Psyllid ID: psy12247
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 119 | ||||||
| 353530048 | 116 | ATG8-1 LC3-1 like protein [Echinococcus | 0.966 | 0.991 | 0.413 | 3e-23 | |
| 389604114 | 117 | autophagy related protein Atg8 [Helicove | 0.966 | 0.982 | 0.413 | 8e-21 | |
| 400073886 | 118 | autophagy related protein Atg8 [Galleria | 0.966 | 0.974 | 0.413 | 9e-21 | |
| 114052412 | 117 | autophagy related protein Atg8 [Bombyx m | 0.966 | 0.982 | 0.413 | 9e-21 | |
| 301015887 | 125 | Chain A, Crystal Structure Of Autophagy- | 0.966 | 0.92 | 0.413 | 1e-20 | |
| 357624756 | 117 | Autophagy-Related Protein Atg8 [Danaus p | 0.966 | 0.982 | 0.405 | 1e-20 | |
| 256084674 | 124 | gaba(A) receptor-associated protein [Sch | 0.966 | 0.927 | 0.413 | 2e-20 | |
| 242007202 | 117 | gamma-aminobutyric acid receptor-associa | 0.966 | 0.982 | 0.405 | 4e-20 | |
| 91085241 | 120 | PREDICTED: similar to putative GABA-A re | 0.991 | 0.983 | 0.394 | 5e-20 | |
| 345492299 | 117 | PREDICTED: gamma-aminobutyric acid recep | 0.966 | 0.982 | 0.396 | 6e-20 |
| >gi|353530048|gb|AER10558.1| ATG8-1 LC3-1 like protein [Echinococcus granulosus] gi|353530052|gb|AER10560.1| ATG8-1 LC3-1 like protein [Echinococcus multilocularis] | Back alignment and taxonomy information |
|---|
Score = 112 bits (280), Expect = 3e-23, Method: Compositional matrix adjust.
Identities = 48/116 (41%), Positives = 82/116 (70%), Gaps = 1/116 (0%)
Query: 1 MKFQYTEKYSLEERIKIGENLARNHPNCAFVILERSPSALLPQMPRSNYVVAYEMTVGHF 60
MKF Y ++ + EER++ GE +++ +PNC VI+E+SP A +P + R+ Y+V ++TVG F
Sbjct: 1 MKFAYKQERTFEERLQEGEKISKRYPNCVPVIVEKSPRANVPNLDRNKYLVPVDLTVGQF 60
Query: 61 FYLLRKKMALRPEEACFFFIESMIVPADSTRMETLSQRFADKDGLIYMVYSDVNIF 116
+YL+RK++ L+PE+A FFF+++ I P +T M L + + D D +Y+ YSD +++
Sbjct: 61 YYLIRKRIELKPEQALFFFVDNTIPPTSAT-MGALYEEYRDSDKFLYIAYSDESVY 115
|
Source: Echinococcus granulosus Species: Echinococcus granulosus Genus: Echinococcus Family: Taeniidae Order: Cyclophyllidea Class: Cestoda Phylum: Platyhelminthes Superkingdom: Eukaryota |
| >gi|389604114|gb|AFK91514.1| autophagy related protein Atg8 [Helicoverpa armigera] gi|389608575|dbj|BAM17897.1| autophagy-specific gene 8a [Papilio xuthus] | Back alignment and taxonomy information |
|---|
| >gi|400073886|gb|AFP66874.1| autophagy related protein Atg8 [Galleria mellonella] | Back alignment and taxonomy information |
|---|
| >gi|114052412|ref|NP_001040244.1| autophagy related protein Atg8 [Bombyx mori] gi|87248499|gb|ABD36302.1| gaba receptor protein [Bombyx mori] gi|213390050|gb|ACJ46064.1| autophagy related protein Atg8 [Bombyx mori] gi|226424978|gb|ACO53446.1| gamma-aminobutyric acid type A receptor-associated protein [Bombyx mori] | Back alignment and taxonomy information |
|---|
| >gi|301015887|pdb|3M95|A Chain A, Crystal Structure Of Autophagy-Related Protein Atg8 From The Silkworm Bombyx Mori gi|301015888|pdb|3M95|B Chain B, Crystal Structure Of Autophagy-Related Protein Atg8 From The Silkworm Bombyx Mori | Back alignment and taxonomy information |
|---|
| >gi|357624756|gb|EHJ75410.1| Autophagy-Related Protein Atg8 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|256084674|ref|XP_002578552.1| gaba(A) receptor-associated protein [Schistosoma mansoni] gi|353228674|emb|CCD74845.1| putative gaba(A) receptor-associated protein [Schistosoma mansoni] | Back alignment and taxonomy information |
|---|
| >gi|242007202|ref|XP_002424431.1| gamma-aminobutyric acid receptor-associated protein, putative [Pediculus humanus corporis] gi|212507831|gb|EEB11693.1| gamma-aminobutyric acid receptor-associated protein, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|91085241|ref|XP_973073.1| PREDICTED: similar to putative GABA-A receptor associated protein [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|345492299|ref|XP_003426810.1| PREDICTED: gamma-aminobutyric acid receptor-associated protein-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 119 | ||||||
| FB|FBgn0052672 | 121 | Atg8a "Autophagy-specific gene | 0.966 | 0.950 | 0.387 | 3e-21 | |
| UNIPROTKB|Q8HYB6 | 117 | GABARAPL1 "Gamma-aminobutyric | 0.966 | 0.982 | 0.387 | 3.5e-20 | |
| UNIPROTKB|F1P7N8 | 117 | GABARAPL1 "Uncharacterized pro | 0.966 | 0.982 | 0.387 | 3.5e-20 | |
| UNIPROTKB|Q9H0R8 | 117 | GABARAPL1 "Gamma-aminobutyric | 0.966 | 0.982 | 0.387 | 3.5e-20 | |
| MGI|MGI:1914980 | 117 | Gabarapl1 "gamma-aminobutyric | 0.966 | 0.982 | 0.387 | 3.5e-20 | |
| RGD|1596143 | 117 | Gabarapl1 "GABA(A) receptor-as | 0.966 | 0.982 | 0.387 | 3.5e-20 | |
| FB|FBgn0038539 | 158 | Atg8b "Autophagy-specific gene | 0.966 | 0.727 | 0.353 | 2.5e-19 | |
| ZFIN|ZDB-GENE-030131-5174 | 163 | gabarapa "GABA(A) receptor-ass | 0.983 | 0.717 | 0.364 | 2.5e-19 | |
| UNIPROTKB|Q9GJW7 | 117 | GABARAP "Gamma-aminobutyric ac | 0.966 | 0.982 | 0.362 | 8.3e-19 | |
| UNIPROTKB|F1Q2L2 | 117 | GABARAP "Uncharacterized prote | 0.966 | 0.982 | 0.362 | 8.3e-19 |
| FB|FBgn0052672 Atg8a "Autophagy-specific gene 8a" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 249 (92.7 bits), Expect = 3.0e-21, P = 3.0e-21
Identities = 45/116 (38%), Positives = 79/116 (68%)
Query: 1 MKFQYTEKYSLEERIKIGENLARNHPNCAFVILERSPSALLPQMPRSNYVVAYEMTVGHF 60
MKFQY E+++ E+R G+ + R +P+ VI+E++P A + + + Y+V ++TVG F
Sbjct: 1 MKFQYKEEHAFEKRRAEGDKIRRKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQF 60
Query: 61 FYLLRKKMALRPEEACFFFIESMIVPADSTRMETLSQRFADKDGLIYMVYSDVNIF 116
++L+RK++ LRPE+A FFF+ ++I P +T M +L Q ++D +Y+ YSD N++
Sbjct: 61 YFLIRKRIHLRPEDALFFFVNNVIPPTSAT-MGSLYQEHHEEDYFLYIAYSDENVY 115
|
|
| UNIPROTKB|Q8HYB6 GABARAPL1 "Gamma-aminobutyric acid receptor-associated protein-like 1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P7N8 GABARAPL1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9H0R8 GABARAPL1 "Gamma-aminobutyric acid receptor-associated protein-like 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1914980 Gabarapl1 "gamma-aminobutyric acid (GABA) A receptor-associated protein-like 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1596143 Gabarapl1 "GABA(A) receptor-associated protein like 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0038539 Atg8b "Autophagy-specific gene 8b" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-5174 gabarapa "GABA(A) receptor-associated protein a" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9GJW7 GABARAP "Gamma-aminobutyric acid receptor-associated protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1Q2L2 GABARAP "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 119 | |||
| cd01611 | 112 | cd01611, GABARAP, Ubiquitin domain of GABA-recepto | 6e-28 | |
| pfam02991 | 104 | pfam02991, Atg8, Autophagy protein Atg8 ubiquitin | 1e-25 | |
| cd01612 | 87 | cd01612, APG12_C, Ubiquitin-like domain of APG12 | 0.002 |
| >gnl|CDD|176355 cd01611, GABARAP, Ubiquitin domain of GABA-receptor-associated protein | Back alignment and domain information |
|---|
Score = 98.1 bits (245), Expect = 6e-28
Identities = 40/112 (35%), Positives = 65/112 (58%), Gaps = 1/112 (0%)
Query: 5 YTEKYSLEERIKIGENLARNHPNCAFVILERSPSALLPQMPRSNYVVAYEMTVGHFFYLL 64
+ E++ E+R E + +P+ VI+ER P + LP + + Y+V ++TVG F Y++
Sbjct: 1 FKERHPFEKRKAEVERIRAKYPDRIPVIVERYPKSDLPDLDKKKYLVPSDLTVGQFVYII 60
Query: 65 RKKMALRPEEACFFFIESMIVPADSTRMETLSQRFADKDGLIYMVYSDVNIF 116
RK++ LRPE+A F F+ + + P S M L + D+DG +YM YS F
Sbjct: 61 RKRIQLRPEKALFLFVNNSLPPT-SATMSQLYEEHKDEDGFLYMTYSSEETF 111
|
GABARAP (GABA-receptor-associated protein) belongs ot a large family of proteins that mediate intracellular membrane trafficking and/or fusion. GABARAP binds not only to GABA, type A but also to tubulin, gephrin, and ULK1. Orthologues of GABARAP include Gate-16 (golgi-associated ATPase enhancer), LC3 (microtubule-associated protein light chain 3), and ATG8 (autophagy protein 8). ATG8 is a ubiquitin-like protein that is conjugated to the membrane phospholipid, phosphatidylethanolamine as part of a ubiquitin-like conjugation system essential for autophagosome-formation. Length = 112 |
| >gnl|CDD|111837 pfam02991, Atg8, Autophagy protein Atg8 ubiquitin like | Back alignment and domain information |
|---|
| >gnl|CDD|176356 cd01612, APG12_C, Ubiquitin-like domain of APG12 | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 119 | |||
| KOG1654|consensus | 116 | 100.0 | ||
| cd01611 | 112 | GABARAP Ubiquitin domain of GABA-receptor-associat | 100.0 | |
| PTZ00380 | 121 | microtubule-associated protein (MAP); Provisional | 100.0 | |
| PF02991 | 104 | Atg8: Autophagy protein Atg8 ubiquitin like; Inter | 100.0 | |
| cd01612 | 87 | APG12_C Ubiquitin-like domain of APG12. APG12_C Th | 100.0 | |
| PF04110 | 87 | APG12: Ubiquitin-like autophagy protein Apg12 ; In | 99.94 | |
| KOG3439|consensus | 116 | 99.93 | ||
| PF04106 | 197 | APG5: Autophagy protein Apg5 ; InterPro: IPR007239 | 96.82 | |
| PF11816 | 331 | DUF3337: Domain of unknown function (DUF3337); Int | 95.32 | |
| PF11976 | 72 | Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; Inter | 93.59 | |
| cd06406 | 80 | PB1_P67 A PB1 domain is present in p67 proteins wh | 92.95 | |
| KOG2660|consensus | 331 | 90.89 | ||
| PF13019 | 162 | Telomere_Sde2: Telomere stability and silencing | 90.73 | |
| cd00196 | 69 | UBQ Ubiquitin-like proteins. Ubiquitin homologs; I | 88.87 | |
| smart00213 | 64 | UBQ Ubiquitin homologues. Ubiquitin-mediated prote | 88.6 | |
| PF00240 | 69 | ubiquitin: Ubiquitin family; InterPro: IPR000626 U | 87.34 | |
| KOG2976|consensus | 278 | 82.76 | ||
| cd01790 | 79 | Herp_N Homocysteine-responsive endoplasmic reticul | 80.74 | |
| PF03671 | 76 | Ufm1: Ubiquitin fold modifier 1 protein; InterPro: | 80.53 |
| >KOG1654|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=1e-54 Score=300.66 Aligned_cols=116 Identities=33% Similarity=0.605 Sum_probs=114.2
Q ss_pred CCCcccccCCHHHHHHHHHHHHhcCCCcceEEEEcCCCCCCCCCCcceEEecCCcchHhHHHHHHHhhcCCCCCeEEEEE
Q psy12247 1 MKFQYTEKYSLEERIKIGENLARNHPNCAFVILERSPSALLPQMPRSNYVVAYEMTVGHFFYLLRKKMALRPEEACFFFI 80 (119)
Q Consensus 1 m~~~fk~~~~~e~R~~e~~~ir~kyp~~ipVIvE~~~~~~~p~L~k~Kflvp~~~tv~~~~~~lRk~l~l~~~~slfl~V 80 (119)
|+++||++|||++|+.|+++||+|||+|||||||+++++++|.|||+|||||+++|||||+.+|||||+|+|++|+||||
T Consensus 1 ~~~~FK~~~~fe~R~~E~~~Ir~kyP~riPVIvEk~~~~~lp~lDK~KyLVP~dltvgqfi~iIRkRiqL~~~kA~flfV 80 (116)
T KOG1654|consen 1 MKSSFKERHPFEKRKAEVRRIREKYPDRIPVIVEKAGKSQLPDLDKKKYLVPDDLTVGQFIKIIRKRIQLSPEKAFFLFV 80 (116)
T ss_pred CcchhhccCCHHHHHHHHHHHHHHCCCCCcEEEEecccccCcccccceeeccccccHHHHHHHHHHHhccChhHeEEEEE
Confidence 78999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred cCeecCCcCchHHHHHhHhcCCCCeEEEEeccccccc
Q psy12247 81 ESMIVPADSTRMETLSQRFADKDGLIYMVYSDVNIFV 117 (119)
Q Consensus 81 n~~~~p~~~~~m~~lY~~~kd~DGfLyl~Ys~~~~fG 117 (119)
||.+ |+++++|++||+.+||+||||||+||+|+|||
T Consensus 81 n~~~-p~ts~~ms~~Ye~~kdeDgFLYm~Ys~e~tfG 116 (116)
T KOG1654|consen 81 NNTS-PPTSATMSALYEEEKDEDGFLYMTYSGENTFG 116 (116)
T ss_pred cCcC-CcchhhHHHHHHhhcccCcEEEEEeccccccC
Confidence 9999 77799999999999999999999999999999
|
|
| >cd01611 GABARAP Ubiquitin domain of GABA-receptor-associated protein | Back alignment and domain information |
|---|
| >PTZ00380 microtubule-associated protein (MAP); Provisional | Back alignment and domain information |
|---|
| >PF02991 Atg8: Autophagy protein Atg8 ubiquitin like; InterPro: IPR004241 Autophagy is generally known as a process involved in the degradation of bulk cytoplasmic components that are non-specifically sequestered into an autophagosome, where they are sequestered into double-membrane vesicles and delivered to the degradative organelle, the lysosome/vacuole, for breakdown and eventual recycling of the resulting macromolecules | Back alignment and domain information |
|---|
| >cd01612 APG12_C Ubiquitin-like domain of APG12 | Back alignment and domain information |
|---|
| >PF04110 APG12: Ubiquitin-like autophagy protein Apg12 ; InterPro: IPR007242 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >KOG3439|consensus | Back alignment and domain information |
|---|
| >PF04106 APG5: Autophagy protein Apg5 ; InterPro: IPR007239 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF11816 DUF3337: Domain of unknown function (DUF3337); InterPro: IPR021772 This family of proteins are functionally uncharacterised | Back alignment and domain information |
|---|
| >PF11976 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; InterPro: IPR022617 This entry includes small ubiquitin-related modifier (SUMO) proteins | Back alignment and domain information |
|---|
| >cd06406 PB1_P67 A PB1 domain is present in p67 proteins which forms a signaling complex with p40, a crucial step for activation of NADPH oxidase during phagocytosis | Back alignment and domain information |
|---|
| >KOG2660|consensus | Back alignment and domain information |
|---|
| >PF13019 Telomere_Sde2: Telomere stability and silencing | Back alignment and domain information |
|---|
| >cd00196 UBQ Ubiquitin-like proteins | Back alignment and domain information |
|---|
| >smart00213 UBQ Ubiquitin homologues | Back alignment and domain information |
|---|
| >PF00240 ubiquitin: Ubiquitin family; InterPro: IPR000626 Ubiquitinylation is an ATP-dependent process that involves the action of at least three enzymes: a ubiquitin-activating enzyme (E1, IPR000011 from INTERPRO), a ubiquitin-conjugating enzyme (E2, IPR000608 from INTERPRO), and a ubiquitin ligase (E3, IPR000569 from INTERPRO, IPR003613 from INTERPRO), which work sequentially in a cascade | Back alignment and domain information |
|---|
| >KOG2976|consensus | Back alignment and domain information |
|---|
| >cd01790 Herp_N Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain protein | Back alignment and domain information |
|---|
| >PF03671 Ufm1: Ubiquitin fold modifier 1 protein; InterPro: IPR005375 Ubiquitinylation is an ATP-dependent process that involves the action of at least three enzymes: a ubiquitin-activating enzyme (E1, IPR000011 from INTERPRO), a ubiquitin-conjugating enzyme (E2, IPR000608 from INTERPRO), and a ubiquitin ligase (E3, IPR000569 from INTERPRO, IPR003613 from INTERPRO), which work sequentially in a cascade | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 119 | ||||
| 3m95_A | 125 | Crystal Structure Of Autophagy-Related Protein Atg8 | 2e-23 | ||
| 2l8j_A | 119 | Gabarapl-1 Nbr1-Lir Complex Structure Length = 119 | 2e-20 | ||
| 2r2q_A | 110 | Crystal Structure Of Human Gamma-Aminobutyric Acid | 1e-19 | ||
| 1kot_A | 119 | Solution Structure Of Human Gaba Receptor Associate | 3e-19 | ||
| 1kjt_A | 119 | Crystal Structure Of The Gaba(A) Receptor Associate | 3e-19 | ||
| 1gnu_A | 117 | Gaba(a) Receptor Associated Protein Gabarap Length | 3e-19 | ||
| 2li5_A | 117 | Nmr Structure Of Atg8-Atg7c30 Complex Length = 117 | 3e-16 | ||
| 3vh3_B | 119 | Crystal Structure Of Atg7ctd-Atg8 Complex Length = | 3e-16 | ||
| 2kwc_A | 116 | The Nmr Structure Of The Autophagy-Related Protein | 3e-16 | ||
| 3rui_B | 118 | Crystal Structure Of Atg7c-Atg8 Complex Length = 11 | 3e-15 | ||
| 2zpn_A | 119 | The Crystal Structure Of Saccharomyces Cerevisiae A | 3e-15 | ||
| 2kq7_A | 119 | Solution Structure Of The Autophagy-Related Protein | 3e-15 | ||
| 1eo6_A | 117 | Crystal Structure Of Gate-16 Length = 117 | 2e-13 | ||
| 3h9d_A | 119 | Crystal Structure Of Trypanosoma Brucei Atg8 Length | 5e-11 | ||
| 3vvw_B | 128 | Ndp52 In Complex With Lc3c Length = 128 | 9e-09 | ||
| 4eoy_A | 128 | Plasmodium Falciparum Atg8 In Complex With Plasmodi | 1e-07 | ||
| 3eci_A | 122 | Microtubule-Associated Protein 1 Light Chain 3 Alph | 1e-07 | ||
| 2k6q_A | 121 | Lc3 P62 Complex Structure Length = 121 | 2e-06 | ||
| 1ugm_A | 125 | Crystal Structure Of Lc3 Length = 125 | 2e-06 | ||
| 2z0e_B | 129 | The Crystal Structure Of Human Atg4b- Lc3(1-124) Co | 2e-06 | ||
| 1v49_A | 120 | Solution Structure Of Microtubule-Associated Protei | 2e-06 | ||
| 2zjd_A | 130 | Crystal Structure Of Lc3-P62 Complex Length = 130 | 3e-06 |
| >pdb|3M95|A Chain A, Crystal Structure Of Autophagy-Related Protein Atg8 From The Silkworm Bombyx Mori Length = 125 | Back alignment and structure |
|
| >pdb|2L8J|A Chain A, Gabarapl-1 Nbr1-Lir Complex Structure Length = 119 | Back alignment and structure |
| >pdb|2R2Q|A Chain A, Crystal Structure Of Human Gamma-Aminobutyric Acid Receptor- Associated Protein-Like 1 (Gabarap1), Isoform Cra_a Length = 110 | Back alignment and structure |
| >pdb|1KOT|A Chain A, Solution Structure Of Human Gaba Receptor Associated Protein Gabarap Length = 119 | Back alignment and structure |
| >pdb|1KJT|A Chain A, Crystal Structure Of The Gaba(A) Receptor Associated Protein, Gabarap Length = 119 | Back alignment and structure |
| >pdb|1GNU|A Chain A, Gaba(a) Receptor Associated Protein Gabarap Length = 117 | Back alignment and structure |
| >pdb|2LI5|A Chain A, Nmr Structure Of Atg8-Atg7c30 Complex Length = 117 | Back alignment and structure |
| >pdb|3VH3|B Chain B, Crystal Structure Of Atg7ctd-Atg8 Complex Length = 119 | Back alignment and structure |
| >pdb|2KWC|A Chain A, The Nmr Structure Of The Autophagy-Related Protein Atg8 Length = 116 | Back alignment and structure |
| >pdb|3RUI|B Chain B, Crystal Structure Of Atg7c-Atg8 Complex Length = 118 | Back alignment and structure |
| >pdb|2ZPN|A Chain A, The Crystal Structure Of Saccharomyces Cerevisiae Atg8- Atg19(412-415) Complex Length = 119 | Back alignment and structure |
| >pdb|2KQ7|A Chain A, Solution Structure Of The Autophagy-Related Protein Atg8 Length = 119 | Back alignment and structure |
| >pdb|1EO6|A Chain A, Crystal Structure Of Gate-16 Length = 117 | Back alignment and structure |
| >pdb|3H9D|A Chain A, Crystal Structure Of Trypanosoma Brucei Atg8 Length = 119 | Back alignment and structure |
| >pdb|3VVW|B Chain B, Ndp52 In Complex With Lc3c Length = 128 | Back alignment and structure |
| >pdb|4EOY|A Chain A, Plasmodium Falciparum Atg8 In Complex With Plasmodium Falciparum Atg3 Peptide Length = 128 | Back alignment and structure |
| >pdb|3ECI|A Chain A, Microtubule-Associated Protein 1 Light Chain 3 Alpha Isoform A (Map1alc3) Length = 122 | Back alignment and structure |
| >pdb|2K6Q|A Chain A, Lc3 P62 Complex Structure Length = 121 | Back alignment and structure |
| >pdb|1UGM|A Chain A, Crystal Structure Of Lc3 Length = 125 | Back alignment and structure |
| >pdb|2Z0E|B Chain B, The Crystal Structure Of Human Atg4b- Lc3(1-124) Complex Length = 129 | Back alignment and structure |
| >pdb|1V49|A Chain A, Solution Structure Of Microtubule-Associated Protein Light Chain-3 Length = 120 | Back alignment and structure |
| >pdb|2ZJD|A Chain A, Crystal Structure Of Lc3-P62 Complex Length = 130 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 119 | |||
| 3rui_B | 118 | Autophagy-related protein 8; autophagosome formati | 3e-25 | |
| 3m95_A | 125 | Autophagy related protein ATG8; alpha slash beta, | 1e-24 | |
| 1eo6_A | 117 | GATE-16, golgi-associated ATPase enhancer of 16 KD | 3e-24 | |
| 2r2q_A | 110 | Gamma-aminobutyric acid receptor-associated protei | 3e-23 | |
| 2zjd_A | 130 | Microtubule-associated proteins 1A/1B light chain | 7e-23 | |
| 3h9d_A | 119 | ATG8, microtubule-associated protein 1A/1B, light | 9e-23 |
| >3rui_B Autophagy-related protein 8; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 2kq7_A 2zpn_A 2kwc_A 2li5_A 3vh3_B 3vh4_B* Length = 118 | Back alignment and structure |
|---|
Score = 90.8 bits (225), Expect = 3e-25
Identities = 39/116 (33%), Positives = 64/116 (55%), Gaps = 1/116 (0%)
Query: 1 MKFQYTEKYSLEERIKIGENLARNHPNCAFVILERSPSALLPQMPRSNYVVAYEMTVGHF 60
MK + +Y E+R E +A N VI E++ + +P++ + Y+V ++TVG F
Sbjct: 3 MKSTFKSEYPFEKRKAESERIADRFKNRIPVICEKAEKSDIPEIDKRKYLVPADLTVGQF 62
Query: 61 FYLLRKKMALRPEEACFFFIESMIVPADSTRMETLSQRFADKDGLIYMVYSDVNIF 116
Y++RK++ L PE+A F F+ + P + M + Q DKDG +Y+ YS N F
Sbjct: 63 VYVIRKRIMLPPEKAIFIFVNDTLPPTAAL-MSAIYQEHKDKDGFLYVTYSGENTF 117
|
| >3m95_A Autophagy related protein ATG8; alpha slash beta, receptor, transport protein; 2.40A {Bombyx mori} Length = 125 | Back alignment and structure |
|---|
| >1eo6_A GATE-16, golgi-associated ATPase enhancer of 16 KD; ubiquitin fold, protein binding; 1.80A {Bos taurus} SCOP: d.15.1.3 Length = 117 | Back alignment and structure |
|---|
| >2r2q_A Gamma-aminobutyric acid receptor-associated protein-like 1; autophagy, ubiquitin homolog, structural genomics consortium, SGC, microtubule; 1.65A {Homo sapiens} PDB: 2l8j_A 1kjt_A 1kot_A 3d32_A 3dow_A 1gnu_A 1klv_A 1km7_A Length = 110 | Back alignment and structure |
|---|
| >2zjd_A Microtubule-associated proteins 1A/1B light chain 3B precursor; autophagy, LC3, microtubule-associated protein 1 light chain 3, cytoplasm, cytoplasmic vesicle, lipoprotein; 1.56A {Homo sapiens} SCOP: d.15.1.3 PDB: 2z0e_B 2zzp_B 2z0d_B 1ugm_A 1v49_A 2k6q_A 3eci_A Length = 130 | Back alignment and structure |
|---|
| >3h9d_A ATG8, microtubule-associated protein 1A/1B, light chain putative; autophagy, lipidation, ubiquitin-like, S protein; 2.30A {Trypanosoma brucei} Length = 119 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 119 | |||
| 3rui_B | 118 | Autophagy-related protein 8; autophagosome formati | 100.0 | |
| 3m95_A | 125 | Autophagy related protein ATG8; alpha slash beta, | 100.0 | |
| 3h9d_A | 119 | ATG8, microtubule-associated protein 1A/1B, light | 100.0 | |
| 1eo6_A | 117 | GATE-16, golgi-associated ATPase enhancer of 16 KD | 100.0 | |
| 2zjd_A | 130 | Microtubule-associated proteins 1A/1B light chain | 100.0 | |
| 2r2q_A | 110 | Gamma-aminobutyric acid receptor-associated protei | 100.0 | |
| 4gdk_A | 91 | Ubiquitin-like protein ATG12; protein-protein conj | 100.0 | |
| 1wz3_A | 96 | Autophagy 12B, ATG12B, APG12B; ubiquitin-fold, pla | 100.0 | |
| 3w1s_C | 91 | Ubiquitin-like protein ATG12; ubiquitin fold, E3-l | 100.0 | |
| 2dyo_A | 297 | Autophagy protein 5; ubiquitin-fold, herix-bundle, | 95.85 | |
| 4gdk_B | 275 | Autophagy protein 5; protein-protein conjugate, pr | 95.52 | |
| 3vqi_A | 274 | ATG5; autophagy, E3-like, ubiquitin-fold, PRE-auto | 94.97 | |
| 3goe_A | 82 | DNA repair protein RAD60; SUMO-like domain, sumoyl | 93.93 | |
| 1oey_A | 83 | P67-PHOX, neutrophil cytosol factor 2; immune syst | 89.47 | |
| 1q1o_A | 98 | Cell division control protein 24; PB1 domain, PCCR | 86.76 | |
| 2uyz_B | 79 | Small ubiquitin-related modifier 1; sumoylation, c | 86.65 | |
| 3a4r_A | 79 | Nfatc2-interacting protein; ubiquitin fold, coiled | 85.77 | |
| 1wh3_A | 87 | 59 kDa 2'-5'-oligoadenylate synthetase like protei | 84.88 | |
| 1wy8_A | 89 | NP95-like ring finger protein, isoform A; ubiquiti | 83.59 | |
| 1uh6_A | 100 | Ubiquitin-like 5; beta-grAsp fold, structural geno | 82.46 | |
| 3mtn_B | 85 | UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit | 82.14 | |
| 1we7_A | 115 | SF3A1 protein; structural genomics, ubiquitin-like | 82.0 | |
| 1ndd_A | 76 | NEDD8, protein (ubiquitin-like protein NEDD8); pro | 81.37 | |
| 3n3k_B | 85 | Ubiquitin; hydrolase, protease, thiol protease, DU | 80.91 | |
| 1wyw_B | 97 | Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Ho | 80.84 | |
| 3a9j_A | 76 | Ubiquitin; protein complex, cytoplasm, isopeptide | 80.55 |
| >3rui_B Autophagy-related protein 8; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} SCOP: d.15.1.3 PDB: 2kq7_A 2zpn_A 3vxw_A 2kwc_A 2li5_A 3vh3_B 3vh4_B* | Back alignment and structure |
|---|
Probab=100.00 E-value=1.5e-55 Score=309.59 Aligned_cols=116 Identities=34% Similarity=0.641 Sum_probs=111.6
Q ss_pred CCCcccccCCHHHHHHHHHHHHhcCCCcceEEEEcCCCCCCCCCCcceEEecCCcchHhHHHHHHHhhcCCCCCeEEEEE
Q psy12247 1 MKFQYTEKYSLEERIKIGENLARNHPNCAFVILERSPSALLPQMPRSNYVVAYEMTVGHFFYLLRKKMALRPEEACFFFI 80 (119)
Q Consensus 1 m~~~fk~~~~~e~R~~e~~~ir~kyp~~ipVIvE~~~~~~~p~L~k~Kflvp~~~tv~~~~~~lRk~l~l~~~~slfl~V 80 (119)
|+++||++||||+|++|+++||+|||++||||||+++++++|.|+++|||||+++||+||+.+||++|+|++++||||||
T Consensus 3 m~~~fK~~~~~e~R~~e~~~ir~kyP~riPVIvE~~~~~~~P~ldk~KflVp~~~tv~qf~~~iRkrl~l~~~~alFl~V 82 (118)
T 3rui_B 3 MKSTFKSEYPFEKRKAESERIADRFKNRIPVICEKAEKSDIPEIDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFV 82 (118)
T ss_dssp ---CCTTSSCHHHHHHHHHHHHHHCSSEEEEEEEECTTCCSCCCSCCEEEEETTSBHHHHHHHHHHHTTCCTTCCEEEEB
T ss_pred CcchhhccCCHHHHHHHHHHHHHhCCCceEEEEEeCCCCCCCccccceEEcCCCCCHHHHHHHHHHHhCcCCCccEEEEE
Confidence 89999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred cCeecCCcCchHHHHHhHhcCCCCeEEEEeccccccc
Q psy12247 81 ESMIVPADSTRMETLSQRFADKDGLIYMVYSDVNIFV 117 (119)
Q Consensus 81 n~~~~p~~~~~m~~lY~~~kd~DGfLyl~Ys~~~~fG 117 (119)
||. +|++|++||+||++|||+||||||+||+++|||
T Consensus 83 n~~-~p~~~~~m~~lY~~~kdeDGfLyv~Ys~~~~fG 118 (118)
T 3rui_B 83 NDT-LPPTAALMSAIYQEHKDKDGFLYVTYSGENTFG 118 (118)
T ss_dssp TTB-CCCTTSBHHHHHHHHCCTTSCEEEEEEECCCBC
T ss_pred CCc-cCCccchHHHHHHHcCCCCCeEEEEEeccccCC
Confidence 996 599999999999999999999999999999999
|
| >3m95_A Autophagy related protein ATG8; alpha slash beta, receptor, transport protein; 2.40A {Bombyx mori} SCOP: d.15.1.3 | Back alignment and structure |
|---|
| >3h9d_A ATG8, microtubule-associated protein 1A/1B, light chain putative; autophagy, lipidation, ubiquitin-like, S protein; 2.30A {Trypanosoma brucei} SCOP: d.15.1.0 | Back alignment and structure |
|---|
| >1eo6_A GATE-16, golgi-associated ATPase enhancer of 16 KD; ubiquitin fold, protein binding; 1.80A {Bos taurus} SCOP: d.15.1.3 | Back alignment and structure |
|---|
| >2zjd_A Microtubule-associated proteins 1A/1B light chain 3B precursor; autophagy, LC3, microtubule-associated protein 1 light chain 3, cytoplasm, cytoplasmic vesicle, lipoprotein; 1.56A {Homo sapiens} SCOP: d.15.1.3 PDB: 2z0e_B 2zzp_B 2z0d_B 1ugm_A 1v49_A 2k6q_A 3eci_A | Back alignment and structure |
|---|
| >2r2q_A Gamma-aminobutyric acid receptor-associated protein-like 1; autophagy, ubiquitin homolog, structural genomics consortium, SGC, microtubule; 1.65A {Homo sapiens} PDB: 2l8j_A 1kjt_A 1kot_A 3d32_A 3dow_A 1gnu_A 1klv_A 1km7_A | Back alignment and structure |
|---|
| >4gdk_A Ubiquitin-like protein ATG12; protein-protein conjugate, protein-protein complex, ubiquiti protein, E3 ligase, ubiquitin-like fold; 2.70A {Homo sapiens} PDB: 4gdl_A | Back alignment and structure |
|---|
| >1wz3_A Autophagy 12B, ATG12B, APG12B; ubiquitin-fold, plant protein; 1.80A {Arabidopsis thaliana} SCOP: d.15.1.7 | Back alignment and structure |
|---|
| >3w1s_C Ubiquitin-like protein ATG12; ubiquitin fold, E3-like, ATG3 binding, isopeptide bond betwe Gly186 and ATG5 Lys149, ligase; 2.60A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2dyo_A Autophagy protein 5; ubiquitin-fold, herix-bundle, protein turnover/protein turnover complex; 1.97A {Saccharomyces cerevisiae} PDB: 2dym_A | Back alignment and structure |
|---|
| >4gdk_B Autophagy protein 5; protein-protein conjugate, protein-protein complex, ubiquiti protein, E3 ligase, ubiquitin-like fold; 2.70A {Homo sapiens} PDB: 4gdl_B | Back alignment and structure |
|---|
| >3vqi_A ATG5; autophagy, E3-like, ubiquitin-fold, PRE-autoph structure, protein turnover, protein transport; HET: EPE; 2.50A {Kluyveromyces marxianus} | Back alignment and structure |
|---|
| >3goe_A DNA repair protein RAD60; SUMO-like domain, sumoylation, SUMO, genome stability, DNA damage, DNA recombination, nucleus; HET: DNA; 0.97A {Schizosaccharomyces pombe} PDB: 3rcz_A* | Back alignment and structure |
|---|
| >1oey_A P67-PHOX, neutrophil cytosol factor 2; immune system, PB1 heterodimer/complex, NADPH oxidase, PB1 D heterodimerization; 2.0A {Homo sapiens} SCOP: d.15.2.2 | Back alignment and structure |
|---|
| >1q1o_A Cell division control protein 24; PB1 domain, PCCR, PC motif, OPCA motif, yeast, cell polarity, protein-protein interaction; NMR {Saccharomyces cerevisiae} SCOP: d.15.2.2 PDB: 2kfj_A 2kfk_B | Back alignment and structure |
|---|
| >2uyz_B Small ubiquitin-related modifier 1; sumoylation, cell division, nuclear protein, ubiquitin-like modifier, UBL conjugation pathway; 1.4A {Homo sapiens} SCOP: d.15.1.1 PDB: 2vrr_B 2iy0_B 2iy1_B 2g4d_B 2las_A 2io2_B 1z5s_B 3uip_B* 1tgz_B* 2bf8_B | Back alignment and structure |
|---|
| >3a4r_A Nfatc2-interacting protein; ubiquitin fold, coiled coil, cytoplasm, methylation, nucleus, transcription; 1.00A {Mus musculus} PDB: 3a4s_C 3rd2_A | Back alignment and structure |
|---|
| >1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1wy8_A NP95-like ring finger protein, isoform A; ubiquitin-like domain, NP95/ICBP90-like ring finger (NIRF), ubiquitin ligase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1uh6_A Ubiquitin-like 5; beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1we7_A SF3A1 protein; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 1zkh_A | Back alignment and structure |
|---|
| >1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A | Back alignment and structure |
|---|
| >3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1wyw_B Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 1y8r_C* 2asq_A 2pe6_B 1a5r_A 2kqs_A 3kyc_D* 3rzw_C | Back alignment and structure |
|---|
| >3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ... | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 119 | ||||
| d1eo6a_ | 116 | d.15.1.3 (A:) Golgi-associated ATPase enhancer of | 7e-28 | |
| d3d32a1 | 118 | d.15.1.3 (A:1-118) GABA(A) receptor associated pro | 4e-27 | |
| d2zjda1 | 119 | d.15.1.3 (A:2-120) Microtubule-associated proteins | 2e-21 |
| >d1eo6a_ d.15.1.3 (A:) Golgi-associated ATPase enhancer of 16 kD, Gate-16 {Cow (Bos taurus) [TaxId: 9913]} Length = 116 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: beta-Grasp (ubiquitin-like) superfamily: Ubiquitin-like family: GABARAP-like domain: Golgi-associated ATPase enhancer of 16 kD, Gate-16 species: Cow (Bos taurus) [TaxId: 9913]
Score = 96.3 bits (240), Expect = 7e-28
Identities = 34/116 (29%), Positives = 64/116 (55%), Gaps = 1/116 (0%)
Query: 1 MKFQYTEKYSLEERIKIGENLARNHPNCAFVILERSPSALLPQMPRSNYVVAYEMTVGHF 60
MK+ + E +SLE R + +P+ VI+E+ + + + + Y+V ++TV F
Sbjct: 1 MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQF 60
Query: 61 FYLLRKKMALRPEEACFFFIESMIVPADSTRMETLSQRFADKDGLIYMVYSDVNIF 116
+++RK++ L E+A F F++ + + T M L ++ D+DG +Y+ YS N F
Sbjct: 61 MWIIRKRIQLPSEKAIFLFVDKTVPQSSLT-MGQLYEKEKDEDGFLYVAYSGENTF 115
|
| >d3d32a1 d.15.1.3 (A:1-118) GABA(A) receptor associated protein GABARAP {Human (Homo sapiens) [TaxId: 9606]} Length = 118 | Back information, alignment and structure |
|---|
| >d2zjda1 d.15.1.3 (A:2-120) Microtubule-associated proteins 1A/1B light chain 3B {Human (Homo sapiens) [TaxId: 9606]} Length = 119 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 119 | |||
| d3d32a1 | 118 | GABA(A) receptor associated protein GABARAP {Human | 100.0 | |
| d1eo6a_ | 116 | Golgi-associated ATPase enhancer of 16 kD, Gate-16 | 100.0 | |
| d2zjda1 | 119 | Microtubule-associated proteins 1A/1B light chain | 100.0 | |
| d1wz3a1 | 84 | Autophagy-related protein 12b (APG12b) {Thale cres | 99.92 | |
| d1euvb_ | 79 | SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomy | 90.11 | |
| d1m94a_ | 73 | Ubiquitin-like modifier protein hub1 {Baker's yeas | 90.1 | |
| d1wx8a1 | 83 | 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] | 86.97 | |
| d1wh3a_ | 87 | 2'-5'-oligoadenylate synthetase-like protein, OASL | 85.76 | |
| d2uyzb1 | 77 | SUMO-1 (smt3 homologue) {Human (Homo sapiens) [Tax | 85.1 | |
| d1wxva1 | 81 | Bag-family molecular chaperone regulator-1 {Human | 84.72 | |
| d1yqba1 | 84 | Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} | 84.05 | |
| d1v5oa_ | 102 | 1700011n24rik protein {Mouse (Mus musculus) [TaxId | 83.94 | |
| d1ttna1 | 80 | Dendritic cell-derived ubiquitin-like protein {Hum | 83.9 | |
| d1uh6a_ | 100 | Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculu | 83.56 | |
| d1wy8a1 | 76 | Ubiquitin-like PHD and RING finger domain-containi | 83.13 | |
| d1j8ca_ | 103 | Ubiquitin-like N-terminal domain of PLIC-2 {Human | 82.79 | |
| d1wjua_ | 100 | NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens | 81.64 | |
| d1z2ma2 | 76 | Interferon-induced 15 kDa protein {Human (Homo sap | 81.59 | |
| d1wx9a1 | 73 | Large proline-rich protein BAT3 {Human (Homo sapie | 80.67 |
| >d3d32a1 d.15.1.3 (A:1-118) GABA(A) receptor associated protein GABARAP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: beta-Grasp (ubiquitin-like) superfamily: Ubiquitin-like family: GABARAP-like domain: GABA(A) receptor associated protein GABARAP species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=1.6e-54 Score=302.77 Aligned_cols=116 Identities=36% Similarity=0.722 Sum_probs=114.6
Q ss_pred CCCcccccCCHHHHHHHHHHHHhcCCCcceEEEEcCCCCCCCCCCcceEEecCCcchHhHHHHHHHhhcCCCCCeEEEEE
Q psy12247 1 MKFQYTEKYSLEERIKIGENLARNHPNCAFVILERSPSALLPQMPRSNYVVAYEMTVGHFFYLLRKKMALRPEEACFFFI 80 (119)
Q Consensus 1 m~~~fk~~~~~e~R~~e~~~ir~kyp~~ipVIvE~~~~~~~p~L~k~Kflvp~~~tv~~~~~~lRk~l~l~~~~slfl~V 80 (119)
|+++||++||||+|++|+++|++|||+|||||||+++++++|.|+++|||||.|+||+||+++||++|+|++++||||||
T Consensus 3 m~~~fk~~~s~e~R~~es~~i~~KyPdriPVIve~~~~s~lp~ldk~KflVp~d~tv~qf~~~iRkrl~l~~~~alflfv 82 (118)
T d3d32a1 3 MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFV 82 (118)
T ss_dssp SCCHHHHHSCHHHHHHHHHHHHHHCTTEEEEEEEECTTCCSCCCSCSEEEEETTCBHHHHHHHHHHHHTCCTTSCCEEEB
T ss_pred ccchhcccCCHHHHHHHHHHHHHHCCCCceEEEEEcCCCCCcccccceEEecCCccHHHHHHHHHHHhCCCccceEEEEE
Confidence 89999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred cCeecCCcCchHHHHHhHhcCCCCeEEEEeccccccc
Q psy12247 81 ESMIVPADSTRMETLSQRFADKDGLIYMVYSDVNIFV 117 (119)
Q Consensus 81 n~~~~p~~~~~m~~lY~~~kd~DGfLyl~Ys~~~~fG 117 (119)
||++ |+++++||+||++|||+||||||+||+|||||
T Consensus 83 n~~~-~~~~~ti~~lY~~~kdeDGfLYi~Ys~entFG 118 (118)
T d3d32a1 83 NNVI-PPTSATMGQLYQEHHEEDFFLYIAYSDESVYG 118 (118)
T ss_dssp TTBC-CCTTCBHHHHHHHHCCTTSCEEEEEESCTTCC
T ss_pred CCcc-cCccccHHHHHHHhCCCCcEEEEEEecccccC
Confidence 9998 88999999999999999999999999999999
|
| >d1eo6a_ d.15.1.3 (A:) Golgi-associated ATPase enhancer of 16 kD, Gate-16 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2zjda1 d.15.1.3 (A:2-120) Microtubule-associated proteins 1A/1B light chain 3B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wz3a1 d.15.1.7 (A:10-93) Autophagy-related protein 12b (APG12b) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1m94a_ d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wh3a_ d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2uyzb1 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wxva1 d.15.1.1 (A:7-87) Bag-family molecular chaperone regulator-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yqba1 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5oa_ d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ttna1 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquitin-like protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wy8a1 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING finger domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wjua_ d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|