and play an important roles in mediating the rapid excitatory synaptic current. Length = 368 |
| >gnl|CDD|173652 cd05100, PTKc_FGFR3, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 | Back alignment and domain information |
|---|
| >gnl|CDD|133232 cd05101, PTKc_FGFR2, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|133229 cd05098, PTKc_FGFR1, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 | Back alignment and domain information |
|---|
| >gnl|CDD|133230 cd05099, PTKc_FGFR4, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 | Back alignment and domain information |
|---|
| >gnl|CDD|173634 cd05053, PTKc_FGFR, Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors | Back alignment and domain information |
|---|
| >gnl|CDD|133165 cd05033, PTKc_EphR, Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|107346 cd06351, PBP1_iGluR_N_LIVBP_like, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NMDA, AMPA, and kainate receptor subtypes of ionotropic glutamate receptors (iGluRs) | Back alignment and domain information |
|---|
| >gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase | Back alignment and domain information |
|---|
| >gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|133187 cd05056, PTKc_FAK, Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity | Back alignment and domain information |
|---|
| >gnl|CDD|173639 cd05066, PTKc_EphR_A, Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors | Back alignment and domain information |
|---|
| >gnl|CDD|173625 cd05032, PTKc_InsR_like, Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|133171 cd05039, PTKc_Csk_like, Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173628 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 202 | |||
| KOG0196|consensus | 996 | 99.39 | ||
| cd06383 | 368 | PBP1_iGluR_AMPA_Like N-terminal leucine/isoleucine | 98.71 | |
| KOG4278|consensus | 1157 | 98.02 | ||
| KOG0200|consensus | 609 | 97.98 | ||
| KOG1095|consensus | 1025 | 97.79 | ||
| KOG4257|consensus | 974 | 97.6 | ||
| KOG1025|consensus | 1177 | 97.25 | ||
| cd05108 | 316 | PTKc_EGFR Catalytic domain of the Protein Tyrosine | 97.03 | |
| KOG0192|consensus | 362 | 97.01 | ||
| KOG0199|consensus | 1039 | 96.88 | ||
| cd05100 | 334 | PTKc_FGFR3 Catalytic domain of the Protein Tyrosin | 96.84 | |
| cd06351 | 328 | PBP1_iGluR_N_LIVBP_like N-terminal leucine/isoleuc | 96.41 | |
| cd05110 | 303 | PTKc_HER4 Catalytic domain of the Protein Tyrosine | 96.4 | |
| cd06393 | 384 | PBP1_iGluR_Kainate_GluR5_7 N-terminal leucine/isol | 96.37 | |
| cd06387 | 372 | PBP1_iGluR_AMPA_GluR3 N-terminal leucine/isoleucin | 96.29 | |
| cd06390 | 364 | PBP1_iGluR_AMPA_GluR1 N-terminal leucine/isoleucin | 95.51 | |
| PF01094 | 348 | ANF_receptor: Receptor family ligand binding regio | 95.48 | |
| cd06392 | 400 | PBP1_iGluR_delta_1 N-terminal leucine/isoleucine/v | 95.28 | |
| KOG4721|consensus | 904 | 95.11 | ||
| cd06389 | 370 | PBP1_iGluR_AMPA_GluR2 N-terminal leucine/isoleucin | 94.29 | |
| cd06379 | 377 | PBP1_iGluR_NMDA_NR1 N-terminal leucine/isoleucine/ | 94.18 | |
| cd06380 | 382 | PBP1_iGluR_AMPA N-terminal leucine/isoleucine/vali | 94.08 | |
| cd06650 | 333 | PKc_MEK1 Catalytic domain of the dual-specificity | 94.07 | |
| cd06381 | 363 | PBP1_iGluR_delta_like N-terminal leucine/isoleucin | 93.84 | |
| KOG0194|consensus | 474 | 93.7 | ||
| cd06388 | 371 | PBP1_iGluR_AMPA_GluR4 N-terminal leucine/isoleucin | 93.46 | |
| cd06269 | 298 | PBP1_glutamate_receptors_like Family C G-protein c | 93.39 | |
| cd06394 | 333 | PBP1_iGluR_Kainate_KA1_2 N-terminal leucine/isoleu | 93.32 | |
| cd06386 | 387 | PBP1_NPR_C_like Ligand-binding domain of type C na | 93.19 | |
| cd06391 | 400 | PBP1_iGluR_delta_2 N-terminal leucine/isoleucine/v | 93.18 | |
| cd06607 | 307 | STKc_TAO Catalytic domain of the Protein Serine/Th | 93.16 | |
| cd06378 | 362 | PBP1_iGluR_NMDA_NR2 N-terminal leucine/isoleucine/ | 92.4 | |
| KOG1023|consensus | 484 | 92.39 | ||
| cd07834 | 330 | STKc_MAPK Catalytic domain of the Serine/Threonine | 92.19 | |
| cd06634 | 308 | STKc_TAO2 Catalytic domain of the Protein Serine/T | 91.82 | |
| cd06385 | 405 | PBP1_NPR_A Ligand-binding domain of type A natriur | 91.18 | |
| cd07849 | 336 | STKc_ERK1_2_like Catalytic domain of Extracellular | 91.16 | |
| cd07859 | 338 | STKc_TDY_MAPK_plant Catalytic domain of the Serine | 90.4 | |
| cd06368 | 324 | PBP1_iGluR_non_NMDA_like N-terminal leucine/isoleu | 90.12 | |
| cd06635 | 317 | STKc_TAO1 Catalytic domain of the Protein Serine/T | 90.07 | |
| cd05609 | 305 | STKc_MAST Catalytic domain of the Protein Serine/T | 89.69 | |
| cd07852 | 337 | STKc_MAPK15 Catalytic domain of the Serine/Threoni | 89.57 | |
| cd07858 | 337 | STKc_TEY_MAPK_plant Catalytic domain of the Serine | 89.5 | |
| cd06367 | 362 | PBP1_iGluR_NMDA N-terminal leucine/isoleucine/vali | 88.82 | |
| cd06382 | 327 | PBP1_iGluR_Kainate N-terminal leucine/isoleucine/v | 88.82 | |
| cd06373 | 396 | PBP1_NPR_like Ligand binding domain of natriuretic | 87.96 | |
| cd06384 | 399 | PBP1_NPR_B Ligand-binding domain of type B natriur | 87.91 | |
| cd07851 | 343 | STKc_p38 Catalytic domain of the Serine/Threonine | 87.27 | |
| cd06633 | 313 | STKc_TAO3 Catalytic domain of the Protein Serine/T | 87.27 | |
| cd07856 | 328 | STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre | 86.85 | |
| cd07854 | 342 | STKc_MAPK4_6 Catalytic domain of the Serine/Threon | 86.56 | |
| cd07855 | 334 | STKc_ERK5 Catalytic domain of the Serine/Threonine | 86.56 | |
| PTZ00283 | 496 | serine/threonine protein kinase; Provisional | 86.54 | |
| cd06376 | 463 | PBP1_mGluR_groupIII Ligand-binding domain of the g | 86.53 | |
| cd06366 | 350 | PBP1_GABAb_receptor Ligand-binding domain of GABAb | 85.85 | |
| cd07879 | 342 | STKc_p38delta_MAPK13 Catalytic domain of the Serin | 85.63 | |
| cd07857 | 332 | STKc_MPK1 Catalytic domain of the Serine/Threonine | 84.77 | |
| cd07876 | 359 | STKc_JNK2 Catalytic domain of the Serine/Threonine | 84.18 | |
| PTZ00267 | 478 | NIMA-related protein kinase; Provisional | 83.77 | |
| cd07874 | 355 | STKc_JNK3 Catalytic domain of the Serine/Threonine | 83.35 | |
| cd06352 | 389 | PBP1_NPR_GC_like Ligand-binding domain of membrane | 82.51 | |
| cd07850 | 353 | STKc_JNK Catalytic domain of the Serine/Threonine | 81.49 | |
| cd04509 | 299 | PBP1_ABC_transporter_GCPR_C_like Family C of G-pro | 80.91 |
| >KOG0196|consensus | Back alignment and domain information |
|---|
Probab=99.39 E-value=3.6e-13 Score=132.98 Aligned_cols=104 Identities=30% Similarity=0.425 Sum_probs=86.6
Q ss_pred hHHHHHHHhchhcCCCCCCHHHHHHHHHHHhhhhccccc-ccccccCCCCCCCCCCCCCCCCCCchhhHhhhhhhhhhhh
Q psy12232 2 SSYELMRDCWSYVASERPEFIQLVSKLDRILTVTANEYL-GQEYLELEAPLLDTPPSSEDESNDDEETCAYLLESVIRIS 80 (202)
Q Consensus 2 ~LY~LM~~CW~~dP~~RPtF~eLv~~Le~ll~~~~~~~~-~~~Yldls~p~~~~sps~~d~~~~~~~t~~~~lesI~~Wr 80 (202)
.||+||++||++++.+||+|.||+..|+++++++.+++. ...-...+.++.+. +.+|.. ...++++|+++|
T Consensus 862 aL~qLMldCWqkdR~~RP~F~qiV~~lDklIrnP~SLk~~~~~~~r~s~~lld~--~~~~~~--~f~sv~~WL~aI---- 933 (996)
T KOG0196|consen 862 ALYQLMLDCWQKDRNRRPKFAQIVSTLDKLIRNPNSLKTIAPESPRPSQPLLDR--SGSDFT--PFRSVGDWLEAI---- 933 (996)
T ss_pred HHHHHHHHHHHHHhhcCCCHHHHHHHHHHHhcCchhhcccCCCCCCCcccccCC--CCCCCc--ccCCHHHHHHHh----
Confidence 699999999999999999999999999999999998776 44444455565553 333433 448999999999
Q ss_pred ccCcccccceEeeCCCCCChHHHHHHH----HHHhcCCcce
Q psy12232 81 NLDGEQMKYLIQVNPPGDILPEVIRAI----ILMQNITDAG 117 (202)
Q Consensus 81 ~l~~~~~~YLlqv~pp~~~~pe~vr~~----~~~~nit~Ag 117 (202)
.+.+|..+|+.+|....+.|.++ +.++|||.+|
T Consensus 934 ----km~rY~~~F~~ag~~s~~~V~q~s~eDl~~~Gitl~G 970 (996)
T KOG0196|consen 934 ----KMGRYKEHFAAAGYTSFEDVAQMSAEDLLRLGITLAG 970 (996)
T ss_pred ----hhhHHHHHHHhcCcccHHHHHhhhHHHHHhhceeecc
Confidence 49999999999999999999998 5899999754
|
|
| >cd06383 PBP1_iGluR_AMPA_Like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of uncharacterized AMPA-like receptors | Back alignment and domain information |
|---|
| >KOG4278|consensus | Back alignment and domain information |
|---|
| >KOG0200|consensus | Back alignment and domain information |
|---|
| >KOG1095|consensus | Back alignment and domain information |
|---|
| >KOG4257|consensus | Back alignment and domain information |
|---|
| >KOG1025|consensus | Back alignment and domain information |
|---|
| >cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor | Back alignment and domain information |
|---|
| >KOG0192|consensus | Back alignment and domain information |
|---|
| >KOG0199|consensus | Back alignment and domain information |
|---|
| >cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 | Back alignment and domain information |
|---|
| >cd06351 PBP1_iGluR_N_LIVBP_like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NMDA, AMPA, and kainate receptor subtypes of ionotropic glutamate receptors (iGluRs) | Back alignment and domain information |
|---|
| >cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 | Back alignment and domain information |
|---|
| >cd06393 PBP1_iGluR_Kainate_GluR5_7 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR5-7 subunits of Kainate receptor | Back alignment and domain information |
|---|
| >cd06387 PBP1_iGluR_AMPA_GluR3 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR3 subunit of the AMPA receptor | Back alignment and domain information |
|---|
| >cd06390 PBP1_iGluR_AMPA_GluR1 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR1 subunit of the AMPA receptor | Back alignment and domain information |
|---|
| >PF01094 ANF_receptor: Receptor family ligand binding region The Prosite family is a sub-family of the Pfam family; InterPro: IPR001828 This describes a ligand binding domain and includes extracellular ligand binding domains of a wide range of receptors, as well as the bacterial amino acid binding proteins of known structure [] | Back alignment and domain information |
|---|
| >cd06392 PBP1_iGluR_delta_1 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the delta1 receptor of an orphan glutamate receptor family | Back alignment and domain information |
|---|
| >KOG4721|consensus | Back alignment and domain information |
|---|
| >cd06389 PBP1_iGluR_AMPA_GluR2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR2 subunit of the AMPA receptor | Back alignment and domain information |
|---|
| >cd06379 PBP1_iGluR_NMDA_NR1 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NR1, an essential channel-forming subunit of the NMDA receptor | Back alignment and domain information |
|---|
| >cd06380 PBP1_iGluR_AMPA N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the AMPA receptor | Back alignment and domain information |
|---|
| >cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 | Back alignment and domain information |
|---|
| >cd06381 PBP1_iGluR_delta_like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of an orphan family of delta receptors, GluRdelta1 and GluRdelta2 | Back alignment and domain information |
|---|
| >KOG0194|consensus | Back alignment and domain information |
|---|
| >cd06388 PBP1_iGluR_AMPA_GluR4 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR4 subunit of the AMPA receptor | Back alignment and domain information |
|---|
| >cd06269 PBP1_glutamate_receptors_like Family C G-protein couples receptors (GPCRs), membrane bound guanylyl cyclases such as the family of natriuretic peptide receptors (NPRs), and the N-terminal leucine/isoleucine/valine- binding protein (LIVBP)-like domain of the ionotropic glutamate receptors | Back alignment and domain information |
|---|
| >cd06394 PBP1_iGluR_Kainate_KA1_2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the KA1 and KA2 subunits of Kainate receptor | Back alignment and domain information |
|---|
| >cd06386 PBP1_NPR_C_like Ligand-binding domain of type C natriuretic peptide receptor | Back alignment and domain information |
|---|
| >cd06391 PBP1_iGluR_delta_2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the delta2 receptor of an orphan glutamate receptor family | Back alignment and domain information |
|---|
| >cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins | Back alignment and domain information |
|---|
| >cd06378 PBP1_iGluR_NMDA_NR2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NR2 subunit of NMDA receptor family | Back alignment and domain information |
|---|
| >KOG1023|consensus | Back alignment and domain information |
|---|
| >cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 | Back alignment and domain information |
|---|
| >cd06385 PBP1_NPR_A Ligand-binding domain of type A natriuretic peptide receptor | Back alignment and domain information |
|---|
| >cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants | Back alignment and domain information |
|---|
| >cd06368 PBP1_iGluR_non_NMDA_like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the non-NMDA (N-methyl-d-asparate) subtypes of ionotropic glutamate receptors | Back alignment and domain information |
|---|
| >cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 | Back alignment and domain information |
|---|
| >cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase | Back alignment and domain information |
|---|
| >cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 | Back alignment and domain information |
|---|
| >cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants | Back alignment and domain information |
|---|
| >cd06367 PBP1_iGluR_NMDA N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the ionotropic N-methyl-d-asparate (NMDA) subtype of glutamate receptors | Back alignment and domain information |
|---|
| >cd06382 PBP1_iGluR_Kainate N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the kainate receptors | Back alignment and domain information |
|---|
| >cd06373 PBP1_NPR_like Ligand binding domain of natriuretic peptide receptor (NPR) family | Back alignment and domain information |
|---|
| >cd06384 PBP1_NPR_B Ligand-binding domain of type B natriuretic peptide receptor | Back alignment and domain information |
|---|
| >cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 | Back alignment and domain information |
|---|
| >cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 | Back alignment and domain information |
|---|
| >cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 | Back alignment and domain information |
|---|
| >cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 | Back alignment and domain information |
|---|
| >PTZ00283 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd06376 PBP1_mGluR_groupIII Ligand-binding domain of the group III metabotropic glutamate receptor | Back alignment and domain information |
|---|
| >cd06366 PBP1_GABAb_receptor Ligand-binding domain of GABAb receptors, which are metabotropic transmembrane receptors for gamma-aminobutyric acid (GABA) | Back alignment and domain information |
|---|
| >cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 | Back alignment and domain information |
|---|
| >cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 | Back alignment and domain information |
|---|
| >PTZ00267 NIMA-related protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 | Back alignment and domain information |
|---|
| >cd06352 PBP1_NPR_GC_like Ligand-binding domain of membrane guanylyl-cyclase receptors | Back alignment and domain information |
|---|
| >cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase | Back alignment and domain information |
|---|
| >cd04509 PBP1_ABC_transporter_GCPR_C_like Family C of G-protein coupled receptors and their close homologs, the type I periplasmic-binding proteins of ATP-binding cassette transporter-like systems | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 202 | ||||
| 2pvf_A | 334 | Crystal Structure Of Tyrosine Phosphorylated Activa | 2e-09 | ||
| 3cly_A | 334 | Crystal Structure Of Fgf Receptor 2 (Fgfr2) Kinase | 2e-09 | ||
| 3gql_A | 326 | Crystal Structure Of Activated Receptor Tyrosine Ki | 1e-08 | ||
| 3gqi_A | 326 | Crystal Structure Of Activated Receptor Tyrosine Ki | 8e-08 | ||
| 2psq_A | 370 | Crystal Structure Of Unphosphorylated Unactivated W | 1e-07 | ||
| 2py3_A | 324 | Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D | 1e-07 | ||
| 2pwl_A | 324 | Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D | 1e-07 | ||
| 2q0b_A | 324 | Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D | 1e-07 | ||
| 2pvy_A | 324 | Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D | 1e-07 | ||
| 2pz5_A | 324 | Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D | 1e-07 | ||
| 2pzr_A | 324 | Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D | 1e-07 | ||
| 2pzp_A | 324 | Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D | 1e-07 | ||
| 1oec_A | 316 | The Fgfr2 Tyrosine Kinase Domain Length = 316 | 1e-07 | ||
| 3ri1_A | 313 | Crystal Structure Of The Catalytic Domain Of Fgfr2 | 1e-07 | ||
| 3tt0_A | 382 | Co-Structure Of Fibroblast Growth Factor Receptor 1 | 3e-07 | ||
| 3b2t_A | 311 | Structure Of Phosphotransferase Length = 311 | 3e-07 | ||
| 3kxx_A | 317 | Structure Of The Mutant Fibroblast Growth Factor Re | 2e-06 | ||
| 1fgk_A | 310 | Crystal Structure Of The Tyrosine Kinase Domain Of | 2e-06 | ||
| 3js2_A | 317 | Crystal Structure Of Minimal Kinase Domain Of Fibro | 2e-06 | ||
| 4f63_A | 309 | Crystal Structure Of Human Fibroblast Growth Factor | 2e-06 | ||
| 3rhx_B | 306 | Crystal Structure Of The Catalytic Domain Of Fgfr1 | 2e-06 | ||
| 3c4f_A | 302 | Fgfr Tyrosine Kinase Domain In Complex With 3-(3- M | 2e-06 |
| >pdb|2PVF|A Chain A, Crystal Structure Of Tyrosine Phosphorylated Activated Fgf Receptor 2 (Fgfr2) Kinase Domain In Complex With Atp Analog And Substrate Peptide Length = 334 | Back alignment and structure |
|
| >pdb|3CLY|A Chain A, Crystal Structure Of Fgf Receptor 2 (Fgfr2) Kinase Domains Trapped In Trans-Phosphorylation Reaction Length = 334 | Back alignment and structure |
| >pdb|3GQL|A Chain A, Crystal Structure Of Activated Receptor Tyrosine Kinase In Complex With Substrates Length = 326 | Back alignment and structure |
| >pdb|3GQI|A Chain A, Crystal Structure Of Activated Receptor Tyrosine Kinase In Complex With Substrates Length = 326 | Back alignment and structure |
| >pdb|2PSQ|A Chain A, Crystal Structure Of Unphosphorylated Unactivated Wild Type Fgf Receptor 2 (Fgfr2) Kinase Domain Length = 370 | Back alignment and structure |
| >pdb|2PY3|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic E565g Mutation Responsible For Pfeiffer Syndrome Length = 324 | Back alignment and structure |
| >pdb|2PWL|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic N549h Mutation Responsible For Crouzon Syndrome. Length = 324 | Back alignment and structure |
| >pdb|2Q0B|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic E565a Mutation Responsible For Pfeiffer Syndrome Length = 324 | Back alignment and structure |
| >pdb|2PVY|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K659n Mutation Responsible For An Unclassified Craniosynostosis Syndrome. Length = 324 | Back alignment and structure |
| >pdb|2PZ5|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic N549t Mutation Responsible For Pfeiffer Syndrome Length = 324 | Back alignment and structure |
| >pdb|2PZR|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K641r Mutation Responsible For Pfeiffer Syndrome Length = 324 | Back alignment and structure |
| >pdb|2PZP|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K526e Mutation Responsible For Crouzon Syndrome Length = 324 | Back alignment and structure |
| >pdb|1OEC|A Chain A, Fgfr2 Kinase Domain Length = 316 | Back alignment and structure |
| >pdb|3RI1|A Chain A, Crystal Structure Of The Catalytic Domain Of Fgfr2 Kinase In Complex With Arq 069 Length = 313 | Back alignment and structure |
| >pdb|3TT0|A Chain A, Co-Structure Of Fibroblast Growth Factor Receptor 1 Kinase Domain With 3-(2,6-Dichloro-3, 5-Dimethoxy-Phenyl)-1-{6-[4-(4-Ethyl-Piperazin-1- Yl)-Phenylamino]-Pyrimidin-4-Yl}-1-Methyl-Urea (Bgj398) Length = 382 | Back alignment and structure |
| >pdb|3B2T|A Chain A, Structure Of Phosphotransferase Length = 311 | Back alignment and structure |
| >pdb|3KXX|A Chain A, Structure Of The Mutant Fibroblast Growth Factor Receptor 1 Length = 317 | Back alignment and structure |
| >pdb|1FGK|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of Fibroblast Growth Factor Receptor 1 Length = 310 | Back alignment and structure |
| >pdb|3JS2|A Chain A, Crystal Structure Of Minimal Kinase Domain Of Fibroblast Growth Factor Receptor 1 In Complex With 5-(2-Thienyl) Nicotinic Acid Length = 317 | Back alignment and structure |
| >pdb|4F63|A Chain A, Crystal Structure Of Human Fibroblast Growth Factor Receptor 1 Kinase Domain In Complex With Compound 1 Length = 309 | Back alignment and structure |
| >pdb|3RHX|B Chain B, Crystal Structure Of The Catalytic Domain Of Fgfr1 Kinase In Complex With Arq 069 Length = 306 | Back alignment and structure |
| >pdb|3C4F|A Chain A, Fgfr Tyrosine Kinase Domain In Complex With 3-(3- Methoxybenzyl)-7-Azaindole Length = 302 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 202 | |||
| 2pvf_A | 334 | Fibroblast growth factor receptor 2; kinase domain | 7e-13 | |
| 3tt0_A | 382 | Basic fibroblast growth factor receptor 1; kinase | 2e-11 | |
| 3l9p_A | 367 | Anaplastic lymphoma kinase; kinase domain, ATP-bin | 4e-11 | |
| 2yfx_A | 327 | Tyrosine-protein kinase receptor; nucleotide-bindi | 9e-11 | |
| 3c1x_A | 373 | Hepatocyte growth factor receptor; receptor tyrosi | 2e-10 | |
| 3pls_A | 298 | Macrophage-stimulating protein receptor; protein k | 5e-10 | |
| 2psq_A | 370 | Fibroblast growth factor receptor 2; kinase domain | 8e-10 | |
| 1qpc_A | 279 | LCK kinase; alpha beta fold, transferase; HET: PTR | 9e-10 | |
| 2xir_A | 316 | Vascular endothelial growth factor receptor 2; ang | 1e-09 | |
| 3f66_A | 298 | Hepatocyte growth factor receptor; C-Met, protein | 1e-09 | |
| 1qcf_A | 454 | Haematopoetic cell kinase (HCK); tyrosine kinase-i | 2e-09 | |
| 1t46_A | 313 | HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom | 2e-09 | |
| 1rjb_A | 344 | FL cytokine receptor; kinase, structure, autoinhib | 2e-09 | |
| 1fvr_A | 327 | Tyrosine-protein kinase TIE-2; tyrosine kinase, tr | 2e-09 | |
| 3poz_A | 327 | Epidermal growth factor receptor; kinase domain, a | 3e-09 | |
| 3qup_A | 323 | Tyrosine-protein kinase receptor TYRO3; protein ki | 4e-09 | |
| 2ozo_A | 613 | Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t | 5e-09 | |
| 2h8h_A | 535 | Proto-oncogene tyrosine-protein kinase SRC; SRC ki | 7e-09 | |
| 3lzb_A | 327 | Epidermal growth factor receptor; epidermal growth | 1e-08 | |
| 2i1m_A | 333 | Macrophage colony-stimulating factor 1 receptor; k | 1e-08 | |
| 2ivs_A | 314 | Proto-oncogene tyrosine-protein kinase receptor RE | 1e-08 | |
| 1fmk_A | 452 | C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros | 1e-08 | |
| 3kfa_A | 288 | Tyrosine-protein kinase ABL1; CML, drug resistance | 2e-08 | |
| 3lxl_A | 327 | Tyrosine-protein kinase JAK3; TYK2, inflammation, | 2e-08 | |
| 1u59_A | 287 | Tyrosine-protein kinase ZAP-70; transferase; HET: | 3e-08 | |
| 3kex_A | 325 | Receptor tyrosine-protein kinase ERBB-3; kinase do | 4e-08 | |
| 1opk_A | 495 | P150, C-ABL, proto-oncogene tyrosine-protein kinas | 4e-08 | |
| 1byg_A | 278 | CSK, protein (C-terminal SRC kinase); protein kina | 4e-08 | |
| 1xbb_A | 291 | Tyrosine-protein kinase SYK; gleevec, STI-571, ima | 5e-08 | |
| 4aoj_A | 329 | High affinity nerve growth factor receptor; transf | 5e-08 | |
| 3cc6_A | 281 | Protein tyrosine kinase 2 beta; focal adhesion kin | 5e-08 | |
| 1mqb_A | 333 | Ephrin type-A receptor 2; tyrosine protein kinase, | 6e-08 | |
| 1p4o_A | 322 | Insulin-like growth factor I receptor protein; IGF | 6e-08 | |
| 3v5q_A | 297 | NT-3 growth factor receptor; kinase domain, kinase | 6e-08 | |
| 3lxp_A | 318 | Non-receptor tyrosine-protein kinase TYK2; JAK3, i | 1e-07 | |
| 1luf_A | 343 | Muscle-specific tyrosine kinase receptor MUSK; pho | 1e-07 | |
| 3brb_A | 313 | Proto-oncogene tyrosine-protein kinase MER; ATP-bi | 1e-07 | |
| 1mp8_A | 281 | Focal adhesion kinase 1; tyrosine protein kinase, | 1e-07 | |
| 1k9a_A | 450 | Carboxyl-terminal SRC kinase; COOH-terminal SRC ki | 1e-07 | |
| 2w1i_A | 326 | JAK2; chromosomal rearrangement, nucleotide-bindin | 1e-07 | |
| 3vhe_A | 359 | Vascular endothelial growth factor receptor 2; kin | 1e-07 | |
| 3kul_A | 325 | Ephrin type-A receptor 8; ATP-binding, kinase, nuc | 2e-07 | |
| 3gen_A | 283 | Tyrosine-protein kinase BTK; bruton'S tyrosine kin | 3e-07 | |
| 2j0j_A | 656 | Focal adhesion kinase 1; cell migration, FERM, tra | 3e-07 | |
| 4e5w_A | 302 | Tyrosine-protein kinase JAK1; kinase domain, trans | 3e-07 | |
| 3t9t_A | 267 | Tyrosine-protein kinase ITK/TSK; kinase domain, al | 4e-07 | |
| 3sxs_A | 268 | Cytoplasmic tyrosine-protein kinase BMX; transfera | 5e-07 | |
| 2qol_A | 373 | Ephrin receptor; receptor tyrosine kinase, juxtame | 5e-07 | |
| 4fvq_A | 289 | Tyrosine-protein kinase JAK2; janus protein kinase | 6e-07 | |
| 3ugc_A | 295 | Tyrosine-protein kinase JAK2; small molecule inhib | 7e-07 | |
| 3s95_A | 310 | LIMK-1, LIM domain kinase 1; structural genomics, | 2e-06 | |
| 3zzw_A | 289 | Tyrosine-protein kinase transmembrane receptor RO; | 3e-06 | |
| 3cbl_A | 377 | C-FES, proto-oncogene tyrosine-protein kinase FES/ | 3e-06 | |
| 1u46_A | 291 | ACK-1, activated CDC42 kinase 1; tyrosine kinase, | 3e-06 | |
| 3lb7_A | 307 | RAF proto-oncogene serine/threonine-protein kinas; | 1e-05 | |
| 3og7_A | 289 | AKAP9-BRAF fusion protein; proto-oncogene, V600E, | 2e-05 | |
| 2y4i_B | 319 | KSR2, HKSR2, kinase suppressor of RAS 2; transfera | 3e-05 | |
| 2eva_A | 307 | TAK1 kinase - TAB1 chimera fusion protein; transfe | 4e-05 | |
| 3dtc_A | 271 | Mitogen-activated protein kinase kinase kinase 9; | 9e-05 | |
| 3p86_A | 309 | Serine/threonine-protein kinase CTR1; ETR1, ERS1, | 2e-04 | |
| 4f0f_A | 287 | Serine/threonine-protein kinase ROCO4; LRRK2, ATP- | 6e-04 |
| >2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Length = 334 | Back alignment and structure |
|---|
Score = 65.0 bits (159), Expect = 7e-13
Identities = 29/48 (60%), Positives = 33/48 (68%), Gaps = 4/48 (8%)
Query: 4 YELMRDCWSYVASERPEFIQLVSKLDRILTVTANEYLGQEYLELEAPL 51
Y +MRDCW V S+RP F QLV LDRILT+T NE EYL+L PL
Sbjct: 289 YMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTNE----EYLDLSQPL 332
|
| >3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Length = 382 | Back alignment and structure |
|---|
| >3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Length = 367 | Back alignment and structure |
|---|
| >2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Length = 327 | Back alignment and structure |
|---|
| >3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Length = 373 | Back alignment and structure |
|---|
| >3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} Length = 298 | Back alignment and structure |
|---|
| >2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Length = 370 | Back alignment and structure |
|---|
| >1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Length = 279 | Back alignment and structure |
|---|
| >2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Length = 316 | Back alignment and structure |
|---|
| >3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 3q6w_A* 3r7o_A* 3q6u_A* 3cth_A* 3ce3_A* 3ctj_A* ... Length = 298 | Back alignment and structure |
|---|
| >1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 | Back alignment and structure |
|---|
| >1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Length = 313 | Back alignment and structure |
|---|
| >1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Length = 344 | Back alignment and structure |
|---|
| >1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Length = 327 | Back alignment and structure |
|---|
| >3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* 2jiu_A* ... Length = 327 | Back alignment and structure |
|---|
| >3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Length = 323 | Back alignment and structure |
|---|
| >2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 | Back alignment and structure |
|---|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 | Back alignment and structure |
|---|
| >3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Length = 327 | Back alignment and structure |
|---|
| >2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Length = 333 | Back alignment and structure |
|---|
| >2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Length = 314 | Back alignment and structure |
|---|
| >1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 | Back alignment and structure |
|---|
| >3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Length = 288 | Back alignment and structure |
|---|
| >3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 3pjc_A* 1yvj_A* Length = 327 | Back alignment and structure |
|---|
| >1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 287 | Back alignment and structure |
|---|
| >3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Length = 325 | Back alignment and structure |
|---|
| >1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 | Back alignment and structure |
|---|
| >1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Length = 278 | Back alignment and structure |
|---|
| >1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Length = 291 | Back alignment and structure |
|---|
| >4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Length = 329 | Back alignment and structure |
|---|
| >3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Length = 281 | Back alignment and structure |
|---|
| >1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 333 | Back alignment and structure |
|---|
| >1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Length = 322 | Back alignment and structure |
|---|
| >3v5q_A NT-3 growth factor receptor; kinase domain, kinase, phosphorylation, transferase-transfer inhibitor complex; HET: 0F4; 2.20A {Homo sapiens} Length = 297 | Back alignment and structure |
|---|
| >3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* Length = 318 | Back alignment and structure |
|---|
| >1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Length = 343 | Back alignment and structure |
|---|
| >3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Length = 313 | Back alignment and structure |
|---|
| >1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Length = 281 | Back alignment and structure |
|---|
| >1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 | Back alignment and structure |
|---|
| >2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Length = 326 | Back alignment and structure |
|---|
| >3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vid_A* 3hng_A* Length = 359 | Back alignment and structure |
|---|
| >3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Length = 325 | Back alignment and structure |
|---|
| >3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Length = 283 | Back alignment and structure |
|---|
| >2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Length = 656 | Back alignment and structure |
|---|
| >4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 3eyg_A* 3eyh_A* Length = 302 | Back alignment and structure |
|---|
| >3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Length = 267 | Back alignment and structure |
|---|
| >3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} PDB: 3sxr_A* Length = 268 | Back alignment and structure |
|---|
| >2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Length = 373 | Back alignment and structure |
|---|
| >4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Length = 289 | Back alignment and structure |
|---|
| >3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 3q32_A* 3rvg_A* 3tjc_A* 3tjd_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* 3io7_A* 3kck_A* 3jy9_A* Length = 295 | Back alignment and structure |
|---|
| >3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 | Back alignment and structure |
|---|
| >3zzw_A Tyrosine-protein kinase transmembrane receptor RO; transferase, neurotrophic tyrosine kinase, receptor-related NTRKR2; 2.90A {Homo sapiens} Length = 289 | Back alignment and structure |
|---|
| >3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 | Back alignment and structure |
|---|
| >1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Length = 291 | Back alignment and structure |
|---|
| >3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 | Back alignment and structure |
|---|
| >2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 | Back alignment and structure |
|---|
| >2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 | Back alignment and structure |
|---|
| >3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 | Back alignment and structure |
|---|
| >3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 | Back alignment and structure |
|---|
| >4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 202 | |||
| 2qol_A | 373 | Ephrin receptor; receptor tyrosine kinase, juxtame | 97.72 | |
| 3poz_A | 327 | Epidermal growth factor receptor; kinase domain, a | 97.29 | |
| 2eva_A | 307 | TAK1 kinase - TAB1 chimera fusion protein; transfe | 96.69 | |
| 3s95_A | 310 | LIMK-1, LIM domain kinase 1; structural genomics, | 96.47 | |
| 3op5_A | 364 | Serine/threonine-protein kinase VRK1; adenosine tr | 96.43 | |
| 3kex_A | 325 | Receptor tyrosine-protein kinase ERBB-3; kinase do | 96.41 | |
| 3lzb_A | 327 | Epidermal growth factor receptor; epidermal growth | 96.27 | |
| 3tt0_A | 382 | Basic fibroblast growth factor receptor 1; kinase | 96.1 | |
| 1fvr_A | 327 | Tyrosine-protein kinase TIE-2; tyrosine kinase, tr | 95.75 | |
| 2izr_A | 330 | Casein kinase I isoform gamma-3; serine/threonine- | 95.65 | |
| 3ll6_A | 337 | Cyclin G-associated kinase; transferase, protein k | 95.49 | |
| 3sv0_A | 483 | Casein kinase I-like; typical kinase domain fold, | 95.41 | |
| 3o21_A | 389 | Glutamate receptor 3; periplasmatic binding protei | 95.37 | |
| 3saj_A | 384 | Glutamate receptor 1; rossman fold, ION channel, m | 94.84 | |
| 3h6g_A | 395 | Glutamate receptor, ionotropic kainate 2; membrane | 94.81 | |
| 4gpa_A | 389 | Glutamate receptor 4; PBP fold, ligand-gated ION c | 93.87 | |
| 3hsy_A | 376 | Glutamate receptor 2; ligand-gated ION channel, sy | 93.86 | |
| 2dyl_A | 318 | Dual specificity mitogen-activated protein kinase | 93.59 | |
| 4eut_A | 396 | Serine/threonine-protein kinase TBK1; ATP binding, | 93.53 | |
| 3qel_B | 364 | Glutamate [NMDA] receptor subunit epsilon-2; ION c | 93.48 | |
| 3qek_A | 384 | NMDA glutamate receptor subunit; amino terminal do | 93.3 | |
| 2wtk_C | 305 | Serine/threonine-protein kinase 11; transferase-me | 93.08 | |
| 3aln_A | 327 | Dual specificity mitogen-activated protein kinase; | 92.95 | |
| 3m2w_A | 299 | MAP kinase-activated protein kinase 2; small molec | 92.91 | |
| 3com_A | 314 | Serine/threonine-protein kinase 4; MST1, STE20-lik | 92.32 | |
| 3dbq_A | 343 | Dual specificity protein kinase TTK; MPS1 structur | 92.02 | |
| 3eqc_A | 360 | Dual specificity mitogen-activated protein kinase; | 91.97 | |
| 1u5q_A | 348 | Serine/threonine protein kinase TAO2; transferase; | 91.85 | |
| 2zmd_A | 390 | Dual specificity protein kinase TTK; MPS1, T686A, | 91.51 | |
| 2x7f_A | 326 | TRAF2 and NCK-interacting protein kinase; serine/t | 91.43 | |
| 3kg2_A | 823 | Glutamate receptor 2; ION channel, membrane protei | 91.4 | |
| 3gni_B | 389 | Strad alpha; kinase fold, pseudokinase, alpha heli | 91.24 | |
| 1q8y_A | 373 | SR protein kinase; transferase; HET: ADP ADE; 2.05 | 91.03 | |
| 2ycf_A | 322 | Serine/threonine-protein kinase CHK2; transferase, | 90.73 | |
| 3dls_A | 335 | PAS domain-containing serine/threonine-protein KI; | 90.7 | |
| 3uc3_A | 361 | Serine/threonine-protein kinase SRK2I; SNRK2, ABA | 90.55 | |
| 3fhr_A | 336 | MAP kinase-activated protein kinase 3; kinase-inhi | 90.28 | |
| 2owb_A | 335 | Serine/threonine-protein kinase PLK1; catalytic do | 90.24 | |
| 2b9h_A | 353 | MAP kinase FUS3, mitogen-activated protein kinase | 90.23 | |
| 3dzo_A | 413 | Rhoptry kinase domain; parasitic disease, transfer | 90.21 | |
| 3om0_A | 393 | Glutamate receptor, ionotropic kainate 5; membrane | 90.1 | |
| 2y0a_A | 326 | Death-associated protein kinase 1; transferase, ca | 89.78 | |
| 2jam_A | 304 | Calcium/calmodulin-dependent protein kinase type 1 | 89.67 | |
| 3e3p_A | 360 | Protein kinase, putative glycogen synthase kinase; | 89.26 | |
| 3lm5_A | 327 | Serine/threonine-protein kinase 17B; STK17B, serin | 89.2 | |
| 2a2a_A | 321 | Death-associated protein kinase 2; autoinhibition, | 89.15 | |
| 3c0i_A | 351 | Peripheral plasma membrane protein CASK; neurexin, | 89.0 | |
| 3tki_A | 323 | Serine/threonine-protein kinase CHK1; cell checkpo | 88.97 | |
| 1ua2_A | 346 | CAK, cell division protein kinase 7; cell cycle, p | 88.85 | |
| 1dp4_A | 435 | Atrial natriuretic peptide receptor A; periplasmic | 88.77 | |
| 3fe3_A | 328 | MAP/microtubule affinity-regulating kinase 3; seri | 88.46 | |
| 3pg1_A | 362 | Mitogen-activated protein kinase, putative (MAP K | 88.1 | |
| 1nxk_A | 400 | MAP kinase-activated protein kinase 2; MK2, phosph | 88.09 | |
| 3zgw_A | 347 | Maternal embryonic leucine zipper kinase; transfer | 87.77 | |
| 3qyz_A | 364 | Mitogen-activated protein kinase 1; transferase, s | 87.59 | |
| 3coi_A | 353 | Mitogen-activated protein kinase 13; P38D, P38delt | 87.48 | |
| 2rio_A | 434 | Serine/threonine-protein kinase/endoribonuclease I | 87.39 | |
| 3eb0_A | 383 | Putative uncharacterized protein; kinase cryptospo | 87.37 | |
| 4exu_A | 371 | Mitogen-activated protein kinase 13; P38 kinase, t | 87.34 | |
| 4b9d_A | 350 | Serine/threonine-protein kinase NEK1; transferase, | 87.26 | |
| 3h4j_B | 336 | AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin | 87.08 | |
| 3mtl_A | 324 | Cell division protein kinase 16; pctaire1, indirub | 87.07 | |
| 1tki_A | 321 | Titin; serine kinase, muscle, autoinhibition; 2.00 | 86.77 | |
| 3mi9_A | 351 | Cell division protein kinase 9; P-TEFB, HIV-1, pro | 86.49 | |
| 3ork_A | 311 | Serine/threonine protein kinase; structural genomi | 86.26 | |
| 2w4o_A | 349 | Calcium/calmodulin-dependent protein kinase type I | 86.21 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 85.54 | |
| 3rgf_A | 405 | Cyclin-dependent kinase 8; protein kinase complex, | 85.28 | |
| 3soa_A | 444 | Calcium/calmodulin-dependent protein kinase type a | 85.05 | |
| 2y94_A | 476 | 5'-AMP-activated protein kinase catalytic subunit; | 84.83 | |
| 3p23_A | 432 | Serine/threonine-protein kinase/endoribonuclease; | 84.8 | |
| 2xrw_A | 371 | Mitogen-activated protein kinase 8; transcription, | 84.7 | |
| 3oz6_A | 388 | Mitogen-activated protein kinase 1, serine/threon | 84.69 | |
| 4e7w_A | 394 | Glycogen synthase kinase 3; GSK3, PTyr195, transfe | 84.68 | |
| 1jdp_A | 441 | NPR-C, atrial natriuretic peptide clearance recept | 84.42 | |
| 4f11_A | 433 | Gamma-aminobutyric acid type B receptor subunit 2; | 83.82 | |
| 1kob_A | 387 | Twitchin; kinase, intrasteric regulation; 2.30A {A | 83.8 | |
| 3kn6_A | 325 | Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 | 83.43 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 83.25 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 83.07 | |
| 2qr7_A | 342 | Ribosomal protein S6 kinase alpha-3; kinase domain | 82.99 | |
| 3n9x_A | 432 | Phosphotransferase; malaria kinase, structural gen | 82.79 | |
| 2bdw_A | 362 | Hypothetical protein K11E8.1D; kinase, calmodulin | 82.18 | |
| 3rp9_A | 458 | Mitogen-activated protein kinase; structural genom | 82.07 | |
| 2yab_A | 361 | Death-associated protein kinase 2; apoptosis, tran | 81.45 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 81.02 |
| >2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... | Back alignment and structure |
|---|
Probab=97.72 E-value=2e-05 Score=68.94 Aligned_cols=94 Identities=26% Similarity=0.284 Sum_probs=34.0
Q ss_pred hHHHHHHHhchhcCCCCCCHHHHHHHHHHHhhhhccccc-ccccccCCCCCCCCCCCCCCCCCCchhhHhhhhhhhhhhh
Q psy12232 2 SSYELMRDCWSYVASERPEFIQLVSKLDRILTVTANEYL-GQEYLELEAPLLDTPPSSEDESNDDEETCAYLLESVIRIS 80 (202)
Q Consensus 2 ~LY~LM~~CW~~dP~~RPtF~eLv~~Le~ll~~~~~~~~-~~~Yldls~p~~~~sps~~d~~~~~~~t~~~~lesI~~Wr 80 (202)
.+.++|.+||+.+|.+||++.++++.|+.++..+..... ...-...+..... .+..+.. ...+...|++++
T Consensus 278 ~l~~li~~cl~~dp~~RPs~~~i~~~L~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~--~~~~~~~w~~~~---- 349 (373)
T 2qol_A 278 ALYQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPGSLKIITSAAARPSNLLLD--QSNVDIT--TFRTTGDWLNGV---- 349 (373)
T ss_dssp HHHHHHHHHTCSSGGGSCCHHHHHHHHHHHHHCGGGGGSBCCC----CCCEEC---------------------------
T ss_pred HHHHHHHHHhCcChhhCcCHHHHHHHHHHHHhCccccccccCCCCCCcccccC--CCCcccc--CCCCHHHHHHhc----
Confidence 478999999999999999999999999999987654221 0000000000000 0111111 113445566554
Q ss_pred ccCcccccceEeeCCCCCChHHHHHHH
Q psy12232 81 NLDGEQMKYLIQVNPPGDILPEVIRAI 107 (202)
Q Consensus 81 ~l~~~~~~YLlqv~pp~~~~pe~vr~~ 107 (202)
...+|.-.|+..|....+.|..|
T Consensus 350 ----~~~~~~~~~~~~~~~~~~~~~~~ 372 (373)
T 2qol_A 350 ----WTAHCKEIFTGVEYSSCDTIAKI 372 (373)
T ss_dssp ---------------------------
T ss_pred ----cchHHHHHHHhcCCCcHHHHhcc
Confidence 36688888888887777766543
|
| >3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... | Back alignment and structure |
|---|
| >2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A | Back alignment and structure |
|---|
| >3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* | Back alignment and structure |
|---|
| >3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* | Back alignment and structure |
|---|
| >2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* | Back alignment and structure |
|---|
| >3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >3o21_A Glutamate receptor 3; periplasmatic binding protein, oligomerization, membrane, TR protein; HET: NAG; 2.20A {Rattus norvegicus} PDB: 3p3w_A | Back alignment and structure |
|---|
| >3saj_A Glutamate receptor 1; rossman fold, ION channel, membrane, transport protein; HET: NAG BMA MAN; 2.50A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3h6g_A Glutamate receptor, ionotropic kainate 2; membrane protein glycoprotein, cell junction, cell membrane, glycoprotein, ION transport; HET: NAG TLA; 2.70A {Rattus norvegicus} PDB: 3h6h_A* 3qlv_C 3qlu_C* 3qlt_A* 3olz_A* | Back alignment and structure |
|---|
| >4gpa_A Glutamate receptor 4; PBP fold, ligand-gated ION channel, ION transport, transmembrane AMPA receptor regulating proteins, cornichons, ckamp44; HET: NAG; 2.25A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3hsy_A Glutamate receptor 2; ligand-gated ION channel, synapse, cell CELL membrane, endoplasmic reticulum, glycoprotein, ION TRA ionic channel; HET: NAG BMA; 1.75A {Rattus norvegicus} PDB: 3h5v_A* 3h5w_A 3o2j_A* 2wjw_A* 2wjx_A 3n6v_A | Back alignment and structure |
|---|
| >2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} | Back alignment and structure |
|---|
| >4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3qel_B Glutamate [NMDA] receptor subunit epsilon-2; ION channel, allosteric modulation, phenylethanolamine, N-glycosylation, extracellular; HET: NAG BMA MAN FUC QEL; 2.60A {Rattus norvegicus} PDB: 3qem_B* 3jpw_A* 3jpy_A* | Back alignment and structure |
|---|
| >3qek_A NMDA glutamate receptor subunit; amino terminal domain, ION channel, NMDA receptor, allosteri modulation, phenylethanolamine, polyamine; HET: NAG BMA; 2.00A {Xenopus laevis} PDB: 3qel_A* 3qem_A* 3q41_A* | Back alignment and structure |
|---|
| >2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* | Back alignment and structure |
|---|
| >3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* | Back alignment and structure |
|---|
| >3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... | Back alignment and structure |
|---|
| >1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* | Back alignment and structure |
|---|
| >2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* | Back alignment and structure |
|---|
| >2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3kg2_A Glutamate receptor 2; ION channel, membrane protein, cell membrane, glycoprotein, transport, membrane, postsynaptic cell membrane, editing; HET: ZK1 NAG BMA; 3.60A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* | Back alignment and structure |
|---|
| >1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A | Back alignment and structure |
|---|
| >2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* | Back alignment and structure |
|---|
| >3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A | Back alignment and structure |
|---|
| >3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* | Back alignment and structure |
|---|
| >2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* | Back alignment and structure |
|---|
| >2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* | Back alignment and structure |
|---|
| >3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >3om0_A Glutamate receptor, ionotropic kainate 5; membrane protein, ION channel; HET: NAG BMA GOL; 1.40A {Rattus norvegicus} PDB: 3om1_A* 3qlu_A* 3qlv_A | Back alignment and structure |
|---|
| >2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A | Back alignment and structure |
|---|
| >3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} | Back alignment and structure |
|---|
| >3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* | Back alignment and structure |
|---|
| >2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A | Back alignment and structure |
|---|
| >3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A | Back alignment and structure |
|---|
| >3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* | Back alignment and structure |
|---|
| >1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >1dp4_A Atrial natriuretic peptide receptor A; periplasmic binding protein fold, dimer, hormone/growth FACT receptor, lyase complex; HET: NAG; 2.00A {Rattus norvegicus} SCOP: c.93.1.1 PDB: 1t34_A* 3a3k_A* | Back alignment and structure |
|---|
| >3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A | Back alignment and structure |
|---|
| >3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* | Back alignment and structure |
|---|
| >1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C | Back alignment and structure |
|---|
| >3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... | Back alignment and structure |
|---|
| >3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} | Back alignment and structure |
|---|
| >2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* | Back alignment and structure |
|---|
| >3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A | Back alignment and structure |
|---|
| >4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* | Back alignment and structure |
|---|
| >3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* | Back alignment and structure |
|---|
| >3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* | Back alignment and structure |
|---|
| >2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* | Back alignment and structure |
|---|
| >3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} | Back alignment and structure |
|---|
| >2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... | Back alignment and structure |
|---|
| >3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} | Back alignment and structure |
|---|
| >1jdp_A NPR-C, atrial natriuretic peptide clearance receptor; hormone-receptor complex, natriuretic peptide receptor, ALLO activation, signaling protein; HET: NDG NAG; 2.00A {Homo sapiens} SCOP: c.93.1.1 PDB: 1jdn_A* 1yk0_A* 1yk1_A* | Back alignment and structure |
|---|
| >4f11_A Gamma-aminobutyric acid type B receptor subunit 2; venus flytrap module, G-protein coupled receptor, signaling; 2.38A {Homo sapiens} PDB: 4f12_A* | Back alignment and structure |
|---|
| >1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* | Back alignment and structure |
|---|
| >2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A | Back alignment and structure |
|---|
| >3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* | Back alignment and structure |
|---|
| >2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B | Back alignment and structure |
|---|
| >3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 202 | ||||
| d1r0pa_ | 311 | d.144.1.7 (A:) Hepatocyte growth factor receptor, | 9e-05 | |
| d1fgka_ | 299 | d.144.1.7 (A:) Fibroblast growth factor receptor 1 | 3e-04 | |
| d1xkka_ | 317 | d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- | 0.002 | |
| d1qpca_ | 272 | d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom | 0.003 | |
| d1fmka3 | 285 | d.144.1.7 (A:249-533) c-src tyrosine kinase {Human | 0.004 |
| >d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Protein kinase-like (PK-like) superfamily: Protein kinase-like (PK-like) family: Protein kinases, catalytic subunit domain: Hepatocyte growth factor receptor, c-MET species: Human (Homo sapiens) [TaxId: 9606]
Score = 39.8 bits (92), Expect = 9e-05
Identities = 16/50 (32%), Positives = 28/50 (56%), Gaps = 4/50 (8%)
Query: 4 YELMRDCWSYVASERPEFIQLVSKLDRILTVTANEYLGQEYLELEAPLLD 53
YE+M CW A RP F +LVS++ I + ++G+ Y+ + A ++
Sbjct: 264 YEVMLKCWHPKAEMRPSFSELVSRISAIF----STFIGEHYVHVNATYVN 309
|
| >d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 | Back information, alignment and structure |
|---|
| >d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 | Back information, alignment and structure |
|---|
| >d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 | Back information, alignment and structure |
|---|
| >d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 202 | |||
| d1xkka_ | 317 | EGF receptor tyrosine kinase, Erbb-1 {Human (Homo | 97.82 | |
| d1u5ra_ | 309 | Serine/threonine protein kinase TAO2 {Rat (Rattus | 92.26 | |
| d1ewka_ | 477 | Metabotropic glutamate receptor subtype 1 {Rat (Ra | 89.45 | |
| d1a06a_ | 307 | Calmodulin-dependent protein kinase {Rat (Rattus n | 89.33 | |
| d2ozaa1 | 335 | MAP kinase activated protein kinase 2, mapkap2 {Hu | 88.5 | |
| d1koaa2 | 350 | Twitchin, kinase domain {Caenorhabditis elegans, p | 87.08 | |
| d1jdpa_ | 401 | Hormone binding domain of the atrial natriuretic p | 85.89 | |
| d1cm8a_ | 346 | MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: | 85.6 | |
| d1koba_ | 352 | Twitchin, kinase domain {California sea hare (Aply | 85.09 | |
| d1tkia_ | 321 | Titin, kinase domain {Human (Homo sapiens) [TaxId: | 83.85 | |
| d1q5ka_ | 350 | Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho | 83.82 | |
| d1m6ya2 | 192 | TM0872, methyltransferase domain {Thermotoga marit | 83.4 | |
| d2b1pa1 | 355 | c-jun N-terminal kinase (jnk3s) {Human (Homo sapie | 83.38 | |
| d1dp4a_ | 425 | Hormone binding domain of the atrial natriuretic p | 83.08 | |
| d1pmea_ | 345 | MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 | 81.95 |
| >d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Protein kinase-like (PK-like) superfamily: Protein kinase-like (PK-like) family: Protein kinases, catalytic subunit domain: EGF receptor tyrosine kinase, Erbb-1 species: Human (Homo sapiens) [TaxId: 9606]
Probab=97.82 E-value=1.8e-06 Score=72.38 Aligned_cols=36 Identities=25% Similarity=0.599 Sum_probs=32.5
Q ss_pred hHHHHHHHhchhcCCCCCCHHHHHHHHHHHhhhhcc
Q psy12232 2 SSYELMRDCWSYVASERPEFIQLVSKLDRILTVTAN 37 (202)
Q Consensus 2 ~LY~LM~~CW~~dP~~RPtF~eLv~~Le~ll~~~~~ 37 (202)
.+++||.+||+.+|.+||||.+|+..|..+.+++..
T Consensus 241 ~~~~li~~cl~~dP~~RPs~~eil~~l~~~~~~~~~ 276 (317)
T d1xkka_ 241 DVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQR 276 (317)
T ss_dssp HHHHHHHHHTCSSGGGSCCHHHHHHHHHHHHHSHHH
T ss_pred HHHHHHHHhCCCChhhCcCHHHHHHHHHHHHhChHh
Confidence 478999999999999999999999999998876643
|
| >d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ewka_ c.93.1.1 (A:) Metabotropic glutamate receptor subtype 1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1jdpa_ c.93.1.1 (A:) Hormone binding domain of the atrial natriuretic peptide receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} | Back information, alignment and structure |
|---|
| >d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dp4a_ c.93.1.1 (A:) Hormone binding domain of the atrial natriuretic peptide receptor {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|