Psyllid ID: psy12265
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 71 | ||||||
| 383853992 | 649 | PREDICTED: zinc finger protein 195-like | 0.774 | 0.084 | 0.767 | 1e-20 | |
| 350411473 | 647 | PREDICTED: zinc finger protein 45-like [ | 0.774 | 0.085 | 0.767 | 2e-20 | |
| 340729771 | 647 | PREDICTED: zinc finger protein 45-like [ | 0.887 | 0.097 | 0.687 | 3e-20 | |
| 328787424 | 646 | PREDICTED: zinc finger protein 227-like | 0.774 | 0.085 | 0.767 | 3e-20 | |
| 380020763 | 644 | PREDICTED: zinc finger protein 227-like | 0.774 | 0.085 | 0.767 | 4e-20 | |
| 242009920 | 900 | zinc finger protein, putative [Pediculus | 0.887 | 0.07 | 0.687 | 2e-19 | |
| 332016289 | 642 | Zinc finger protein 192 [Acromyrmex echi | 0.690 | 0.076 | 0.75 | 2e-19 | |
| 328722486 | 756 | PREDICTED: zinc finger protein 611-like | 0.774 | 0.072 | 0.785 | 6e-19 | |
| 270005714 | 779 | hypothetical protein TcasGA2_TC007815 [T | 0.690 | 0.062 | 0.75 | 2e-18 | |
| 91080335 | 696 | PREDICTED: similar to AGAP010009-PA [Tri | 0.690 | 0.070 | 0.75 | 5e-18 |
| >gi|383853992|ref|XP_003702506.1| PREDICTED: zinc finger protein 195-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
Score = 103 bits (257), Expect = 1e-20, Method: Composition-based stats.
Identities = 43/56 (76%), Positives = 47/56 (83%)
Query: 7 LKVHNRVHLGLKPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARKY 62
LKVH R+H G KPY CE CGRHFRQWGDLKYH S+HS+ K +QCEYCGKDFARKY
Sbjct: 428 LKVHKRLHSGDKPYKCEECGRHFRQWGDLKYHSTSIHSEQKQYQCEYCGKDFARKY 483
|
Source: Megachile rotundata Species: Megachile rotundata Genus: Megachile Family: Megachilidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|350411473|ref|XP_003489363.1| PREDICTED: zinc finger protein 45-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|340729771|ref|XP_003403169.1| PREDICTED: zinc finger protein 45-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|328787424|ref|XP_395120.3| PREDICTED: zinc finger protein 227-like [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|380020763|ref|XP_003694248.1| PREDICTED: zinc finger protein 227-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|242009920|ref|XP_002425730.1| zinc finger protein, putative [Pediculus humanus corporis] gi|212509631|gb|EEB12992.1| zinc finger protein, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|332016289|gb|EGI57202.1| Zinc finger protein 192 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|328722486|ref|XP_001946974.2| PREDICTED: zinc finger protein 611-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|270005714|gb|EFA02162.1| hypothetical protein TcasGA2_TC007815 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|91080335|ref|XP_974602.1| PREDICTED: similar to AGAP010009-PA [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 71 | ||||||
| FB|FBgn0031573 | 714 | CG3407 [Drosophila melanogaste | 0.901 | 0.089 | 0.562 | 4.1e-16 | |
| UNIPROTKB|E1BCC4 | 646 | LOC787057 "Uncharacterized pro | 0.915 | 0.100 | 0.449 | 6.9e-12 | |
| RGD|620595 | 744 | Zfp111 "zinc finger protein 11 | 0.887 | 0.084 | 0.421 | 3.8e-11 | |
| UNIPROTKB|G3V9G6 | 744 | Zfp111 "Protein Zfp111" [Rattu | 0.887 | 0.084 | 0.421 | 3.8e-11 | |
| UNIPROTKB|F1LYN5 | 149 | F1LYN5 "Uncharacterized protei | 0.915 | 0.436 | 0.378 | 4.5e-11 | |
| UNIPROTKB|I3L6L1 | 650 | ZNF226 "Uncharacterized protei | 0.816 | 0.089 | 0.524 | 6.5e-11 | |
| UNIPROTKB|J9P2R7 | 668 | ZNF234 "Uncharacterized protei | 0.887 | 0.094 | 0.453 | 6.8e-11 | |
| UNIPROTKB|Q9NYT6 | 803 | ZNF226 "Zinc finger protein 22 | 0.816 | 0.072 | 0.524 | 8.8e-11 | |
| UNIPROTKB|J9P984 | 805 | ZNF226 "Uncharacterized protei | 0.816 | 0.072 | 0.524 | 8.8e-11 | |
| ZFIN|ZDB-GENE-071004-59 | 217 | zgc:173620 "zgc:173620" [Danio | 0.887 | 0.290 | 0.421 | 9.4e-11 |
| FB|FBgn0031573 CG3407 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 211 (79.3 bits), Expect = 4.1e-16, P = 4.1e-16
Identities = 36/64 (56%), Positives = 44/64 (68%)
Query: 7 LKVHNRVHLGLKPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARKYQAHS 66
LK H R H G+KP+ C+ C FRQWGDLKYH S HSDVKA CE+CGK F+R+Y
Sbjct: 538 LKAHERTHSGVKPFKCDKCEFQFRQWGDLKYHIISRHSDVKAHMCEFCGKSFSRRYSLVV 597
Query: 67 YHQI 70
+ +I
Sbjct: 598 HRRI 601
|
|
| UNIPROTKB|E1BCC4 LOC787057 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| RGD|620595 Zfp111 "zinc finger protein 111" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3V9G6 Zfp111 "Protein Zfp111" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1LYN5 F1LYN5 "Uncharacterized protein" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3L6L1 ZNF226 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9P2R7 ZNF234 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9NYT6 ZNF226 "Zinc finger protein 226" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9P984 ZNF226 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-071004-59 zgc:173620 "zgc:173620" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 71 | |||
| COG5189 | 423 | COG5189, SFP1, Putative transcriptional repressor | 0.001 |
| >gnl|CDD|227516 COG5189, SFP1, Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
Score = 34.7 bits (79), Expect = 0.001
Identities = 13/34 (38%), Positives = 17/34 (50%)
Query: 10 HNRVHLGLKPYGCEVCGRHFRQWGDLKYHKASLH 43
N KPY CEVC + ++ LKYH+ H
Sbjct: 389 MNIFSAKDKPYRCEVCDKRYKNLNGLKYHRKHSH 422
|
Length = 423 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 71 | |||
| KOG2462|consensus | 279 | 99.86 | ||
| KOG2462|consensus | 279 | 99.85 | ||
| KOG3623|consensus | 1007 | 99.73 | ||
| KOG3576|consensus | 267 | 99.59 | ||
| KOG3623|consensus | 1007 | 99.59 | ||
| PHA00733 | 128 | hypothetical protein | 99.42 | |
| PHA02768 | 55 | hypothetical protein; Provisional | 99.4 | |
| KOG1074|consensus | 958 | 99.37 | ||
| KOG3576|consensus | 267 | 99.31 | ||
| PF13465 | 26 | zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A | 99.24 | |
| PF13465 | 26 | zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A | 99.17 | |
| KOG1074|consensus | 958 | 99.17 | ||
| KOG3608|consensus | 467 | 99.14 | ||
| KOG3608|consensus | 467 | 99.1 | ||
| PHA00732 | 79 | hypothetical protein | 99.01 | |
| PHA00616 | 44 | hypothetical protein | 98.88 | |
| PHA00733 | 128 | hypothetical protein | 98.72 | |
| KOG3993|consensus | 500 | 98.67 | ||
| COG5189 | 423 | SFP1 Putative transcriptional repressor regulating | 98.65 | |
| PF05605 | 54 | zf-Di19: Drought induced 19 protein (Di19), zinc-b | 98.61 | |
| PLN03086 | 567 | PRLI-interacting factor K; Provisional | 98.59 | |
| PF00096 | 23 | zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 | 98.56 | |
| PHA00616 | 44 | hypothetical protein | 98.47 | |
| PLN03086 | 567 | PRLI-interacting factor K; Provisional | 98.4 | |
| PF13912 | 27 | zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 | 98.37 | |
| PF00096 | 23 | zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 | 98.33 | |
| PHA02768 | 55 | hypothetical protein; Provisional | 98.31 | |
| PF12756 | 100 | zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: | 98.3 | |
| PF13894 | 24 | zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP | 98.29 | |
| PF13912 | 27 | zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 | 98.07 | |
| PF13894 | 24 | zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP | 98.05 | |
| PRK04860 | 160 | hypothetical protein; Provisional | 97.98 | |
| smart00355 | 26 | ZnF_C2H2 zinc finger. | 97.95 | |
| PF12171 | 27 | zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi | 97.82 | |
| PF12874 | 25 | zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG | 97.8 | |
| smart00355 | 26 | ZnF_C2H2 zinc finger. | 97.6 | |
| PF09237 | 54 | GAGA: GAGA factor; InterPro: IPR015318 Zinc finger | 97.59 | |
| PF09237 | 54 | GAGA: GAGA factor; InterPro: IPR015318 Zinc finger | 97.58 | |
| KOG3993|consensus | 500 | 97.58 | ||
| PHA00732 | 79 | hypothetical protein | 97.56 | |
| PF13913 | 25 | zf-C2HC_2: zinc-finger of a C2HC-type | 97.54 | |
| PF12874 | 25 | zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG | 97.35 | |
| PF13909 | 24 | zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W | 97.17 | |
| smart00451 | 35 | ZnF_U1 U1-like zinc finger. Family of C2H2-type zi | 97.03 | |
| PRK04860 | 160 | hypothetical protein; Provisional | 96.46 | |
| COG4049 | 65 | Uncharacterized protein containing archaeal-type C | 96.31 | |
| cd00350 | 33 | rubredoxin_like Rubredoxin_like; nonheme iron bind | 95.99 | |
| KOG1146|consensus | 1406 | 95.86 | ||
| COG5048 | 467 | FOG: Zn-finger [General function prediction only] | 95.54 | |
| KOG2893|consensus | 341 | 95.39 | ||
| TIGR00373 | 158 | conserved hypothetical protein TIGR00373. This fam | 95.33 | |
| PF09538 | 108 | FYDLN_acid: Protein of unknown function (FYDLN_aci | 95.27 | |
| COG1592 | 166 | Rubrerythrin [Energy production and conversion] | 95.13 | |
| smart00531 | 147 | TFIIE Transcription initiation factor IIE. | 95.12 | |
| PF13719 | 37 | zinc_ribbon_5: zinc-ribbon domain | 94.7 | |
| PRK06266 | 178 | transcription initiation factor E subunit alpha; V | 94.67 | |
| PF12756 | 100 | zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: | 94.61 | |
| TIGR02098 | 38 | MJ0042_CXXC MJ0042 family finger-like domain. This | 94.4 | |
| PF13717 | 36 | zinc_ribbon_4: zinc-ribbon domain | 94.18 | |
| KOG2186|consensus | 276 | 93.96 | ||
| PF09986 | 214 | DUF2225: Uncharacterized protein conserved in bact | 93.54 | |
| COG2888 | 61 | Predicted Zn-ribbon RNA-binding protein with a fun | 93.24 | |
| KOG1146|consensus | 1406 | 93.16 | ||
| COG5189 | 423 | SFP1 Putative transcriptional repressor regulating | 93.04 | |
| cd00729 | 34 | rubredoxin_SM Rubredoxin, Small Modular nonheme ir | 92.72 | |
| PRK00398 | 46 | rpoP DNA-directed RNA polymerase subunit P; Provis | 92.69 | |
| TIGR02300 | 129 | FYDLN_acid conserved hypothetical protein TIGR0230 | 92.54 | |
| smart00659 | 44 | RPOLCX RNA polymerase subunit CX. present in RNA p | 92.28 | |
| KOG2593|consensus | 436 | 92.2 | ||
| PF09723 | 42 | Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR0134 | 92.07 | |
| KOG2893|consensus | 341 | 91.63 | ||
| KOG3408|consensus | 129 | 91.6 | ||
| PRK00464 | 154 | nrdR transcriptional regulator NrdR; Validated | 91.25 | |
| KOG2785|consensus | 390 | 91.16 | ||
| PF07754 | 24 | DUF1610: Domain of unknown function (DUF1610); Int | 90.98 | |
| PF02892 | 45 | zf-BED: BED zinc finger; InterPro: IPR003656 Zinc | 90.88 | |
| KOG4167|consensus | 907 | 90.79 | ||
| PF15269 | 54 | zf-C2H2_7: Zinc-finger | 90.69 | |
| smart00734 | 26 | ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18 | 90.66 | |
| PF04959 | 214 | ARS2: Arsenite-resistance protein 2; InterPro: IPR | 90.55 | |
| TIGR02605 | 52 | CxxC_CxxC_SSSS putative regulatory protein, FmdB f | 90.39 | |
| COG5048 | 467 | FOG: Zn-finger [General function prediction only] | 90.38 | |
| PF13451 | 49 | zf-trcl: Probable zinc-binding domain | 90.09 | |
| COG1996 | 49 | RPC10 DNA-directed RNA polymerase, subunit RPC10 ( | 89.99 | |
| KOG2482|consensus | 423 | 89.53 | ||
| PRK14890 | 59 | putative Zn-ribbon RNA-binding protein; Provisiona | 88.18 | |
| PF05191 | 36 | ADK_lid: Adenylate kinase, active site lid; InterP | 87.89 | |
| PF02176 | 60 | zf-TRAF: TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A | 87.06 | |
| PF10571 | 26 | UPF0547: Uncharacterised protein family UPF0547; I | 86.89 | |
| PHA00626 | 59 | hypothetical protein | 86.59 | |
| PF03604 | 32 | DNA_RNApol_7kD: DNA directed RNA polymerase, 7 kDa | 86.2 | |
| PF10013 | 42 | DUF2256: Uncharacterized protein conserved in bact | 85.55 | |
| smart00614 | 50 | ZnF_BED BED zinc finger. DNA-binding domain in chr | 85.23 | |
| PRK03824 | 135 | hypA hydrogenase nickel incorporation protein; Pro | 84.99 | |
| PF04780 | 466 | DUF629: Protein of unknown function (DUF629); Inte | 84.67 | |
| smart00834 | 41 | CxxC_CXXC_SSSS Putative regulatory protein. CxxC_C | 84.2 | |
| PF04959 | 214 | ARS2: Arsenite-resistance protein 2; InterPro: IPR | 83.97 | |
| PF12907 | 40 | zf-met2: Zinc-binding | 83.9 | |
| PF07282 | 69 | OrfB_Zn_ribbon: Putative transposase DNA-binding d | 83.84 | |
| PF09963 | 56 | DUF2197: Uncharacterized protein conserved in bact | 83.39 | |
| COG1675 | 176 | TFA1 Transcription initiation factor IIE, alpha su | 83.34 | |
| COG3364 | 112 | Zn-ribbon containing protein [General function pre | 83.01 | |
| PLN02748 | 468 | tRNA dimethylallyltransferase | 82.96 | |
| PF07975 | 51 | C1_4: TFIIH C1-like domain; InterPro: IPR004595 Al | 82.91 | |
| COG4530 | 129 | Uncharacterized protein conserved in bacteria [Fun | 82.45 | |
| COG3091 | 156 | SprT Zn-dependent metalloprotease, SprT family [Ge | 82.22 | |
| COG4338 | 54 | Uncharacterized protein conserved in bacteria [Fun | 81.68 | |
| COG5236 | 493 | Uncharacterized conserved protein, contains RING Z | 81.56 | |
| KOG2231|consensus | 669 | 81.35 |
| >KOG2462|consensus | Back alignment and domain information |
|---|
Probab=99.86 E-value=1.8e-22 Score=104.19 Aligned_cols=66 Identities=39% Similarity=0.677 Sum_probs=56.5
Q ss_pred ChHHHHHHHhHhhCCCceecccccccccchhhHHHhHhhhcCCcCceeCChhhHhhhchHHHHHhhh
Q psy12265 3 KFTYLKVHNRVHLGLKPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARKYQAHSYHQ 69 (71)
Q Consensus 3 ~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~~~l~~h~~ 69 (71)
-+=.|+-|+|+|+||+||.|..|+++|...++|..||+ +|.+.++|+|..|++.|+..+.|.+|..
T Consensus 199 RPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQ-THS~~K~~qC~~C~KsFsl~SyLnKH~E 264 (279)
T KOG2462|consen 199 RPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQ-THSDVKKHQCPRCGKSFALKSYLNKHSE 264 (279)
T ss_pred chHHhhcccccccCCCCccCCcccchhcchHHHHHHHH-hhcCCccccCcchhhHHHHHHHHHHhhh
Confidence 33456678899999999999999999999999999988 7988889999999999999999988864
|
|
| >KOG2462|consensus | Back alignment and domain information |
|---|
| >KOG3623|consensus | Back alignment and domain information |
|---|
| >KOG3576|consensus | Back alignment and domain information |
|---|
| >KOG3623|consensus | Back alignment and domain information |
|---|
| >PHA00733 hypothetical protein | Back alignment and domain information |
|---|
| >PHA02768 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1074|consensus | Back alignment and domain information |
|---|
| >KOG3576|consensus | Back alignment and domain information |
|---|
| >PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A | Back alignment and domain information |
|---|
| >PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A | Back alignment and domain information |
|---|
| >KOG1074|consensus | Back alignment and domain information |
|---|
| >KOG3608|consensus | Back alignment and domain information |
|---|
| >KOG3608|consensus | Back alignment and domain information |
|---|
| >PHA00732 hypothetical protein | Back alignment and domain information |
|---|
| >PHA00616 hypothetical protein | Back alignment and domain information |
|---|
| >PHA00733 hypothetical protein | Back alignment and domain information |
|---|
| >KOG3993|consensus | Back alignment and domain information |
|---|
| >COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins | Back alignment and domain information |
|---|
| >PLN03086 PRLI-interacting factor K; Provisional | Back alignment and domain information |
|---|
| >PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PHA00616 hypothetical protein | Back alignment and domain information |
|---|
| >PLN03086 PRLI-interacting factor K; Provisional | Back alignment and domain information |
|---|
| >PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B | Back alignment and domain information |
|---|
| >PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PHA02768 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A | Back alignment and domain information |
|---|
| >PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A | Back alignment and domain information |
|---|
| >PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B | Back alignment and domain information |
|---|
| >PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A | Back alignment and domain information |
|---|
| >PRK04860 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >smart00355 ZnF_C2H2 zinc finger | Back alignment and domain information |
|---|
| >PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length | Back alignment and domain information |
|---|
| >PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A | Back alignment and domain information |
|---|
| >smart00355 ZnF_C2H2 zinc finger | Back alignment and domain information |
|---|
| >PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG3993|consensus | Back alignment and domain information |
|---|
| >PHA00732 hypothetical protein | Back alignment and domain information |
|---|
| >PF13913 zf-C2HC_2: zinc-finger of a C2HC-type | Back alignment and domain information |
|---|
| >PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A | Back alignment and domain information |
|---|
| >PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A | Back alignment and domain information |
|---|
| >smart00451 ZnF_U1 U1-like zinc finger | Back alignment and domain information |
|---|
| >PRK04860 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center | Back alignment and domain information |
|---|
| >KOG1146|consensus | Back alignment and domain information |
|---|
| >COG5048 FOG: Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2893|consensus | Back alignment and domain information |
|---|
| >TIGR00373 conserved hypothetical protein TIGR00373 | Back alignment and domain information |
|---|
| >PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues | Back alignment and domain information |
|---|
| >COG1592 Rubrerythrin [Energy production and conversion] | Back alignment and domain information |
|---|
| >smart00531 TFIIE Transcription initiation factor IIE | Back alignment and domain information |
|---|
| >PF13719 zinc_ribbon_5: zinc-ribbon domain | Back alignment and domain information |
|---|
| >PRK06266 transcription initiation factor E subunit alpha; Validated | Back alignment and domain information |
|---|
| >PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A | Back alignment and domain information |
|---|
| >TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain | Back alignment and domain information |
|---|
| >PF13717 zinc_ribbon_4: zinc-ribbon domain | Back alignment and domain information |
|---|
| >KOG2186|consensus | Back alignment and domain information |
|---|
| >PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function | Back alignment and domain information |
|---|
| >COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1146|consensus | Back alignment and domain information |
|---|
| >COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase | Back alignment and domain information |
|---|
| >PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional | Back alignment and domain information |
|---|
| >TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300 | Back alignment and domain information |
|---|
| >smart00659 RPOLCX RNA polymerase subunit CX | Back alignment and domain information |
|---|
| >KOG2593|consensus | Back alignment and domain information |
|---|
| >PF09723 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR013429 This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria | Back alignment and domain information |
|---|
| >KOG2893|consensus | Back alignment and domain information |
|---|
| >KOG3408|consensus | Back alignment and domain information |
|---|
| >PRK00464 nrdR transcriptional regulator NrdR; Validated | Back alignment and domain information |
|---|
| >KOG2785|consensus | Back alignment and domain information |
|---|
| >PF07754 DUF1610: Domain of unknown function (DUF1610); InterPro: IPR011668 This domain is found in archaeal species | Back alignment and domain information |
|---|
| >PF02892 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG4167|consensus | Back alignment and domain information |
|---|
| >PF15269 zf-C2H2_7: Zinc-finger | Back alignment and domain information |
|---|
| >smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger | Back alignment and domain information |
|---|
| >PF04959 ARS2: Arsenite-resistance protein 2; InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity [] | Back alignment and domain information |
|---|
| >TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family | Back alignment and domain information |
|---|
| >COG5048 FOG: Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >PF13451 zf-trcl: Probable zinc-binding domain | Back alignment and domain information |
|---|
| >COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription] | Back alignment and domain information |
|---|
| >KOG2482|consensus | Back alignment and domain information |
|---|
| >PRK14890 putative Zn-ribbon RNA-binding protein; Provisional | Back alignment and domain information |
|---|
| >PF05191 ADK_lid: Adenylate kinase, active site lid; InterPro: IPR007862 Adenylate kinases (ADK; 2 | Back alignment and domain information |
|---|
| >PF02176 zf-TRAF: TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A | Back alignment and domain information |
|---|
| >PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines | Back alignment and domain information |
|---|
| >PHA00626 hypothetical protein | Back alignment and domain information |
|---|
| >PF03604 DNA_RNApol_7kD: DNA directed RNA polymerase, 7 kDa subunit; InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates | Back alignment and domain information |
|---|
| >PF10013 DUF2256: Uncharacterized protein conserved in bacteria (DUF2256); InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >smart00614 ZnF_BED BED zinc finger | Back alignment and domain information |
|---|
| >PRK03824 hypA hydrogenase nickel incorporation protein; Provisional | Back alignment and domain information |
|---|
| >PF04780 DUF629: Protein of unknown function (DUF629); InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >smart00834 CxxC_CXXC_SSSS Putative regulatory protein | Back alignment and domain information |
|---|
| >PF04959 ARS2: Arsenite-resistance protein 2; InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity [] | Back alignment and domain information |
|---|
| >PF12907 zf-met2: Zinc-binding | Back alignment and domain information |
|---|
| >PF07282 OrfB_Zn_ribbon: Putative transposase DNA-binding domain; InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins | Back alignment and domain information |
|---|
| >PF09963 DUF2197: Uncharacterized protein conserved in bacteria (DUF2197); InterPro: IPR019241 This family represents various hypothetical bacterial proteins with no known function | Back alignment and domain information |
|---|
| >COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription] | Back alignment and domain information |
|---|
| >COG3364 Zn-ribbon containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02748 tRNA dimethylallyltransferase | Back alignment and domain information |
|---|
| >PF07975 C1_4: TFIIH C1-like domain; InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair | Back alignment and domain information |
|---|
| >COG4530 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only] | Back alignment and domain information |
|---|
| >COG4338 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2231|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 71 | ||||
| 2i13_A | 190 | Aart, A Six Finger Zinc Finger Designed To Recogniz | 8e-09 | ||
| 1mey_C | 87 | Crystal Structure Of A Designed Zinc Finger Protein | 2e-08 | ||
| 1g2f_C | 90 | Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX | 1e-07 | ||
| 1g2d_C | 90 | Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX | 5e-07 | ||
| 2jp9_A | 119 | Structure Of The Wilms Tumor Suppressor Protein Zin | 1e-06 | ||
| 1a1f_A | 90 | Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc | 2e-06 | ||
| 1jk1_A | 90 | Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 | 2e-06 | ||
| 1aay_A | 90 | Zif268 Zinc Finger-Dna Complex Length = 90 | 2e-06 | ||
| 1a1i_A | 90 | Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac | 2e-06 | ||
| 1p47_A | 87 | Crystal Structure Of Tandem Zif268 Molecules Comple | 2e-06 | ||
| 1a1h_A | 90 | Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac | 2e-06 | ||
| 1zaa_C | 87 | Zinc Finger-Dna Recognition: Crystal Structure Of A | 2e-06 | ||
| 2ee8_A | 106 | Solution Structure Of Three Zf-C2h2 Domains From Mo | 3e-06 | ||
| 2csh_A | 110 | Solution Structure Of Tandem Repeat Of The Zf-C2h2 | 5e-06 | ||
| 2kmk_A | 82 | Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = | 1e-05 | ||
| 2dlq_A | 124 | Solution Structure Of The Tandem Four Zf-C2h2 Domai | 2e-05 | ||
| 2yt9_A | 95 | Solution Structure Of C2h2 Type Zinc Finger Domain | 5e-05 | ||
| 2ct1_A | 77 | Solution Structure Of The Zinc Finger Domain Of Tra | 3e-04 | ||
| 2ebt_A | 100 | Solution Structure Of Three Tandem Repeats Of Zf-C2 | 3e-04 | ||
| 1llm_C | 88 | Crystal Structure Of A Zif23-Gcn4 Chimera Bound To | 4e-04 | ||
| 1f2i_G | 73 | Cocrystal Structure Of Selected Zinc Finger Dimer B | 5e-04 | ||
| 2dmd_A | 96 | Solution Structure Of The N-Terminal C2h2 Type Zinc | 5e-04 | ||
| 2lce_A | 74 | Chemical Shift Assignment Of Hr4436b From Homo Sapi | 6e-04 |
| >pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 | Back alignment and structure |
|
| >pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 | Back alignment and structure |
| >pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 | Back alignment and structure |
| >pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 | Back alignment and structure |
| >pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 | Back alignment and structure |
| >pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 | Back alignment and structure |
| >pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 | Back alignment and structure |
| >pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 | Back alignment and structure |
| >pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 | Back alignment and structure |
| >pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 | Back alignment and structure |
| >pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 | Back alignment and structure |
| >pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 | Back alignment and structure |
| >pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 | Back alignment and structure |
| >pdb|2CSH|A Chain A, Solution Structure Of Tandem Repeat Of The Zf-C2h2 Domains Of Human Zinc Finger Protein 297b Length = 110 | Back alignment and structure |
| >pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 | Back alignment and structure |
| >pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 | Back alignment and structure |
| >pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 | Back alignment and structure |
| >pdb|2CT1|A Chain A, Solution Structure Of The Zinc Finger Domain Of Transcriptional Repressor Ctcf Protein Length = 77 | Back alignment and structure |
| >pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 | Back alignment and structure |
| >pdb|1LLM|C Chain C, Crystal Structure Of A Zif23-Gcn4 Chimera Bound To Dna Length = 88 | Back alignment and structure |
| >pdb|1F2I|G Chain G, Cocrystal Structure Of Selected Zinc Finger Dimer Bound To Dna Length = 73 | Back alignment and structure |
| >pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 | Back alignment and structure |
| >pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 71 | |||
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 3e-13 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 1e-06 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 2e-11 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 3e-07 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 3e-06 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 2e-11 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 4e-04 | |
| 1llm_C | 88 | Chimera of ZIF23-GCN4; dimerization, DNA recogniti | 1e-10 | |
| 1llm_C | 88 | Chimera of ZIF23-GCN4; dimerization, DNA recogniti | 9e-08 | |
| 2eps_A | 54 | POZ-, at HOOK-, and zinc finger-containing protein | 1e-10 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 2e-10 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 4e-08 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 4e-07 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 2e-10 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 2e-06 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 3e-10 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 3e-07 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 1e-05 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 3e-10 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 6e-10 | |
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 3e-10 | |
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 5e-10 | |
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 2e-05 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 3e-10 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 1e-07 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 2e-04 | |
| 2dlq_A | 124 | GLI-kruppel family member HKR3; ZF-C2H2 domain, st | 4e-10 | |
| 2dlq_A | 124 | GLI-kruppel family member HKR3; ZF-C2H2 domain, st | 4e-08 | |
| 2dlq_A | 124 | GLI-kruppel family member HKR3; ZF-C2H2 domain, st | 5e-06 | |
| 2dlq_A | 124 | GLI-kruppel family member HKR3; ZF-C2H2 domain, st | 9e-06 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 5e-10 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 2e-05 | |
| 2jp9_A | 119 | Wilms tumor 1; DNA binding, nucleic acid recogniti | 7e-10 | |
| 2jp9_A | 119 | Wilms tumor 1; DNA binding, nucleic acid recogniti | 1e-09 | |
| 2jp9_A | 119 | Wilms tumor 1; DNA binding, nucleic acid recogniti | 3e-05 | |
| 2jp9_A | 119 | Wilms tumor 1; DNA binding, nucleic acid recogniti | 9e-04 | |
| 2kmk_A | 82 | Zinc finger protein GFI-1; tandem repeat zinc fing | 9e-10 | |
| 2kmk_A | 82 | Zinc finger protein GFI-1; tandem repeat zinc fing | 1e-05 | |
| 2kmk_A | 82 | Zinc finger protein GFI-1; tandem repeat zinc fing | 3e-04 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 1e-09 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 7e-07 | |
| 2gli_A | 155 | Protein (five-finger GLI); protein/DNA complex, tr | 2e-09 | |
| 2gli_A | 155 | Protein (five-finger GLI); protein/DNA complex, tr | 2e-06 | |
| 2gli_A | 155 | Protein (five-finger GLI); protein/DNA complex, tr | 2e-05 | |
| 2gli_A | 155 | Protein (five-finger GLI); protein/DNA complex, tr | 3e-04 | |
| 2i13_A | 190 | AART; DNA binding, zinc finger, DNA binding protei | 3e-09 | |
| 2i13_A | 190 | AART; DNA binding, zinc finger, DNA binding protei | 9e-09 | |
| 2i13_A | 190 | AART; DNA binding, zinc finger, DNA binding protei | 1e-08 | |
| 2i13_A | 190 | AART; DNA binding, zinc finger, DNA binding protei | 3e-08 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 2e-08 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 2e-04 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 2e-08 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 8e-05 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 2e-08 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 4e-05 | |
| 2dlk_A | 79 | Novel protein; ZF-C2H2 domain, zinc finger protein | 4e-08 | |
| 2dlk_A | 79 | Novel protein; ZF-C2H2 domain, zinc finger protein | 4e-06 | |
| 2dlk_A | 79 | Novel protein; ZF-C2H2 domain, zinc finger protein | 3e-04 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 1e-07 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 8e-06 | |
| 2eos_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 2e-07 | |
| 2ctu_A | 73 | Zinc finger protein 483; zinc finger domain, struc | 5e-07 | |
| 1ubd_C | 124 | Protein (YY1 zinc finger domain); transcription in | 7e-07 | |
| 1ubd_C | 124 | Protein (YY1 zinc finger domain); transcription in | 1e-06 | |
| 1ubd_C | 124 | Protein (YY1 zinc finger domain); transcription in | 2e-04 | |
| 2rpc_A | 155 | Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr | 1e-06 | |
| 2rpc_A | 155 | Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr | 2e-06 | |
| 2rpc_A | 155 | Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr | 4e-05 | |
| 2rpc_A | 155 | Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr | 9e-05 | |
| 2j7j_A | 85 | Transcription factor IIIA; zinc finger module, alt | 2e-06 | |
| 2j7j_A | 85 | Transcription factor IIIA; zinc finger module, alt | 9e-05 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 2e-06 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 2e-05 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 3e-06 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 2e-05 | |
| 2en2_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 4e-06 | |
| 2em6_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 4e-06 | |
| 2epx_A | 47 | Zinc finger protein 28 homolog; C2H2, zinc finger | 6e-06 | |
| 1tf6_A | 190 | Protein (transcription factor IIIA); complex (tran | 9e-06 | |
| 1tf6_A | 190 | Protein (transcription factor IIIA); complex (tran | 1e-05 | |
| 1tf6_A | 190 | Protein (transcription factor IIIA); complex (tran | 5e-05 | |
| 1tf6_A | 190 | Protein (transcription factor IIIA); complex (tran | 7e-05 | |
| 1tf6_A | 190 | Protein (transcription factor IIIA); complex (tran | 5e-04 | |
| 1tf6_A | 190 | Protein (transcription factor IIIA); complex (tran | 9e-04 | |
| 2eoq_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 9e-06 | |
| 2em7_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 3e-05 | |
| 2em9_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 4e-05 | |
| 2en6_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 4e-05 | |
| 2emp_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 5e-05 | |
| 2ytb_A | 42 | Zinc finger protein 32; zinc-finger domain, C2H2, | 5e-05 | |
| 2eoo_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 5e-05 | |
| 2epu_A | 45 | Zinc finger protein 32; C2H2, zinc finger domain, | 6e-05 | |
| 2ep0_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 6e-05 | |
| 2eon_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 7e-05 | |
| 2dmi_A | 115 | Teashirt homolog 3; zinc finger protein 537, struc | 7e-05 | |
| 2eq1_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 7e-05 | |
| 2enh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 9e-05 | |
| 2ytn_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 9e-05 | |
| 2em3_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 1e-04 | |
| 2em8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 1e-04 | |
| 2elz_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 1e-04 | |
| 2el4_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 1e-04 | |
| 2ysp_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 1e-04 | |
| 2eq4_A | 46 | Zinc finger protein 224; C2H2, zinc finger domain, | 1e-04 | |
| 2eor_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 1e-04 | |
| 2eoz_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 1e-04 | |
| 2en1_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 1e-04 | |
| 2eow_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 1e-04 | |
| 2enc_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 2e-04 | |
| 2emh_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 2e-04 | |
| 2ytm_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-04 | |
| 2ep3_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 2e-04 | |
| 2epr_A | 48 | POZ-, at HOOK-, and zinc finger-containing protein | 2e-04 | |
| 2yth_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 2e-04 | |
| 2ep2_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 2e-04 | |
| 2em2_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-04 | |
| 2em4_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-04 | |
| 2eof_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 2e-04 | |
| 2epc_A | 42 | Zinc finger protein 32; zinc finger domain, C2H2, | 2e-04 | |
| 2eml_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-04 | |
| 2eq2_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 2e-04 | |
| 2en9_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-04 | |
| 2eme_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 2e-04 | |
| 2ene_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 2e-04 | |
| 2ytr_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 3e-04 | |
| 2eov_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 3e-04 | |
| 2yts_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 3e-04 | |
| 2ytj_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 3e-04 | |
| 2em0_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 3e-04 | |
| 2emi_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 3e-04 | |
| 2eoe_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 3e-04 | |
| 2emg_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 3e-04 | |
| 2ep1_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 3e-04 | |
| 2em5_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 3e-04 | |
| 2ema_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 3e-04 | |
| 2ytf_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 3e-04 | |
| 2yrj_A | 46 | Zinc finger protein 473; C2H2-type zinc finger, st | 3e-04 | |
| 2ytq_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 3e-04 | |
| 2epz_A | 46 | Zinc finger protein 28 homolog; C2H2, zinc finger | 3e-04 | |
| 2ytk_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 4e-04 | |
| 2eq0_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 4e-04 | |
| 2eq3_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 4e-04 | |
| 2wbt_A | 129 | B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len | 4e-04 | |
| 2ytt_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 4e-04 | |
| 2ent_A | 48 | Krueppel-like factor 15; zinc binding, transcripti | 4e-04 | |
| 2emy_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 4e-04 | |
| 2ely_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 4e-04 | |
| 2emj_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 5e-04 | |
| 2ytd_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 5e-04 | |
| 2en7_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 5e-04 | |
| 2enf_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 5e-04 | |
| 2yti_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 5e-04 | |
| 2emf_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 5e-04 | |
| 2ytp_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 5e-04 | |
| 2yto_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 6e-04 | |
| 2en3_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 6e-04 | |
| 2yu8_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 6e-04 | |
| 2el6_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 6e-04 | |
| 2epv_A | 44 | Zinc finger protein 268; C2H2, zinc finger domain, | 6e-04 | |
| 2ytg_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 7e-04 | |
| 2epw_A | 46 | Zinc finger protein 268; C2H2, zinc finger domain, | 7e-04 | |
| 2emz_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 7e-04 | |
| 2eoh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 7e-04 | |
| 2en8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 8e-04 | |
| 2eom_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 8e-04 | |
| 1ej6_B | 1275 | Lambda1; icosahedral, non-equivalence, dsRNA virus | 8e-04 |
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 | Back alignment and structure |
|---|
Score = 57.1 bits (139), Expect = 3e-13
Identities = 21/56 (37%), Positives = 26/56 (46%), Gaps = 1/56 (1%)
Query: 7 LKVHNRVHLGLKPYGCEVCGRHFRQWGDLKYHKASLHS-DVKAFQCEYCGKDFARK 61
R H G KPY C +C F Q G +K H H+ +V F C +C ARK
Sbjct: 3 SGSSGRTHSGEKPYECYICHARFTQSGTMKMHILQKHTENVAKFHCPHCDTVIARK 58
|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 | Back alignment and structure |
|---|
| >1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 | Back alignment and structure |
|---|
| >1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 | Back alignment and structure |
|---|
| >2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 | Back alignment and structure |
|---|
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 | Back alignment and structure |
|---|
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 | Back alignment and structure |
|---|
| >2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 | Back alignment and structure |
|---|
| >2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 | Back alignment and structure |
|---|
| >2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 | Back alignment and structure |
|---|
| >2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 | Back alignment and structure |
|---|
| >2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 | Back alignment and structure |
|---|
| >2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 | Back alignment and structure |
|---|
| >2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 | Back alignment and structure |
|---|
| >2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 | Back alignment and structure |
|---|
| >2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 | Back alignment and structure |
|---|
| >2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 | Back alignment and structure |
|---|
| >2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 | Back alignment and structure |
|---|
| >2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 | Back alignment and structure |
|---|
| >2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 | Back alignment and structure |
|---|
| >2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 | Back alignment and structure |
|---|
| >2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 | Back alignment and structure |
|---|
| >2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 | Back alignment and structure |
|---|
| >2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 | Back alignment and structure |
|---|
| >2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 | Back alignment and structure |
|---|
| >2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 | Back alignment and structure |
|---|
| >2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 | Back alignment and structure |
|---|
| >2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 | Back alignment and structure |
|---|
| >2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 | Back alignment and structure |
|---|
| >2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 | Back alignment and structure |
|---|
| >1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 | Back alignment and structure |
|---|
| >1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 | Back alignment and structure |
|---|
| >2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 | Back alignment and structure |
|---|
| >2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 | Back alignment and structure |
|---|
| >2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 | Back alignment and structure |
|---|
| >2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 | Back alignment and structure |
|---|
| >2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 | Back alignment and structure |
|---|
| >2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 | Back alignment and structure |
|---|
| >2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 | Back alignment and structure |
|---|
| >2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 | Back alignment and structure |
|---|
| >1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 | Back alignment and structure |
|---|
| >1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 | Back alignment and structure |
|---|
| >1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 | Back alignment and structure |
|---|
| >1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 | Back alignment and structure |
|---|
| >1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 | Back alignment and structure |
|---|
| >1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 | Back alignment and structure |
|---|
| >2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 | Back alignment and structure |
|---|
| >2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 | Back alignment and structure |
|---|
| >2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 | Back alignment and structure |
|---|
| >2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 | Back alignment and structure |
|---|
| >2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 | Back alignment and structure |
|---|
| >2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 | Back alignment and structure |
|---|
| >2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 | Back alignment and structure |
|---|
| >2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 | Back alignment and structure |
|---|
| >2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 | Back alignment and structure |
|---|
| >2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 | Back alignment and structure |
|---|
| >2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 | Back alignment and structure |
|---|
| >2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >1ej6_B Lambda1; icosahedral, non-equivalence, dsRNA virus, methylase, methyltransferase, guanylyltransferase, zinc finger, icosahedral virus; 3.60A {Reovirus SP} SCOP: i.7.1.1 PDB: 2cse_V Length = 1275 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 71 | |||
| 4gzn_C | 60 | ZFP-57, zinc finger protein 57; transcription-DNA | 99.9 | |
| 2lt7_A | 133 | Transcriptional regulator kaiso; zinc finger, doub | 99.88 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 99.86 | |
| 2kmk_A | 82 | Zinc finger protein GFI-1; tandem repeat zinc fing | 99.86 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 99.85 | |
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 99.85 | |
| 2jp9_A | 119 | Wilms tumor 1; DNA binding, nucleic acid recogniti | 99.83 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 99.83 | |
| 2ctd_A | 96 | Zinc finger protein 512; zinc binding, two ZF-C2H2 | 99.83 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 99.83 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 99.82 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 99.82 | |
| 2i13_A | 190 | AART; DNA binding, zinc finger, DNA binding protei | 99.82 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 99.82 | |
| 2gqj_A | 98 | Zinc finger protein KIAA1196; ZF-C2H2 like domain, | 99.81 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 99.8 | |
| 2lv2_A | 85 | Insulinoma-associated protein 1; structural genomi | 99.8 | |
| 2jp9_A | 119 | Wilms tumor 1; DNA binding, nucleic acid recogniti | 99.79 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 99.79 | |
| 2gli_A | 155 | Protein (five-finger GLI); protein/DNA complex, tr | 99.79 | |
| 2rpc_A | 155 | Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr | 99.78 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 99.78 | |
| 1llm_C | 88 | Chimera of ZIF23-GCN4; dimerization, DNA recogniti | 99.78 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 99.78 | |
| 2lt7_A | 133 | Transcriptional regulator kaiso; zinc finger, doub | 99.78 | |
| 2dlq_A | 124 | GLI-kruppel family member HKR3; ZF-C2H2 domain, st | 99.77 | |
| 3uk3_C | 57 | Zinc finger protein 217; transcription factor, DNA | 99.77 | |
| 2dlq_A | 124 | GLI-kruppel family member HKR3; ZF-C2H2 domain, st | 99.77 | |
| 2i13_A | 190 | AART; DNA binding, zinc finger, DNA binding protei | 99.77 | |
| 2wbt_A | 129 | B-129; zinc finger; 2.70A {Sulfolobus virus 1} | 99.76 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 99.76 | |
| 1ubd_C | 124 | Protein (YY1 zinc finger domain); transcription in | 99.76 | |
| 2j7j_A | 85 | Transcription factor IIIA; zinc finger module, alt | 99.75 | |
| 1wjp_A | 107 | Zinc finger protein 295; ZF-C2H2 domain, zinc bind | 99.75 | |
| 1ubd_C | 124 | Protein (YY1 zinc finger domain); transcription in | 99.75 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 99.75 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 99.75 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 99.75 | |
| 2dlk_A | 79 | Novel protein; ZF-C2H2 domain, zinc finger protein | 99.74 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 99.73 | |
| 2dmi_A | 115 | Teashirt homolog 3; zinc finger protein 537, struc | 99.73 | |
| 2gli_A | 155 | Protein (five-finger GLI); protein/DNA complex, tr | 99.73 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 99.73 | |
| 2ghf_A | 102 | ZHX1, zinc fingers and homeoboxes protein 1; C2H2 | 99.73 | |
| 1tf6_A | 190 | Protein (transcription factor IIIA); complex (tran | 99.71 | |
| 1tf6_A | 190 | Protein (transcription factor IIIA); complex (tran | 99.7 | |
| 2eod_A | 66 | TNF receptor-associated factor 4; zinc binding, NF | 99.69 | |
| 1vd4_A | 62 | Transcription initiation factor IIE, alpha subunit | 99.69 | |
| 1llm_C | 88 | Chimera of ZIF23-GCN4; dimerization, DNA recogniti | 99.69 | |
| 4gzn_C | 60 | ZFP-57, zinc finger protein 57; transcription-DNA | 99.68 | |
| 2rpc_A | 155 | Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr | 99.67 | |
| 2eml_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 99.66 | |
| 2emf_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 99.66 | |
| 2el4_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 99.66 | |
| 2ep2_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 99.66 | |
| 2emx_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 99.66 | |
| 2ytj_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 99.66 | |
| 2eq4_A | 46 | Zinc finger protein 224; C2H2, zinc finger domain, | 99.66 | |
| 2ytn_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 99.66 | |
| 2eq0_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 99.65 | |
| 2ene_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 99.65 | |
| 2em0_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 99.65 | |
| 2eme_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 99.65 | |
| 2emm_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 99.65 | |
| 2eoe_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 99.65 | |
| 2ema_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 99.65 | |
| 2epz_A | 46 | Zinc finger protein 28 homolog; C2H2, zinc finger | 99.65 | |
| 2eps_A | 54 | POZ-, at HOOK-, and zinc finger-containing protein | 99.65 | |
| 2emy_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 99.65 | |
| 2em9_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 99.65 | |
| 2ely_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 99.65 | |
| 2elz_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 99.65 | |
| 2ytk_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 99.65 | |
| 2emk_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 99.65 | |
| 2en1_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 99.65 | |
| 2em7_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 99.65 | |
| 2eop_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 99.65 | |
| 2em5_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 99.65 | |
| 2ytq_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 99.65 | |
| 2epw_A | 46 | Zinc finger protein 268; C2H2, zinc finger domain, | 99.65 | |
| 2eoq_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 99.64 | |
| 2ytd_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 99.64 | |
| 2yso_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 99.64 | |
| 2ytr_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 99.64 | |
| 2eoo_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 99.64 | |
| 2enc_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 99.64 | |
| 2epa_A | 72 | Krueppel-like factor 10; transforming growth facto | 99.64 | |
| 2emp_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 99.64 | |
| 2en8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 99.64 | |
| 2ysp_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 99.64 | |
| 2eov_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 99.64 | |
| 2emh_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 99.64 | |
| 2el6_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 99.64 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 99.64 | |
| 2ytg_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 99.64 | |
| 2en6_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 99.63 | |
| 2ep3_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 99.63 | |
| 2yu8_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 99.63 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 99.63 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 99.63 | |
| 2ytm_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 99.62 | |
| 2dmi_A | 115 | Teashirt homolog 3; zinc finger protein 537, struc | 99.62 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 99.62 | |
| 2em8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 99.62 | |
| 2epx_A | 47 | Zinc finger protein 28 homolog; C2H2, zinc finger | 99.6 | |
| 2em2_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 99.6 | |
| 2dlk_A | 79 | Novel protein; ZF-C2H2 domain, zinc finger protein | 99.6 | |
| 2el5_A | 42 | Zinc finger protein 268; alternative splicing, DNA | 99.59 | |
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 99.59 | |
| 2em4_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 99.58 | |
| 2enf_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 99.57 | |
| 2emj_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 99.57 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 99.57 | |
| 2ytp_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 99.57 | |
| 2yts_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 99.57 | |
| 2yte_A | 42 | Zinc finger protein 473; ZF-C2H2, structural genom | 99.57 | |
| 2ep0_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 99.57 | |
| 2ytf_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 99.57 | |
| 2ctu_A | 73 | Zinc finger protein 483; zinc finger domain, struc | 99.57 | |
| 2emi_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 99.56 | |
| 2em3_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 99.56 | |
| 2emg_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 99.56 | |
| 2ep1_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 99.56 | |
| 2eq2_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 99.56 | |
| 2eow_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 99.56 | |
| 2eoj_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 99.56 | |
| 2em6_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 99.56 | |
| 2yth_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 99.56 | |
| 2epq_A | 45 | POZ-, at HOOK-, and zinc finger-containing protein | 99.56 | |
| 2eof_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 99.56 | |
| 2eor_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 99.56 | |
| 2eoh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 99.56 | |
| 2yti_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 99.56 | |
| 2kmk_A | 82 | Zinc finger protein GFI-1; tandem repeat zinc fing | 99.56 | |
| 2yrj_A | 46 | Zinc finger protein 473; C2H2-type zinc finger, st | 99.56 | |
| 2eon_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 99.56 | |
| 2yu5_A | 44 | Zinc finger protein 473; ZF-C2H2 domain, structura | 99.55 | |
| 2epr_A | 48 | POZ-, at HOOK-, and zinc finger-containing protein | 99.55 | |
| 2en9_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 99.55 | |
| 2eq1_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 99.55 | |
| 2ytt_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 99.55 | |
| 2en7_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 99.55 | |
| 2eoz_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 99.55 | |
| 2epc_A | 42 | Zinc finger protein 32; zinc finger domain, C2H2, | 99.54 | |
| 2ghf_A | 102 | ZHX1, zinc fingers and homeoboxes protein 1; C2H2 | 99.54 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 99.54 | |
| 2ytb_A | 42 | Zinc finger protein 32; zinc-finger domain, C2H2, | 99.54 | |
| 2yto_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 99.54 | |
| 2eoy_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 99.54 | |
| 1yui_A | 54 | GAGA-factor; complex (DNA-binding protein/DNA), ch | 99.54 | |
| 2emb_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 99.54 | |
| 2enh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 99.53 | |
| 2eos_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 99.53 | |
| 2j7j_A | 85 | Transcription factor IIIA; zinc finger module, alt | 99.53 | |
| 2en2_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 99.53 | |
| 2eq3_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 99.52 | |
| 1wjp_A | 107 | Zinc finger protein 295; ZF-C2H2 domain, zinc bind | 99.51 | |
| 2en3_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 99.51 | |
| 2lv2_A | 85 | Insulinoma-associated protein 1; structural genomi | 99.51 | |
| 2emz_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 99.51 | |
| 2eou_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 99.51 | |
| 2epv_A | 44 | Zinc finger protein 268; C2H2, zinc finger domain, | 99.5 | |
| 2ent_A | 48 | Krueppel-like factor 15; zinc binding, transcripti | 99.5 | |
| 2eox_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 99.49 | |
| 2ej4_A | 95 | Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi | 99.49 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 99.49 | |
| 2epu_A | 45 | Zinc finger protein 32; C2H2, zinc finger domain, | 99.48 | |
| 2ept_A | 41 | Zinc finger protein 32; C2H2, zinc finger domain, | 99.48 | |
| 2yrm_A | 43 | B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, | 99.47 | |
| 2eom_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 99.47 | |
| 2ej4_A | 95 | Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi | 99.46 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 99.43 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 99.41 | |
| 2ctd_A | 96 | Zinc finger protein 512; zinc binding, two ZF-C2H2 | 99.41 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 99.39 | |
| 1x3c_A | 73 | Zinc finger protein 292; DNA binding, nuclear prot | 99.37 | |
| 2d9k_A | 75 | FLN29 gene product; zinc finger, ZF-TRAF, structur | 99.37 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 99.36 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 99.34 | |
| 3uk3_C | 57 | Zinc finger protein 217; transcription factor, DNA | 99.34 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 99.34 | |
| 1njq_A | 39 | Superman protein; zinc-finger, peptide-zinc comple | 99.32 | |
| 1yui_A | 54 | GAGA-factor; complex (DNA-binding protein/DNA), ch | 99.3 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 99.29 | |
| 2gqj_A | 98 | Zinc finger protein KIAA1196; ZF-C2H2 like domain, | 99.27 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 99.27 | |
| 2elo_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 99.26 | |
| 1p7a_A | 37 | BF3, BKLF, kruppel-like factor 3; classical zinc f | 99.24 | |
| 1srk_A | 35 | Zinc finger protein ZFPM1; classical zinc finger, | 99.21 | |
| 2elx_A | 35 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 99.21 | |
| 1x6f_A | 88 | Zinc finger protein 462; zinc finger domain, KIAA1 | 99.18 | |
| 1rim_A | 33 | E6APC2 peptide; E6-binding domain, zinc finger, hu | 99.18 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 99.17 | |
| 1p7a_A | 37 | BF3, BKLF, kruppel-like factor 3; classical zinc f | 99.16 | |
| 2eod_A | 66 | TNF receptor-associated factor 4; zinc binding, NF | 99.15 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 99.15 | |
| 2elm_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 99.14 | |
| 2el5_A | 42 | Zinc finger protein 268; alternative splicing, DNA | 99.11 | |
| 2yte_A | 42 | Zinc finger protein 473; ZF-C2H2, structural genom | 99.11 | |
| 2ytb_A | 42 | Zinc finger protein 32; zinc-finger domain, C2H2, | 99.1 | |
| 2eoj_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 99.1 | |
| 2epa_A | 72 | Krueppel-like factor 10; transforming growth facto | 99.09 | |
| 2elq_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 99.09 | |
| 1bhi_A | 38 | CRE-BP1, ATF-2; CRE binding protein, transcription | 99.09 | |
| 2epv_A | 44 | Zinc finger protein 268; C2H2, zinc finger domain, | 99.08 | |
| 2elv_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 99.08 | |
| 2emf_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 99.08 | |
| 1fv5_A | 36 | First zinc finger of U-shaped; CCHC, protein inter | 99.08 | |
| 2eos_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 99.08 | |
| 2emi_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 99.07 | |
| 2ep3_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 99.07 | |
| 2ytp_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 99.07 | |
| 2elp_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 99.06 | |
| 2elt_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 99.06 | |
| 2ytn_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 99.06 | |
| 2yu5_A | 44 | Zinc finger protein 473; ZF-C2H2 domain, structura | 99.06 | |
| 2en7_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 99.06 | |
| 2eoh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 99.06 | |
| 2enf_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 99.06 | |
| 2yts_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 99.06 | |
| 2el4_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 99.06 | |
| 2emg_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 99.06 | |
| 2eoy_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 99.06 | |
| 2ytj_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 99.06 | |
| 2eln_A | 38 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 99.06 | |
| 2eof_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 99.06 | |
| 2en2_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 99.06 | |
| 2ene_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 99.06 | |
| 2epc_A | 42 | Zinc finger protein 32; zinc finger domain, C2H2, | 99.06 | |
| 2epz_A | 46 | Zinc finger protein 28 homolog; C2H2, zinc finger | 99.05 | |
| 2eon_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 99.05 | |
| 2eq1_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 99.05 | |
| 2eml_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 99.05 | |
| 2eop_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 99.05 | |
| 2eq4_A | 46 | Zinc finger protein 224; C2H2, zinc finger domain, | 99.05 | |
| 3iuf_A | 48 | Zinc finger protein UBI-D4; structural genomics co | 99.05 | |
| 2elm_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 99.05 | |
| 2eq0_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 99.04 | |
| 2ytf_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 99.04 | |
| 2enh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 99.04 | |
| 2yrj_A | 46 | Zinc finger protein 473; C2H2-type zinc finger, st | 99.04 | |
| 2elx_A | 35 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 99.04 | |
| 2emb_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 99.04 | |
| 2eq2_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 99.04 | |
| 2ep2_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 99.04 | |
| 2em7_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 99.04 | |
| 2ema_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 99.04 | |
| 2yti_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 99.04 | |
| 2yth_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 99.04 | |
| 1srk_A | 35 | Zinc finger protein ZFPM1; classical zinc finger, | 99.04 | |
| 2elz_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 99.04 | |
| 2en1_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 99.04 | |
| 2em0_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 99.04 | |
| 2eoo_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 99.03 | |
| 2ytq_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 99.03 | |
| 2ytr_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 99.03 | |
| 2emx_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 99.03 | |
| 2eoz_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 99.03 | |
| 2en8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 99.03 | |
| 2em9_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 99.03 | |
| 3iuf_A | 48 | Zinc finger protein UBI-D4; structural genomics co | 99.03 | |
| 2em5_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 99.03 | |
| 2epw_A | 46 | Zinc finger protein 268; C2H2, zinc finger domain, | 99.03 | |
| 2ysp_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 99.03 | |
| 2eq3_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 99.03 | |
| 2emj_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 99.03 | |
| 2em4_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 99.02 | |
| 2eoe_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 99.02 | |
| 2eme_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 99.02 | |
| 2em6_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 99.02 | |
| 2ep1_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 99.02 | |
| 2eoq_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 99.02 | |
| 2elr_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 99.02 | |
| 2emh_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 99.02 | |
| 2em3_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 99.02 | |
| 1fv5_A | 36 | First zinc finger of U-shaped; CCHC, protein inter | 99.02 | |
| 2en3_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 99.02 | |
| 2ytg_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 99.01 | |
| 2yto_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 99.01 | |
| 2emk_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 99.01 | |
| 2emy_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 99.01 | |
| 2eow_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 99.01 | |
| 2enc_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 99.01 | |
| 2emm_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 99.01 | |
| 2epx_A | 47 | Zinc finger protein 28 homolog; C2H2, zinc finger | 99.01 | |
| 2eor_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 99.0 | |
| 2eov_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 99.0 | |
| 2emp_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 99.0 | |
| 2els_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 99.0 | |
| 2elo_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 99.0 | |
| 2kfq_A | 32 | FP1; protein, de novo protein; NMR {Synthetic} | 99.0 | |
| 2yu8_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 99.0 | |
| 2el6_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 99.0 | |
| 2wbt_A | 129 | B-129; zinc finger; 2.70A {Sulfolobus virus 1} | 98.99 | |
| 2ely_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 98.99 | |
| 2elv_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 98.99 | |
| 2eln_A | 38 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 98.99 | |
| 2emz_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 98.99 | |
| 2em2_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.99 | |
| 2en9_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.99 | |
| 2ytm_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.99 | |
| 2eox_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.99 | |
| 2ytk_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.99 | |
| 2elq_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 98.98 | |
| 2ept_A | 41 | Zinc finger protein 32; C2H2, zinc finger domain, | 98.98 | |
| 2yso_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 98.98 | |
| 1njq_A | 39 | Superman protein; zinc-finger, peptide-zinc comple | 98.97 | |
| 2en6_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 98.97 | |
| 2ytd_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.97 | |
| 2em8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.96 | |
| 2elt_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 98.96 | |
| 2ctu_A | 73 | Zinc finger protein 483; zinc finger domain, struc | 98.95 | |
| 2eou_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.95 | |
| 2elp_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 98.92 | |
| 2epu_A | 45 | Zinc finger protein 32; C2H2, zinc finger domain, | 98.92 | |
| 2kvg_A | 27 | Zinc finger and BTB domain-containing protein 32; | 98.92 | |
| 1ncs_A | 47 | Peptide M30F, transcriptional factor SWI5; DNA bin | 98.91 | |
| 2elr_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 98.9 | |
| 2m0d_A | 30 | Zinc finger and BTB domain-containing protein 17; | 98.9 | |
| 2ep0_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.9 | |
| 2kvh_A | 27 | Zinc finger and BTB domain-containing protein 32; | 98.89 | |
| 2els_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 98.89 | |
| 1va1_A | 37 | Transcription factor SP1; C2H2 type zinc finger, D | 98.88 | |
| 1rik_A | 29 | E6APC1 peptide; E6-binding domain, zinc finger, hu | 98.84 | |
| 2yrm_A | 43 | B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, | 98.84 | |
| 2eom_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 98.83 | |
| 2epq_A | 45 | POZ-, at HOOK-, and zinc finger-containing protein | 98.83 | |
| 2kvf_A | 28 | Zinc finger and BTB domain-containing protein 32; | 98.83 | |
| 2epp_A | 66 | POZ-, at HOOK-, and zinc finger-containing protein | 98.82 | |
| 2kvf_A | 28 | Zinc finger and BTB domain-containing protein 32; | 98.82 | |
| 2lvu_A | 26 | Zinc finger and BTB domain-containing protein 17; | 98.31 | |
| 2kvh_A | 27 | Zinc finger and BTB domain-containing protein 32; | 98.81 | |
| 1zfd_A | 32 | SWI5; DNA binding motif, zinc finger DNA binding d | 98.81 | |
| 2ytt_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.8 | |
| 1ard_A | 29 | Yeast transcription factor ADR1; transcription reg | 98.8 | |
| 2kvg_A | 27 | Zinc finger and BTB domain-containing protein 32; | 98.79 | |
| 1sp2_A | 31 | SP1F2; zinc finger, transcription activation; NMR | 98.78 | |
| 1klr_A | 30 | Zinc finger Y-chromosomal protein; transcription; | 98.77 | |
| 2epp_A | 66 | POZ-, at HOOK-, and zinc finger-containing protein | 98.77 | |
| 2m0f_A | 29 | Zinc finger and BTB domain-containing protein 17; | 98.76 | |
| 2eps_A | 54 | POZ-, at HOOK-, and zinc finger-containing protein | 98.76 | |
| 1bhi_A | 38 | CRE-BP1, ATF-2; CRE binding protein, transcription | 98.75 | |
| 2m0d_A | 30 | Zinc finger and BTB domain-containing protein 17; | 98.75 | |
| 1va1_A | 37 | Transcription factor SP1; C2H2 type zinc finger, D | 98.75 | |
| 2m0e_A | 29 | Zinc finger and BTB domain-containing protein 17; | 98.73 | |
| 1znf_A | 27 | 31ST zinc finger from XFIN; zinc finger DNA bindin | 98.72 | |
| 2lvr_A | 30 | Zinc finger and BTB domain-containing protein 17; | 98.18 | |
| 1paa_A | 30 | Yeast transcription factor ADR1; transcription reg | 98.71 | |
| 2lvt_A | 29 | Zinc finger and BTB domain-containing protein 17; | 98.18 | |
| 1ncs_A | 47 | Peptide M30F, transcriptional factor SWI5; DNA bin | 98.7 | |
| 1x3c_A | 73 | Zinc finger protein 292; DNA binding, nuclear prot | 98.7 | |
| 2lvr_A | 30 | Zinc finger and BTB domain-containing protein 17; | 98.16 | |
| 2epr_A | 48 | POZ-, at HOOK-, and zinc finger-containing protein | 98.69 | |
| 2kfq_A | 32 | FP1; protein, de novo protein; NMR {Synthetic} | 98.69 | |
| 2lvt_A | 29 | Zinc finger and BTB domain-containing protein 17; | 98.14 | |
| 1rik_A | 29 | E6APC1 peptide; E6-binding domain, zinc finger, hu | 98.68 | |
| 1znf_A | 27 | 31ST zinc finger from XFIN; zinc finger DNA bindin | 98.67 | |
| 2ent_A | 48 | Krueppel-like factor 15; zinc binding, transcripti | 98.65 | |
| 1rim_A | 33 | E6APC2 peptide; E6-binding domain, zinc finger, hu | 98.65 | |
| 1ard_A | 29 | Yeast transcription factor ADR1; transcription reg | 98.62 | |
| 1zfd_A | 32 | SWI5; DNA binding motif, zinc finger DNA binding d | 98.59 | |
| 1sp2_A | 31 | SP1F2; zinc finger, transcription activation; NMR | 98.57 | |
| 2m0f_A | 29 | Zinc finger and BTB domain-containing protein 17; | 98.57 | |
| 2lvu_A | 26 | Zinc finger and BTB domain-containing protein 17; | 97.97 | |
| 1paa_A | 30 | Yeast transcription factor ADR1; transcription reg | 98.55 | |
| 1klr_A | 30 | Zinc finger Y-chromosomal protein; transcription; | 98.54 | |
| 2m0e_A | 29 | Zinc finger and BTB domain-containing protein 17; | 98.54 | |
| 2ab3_A | 29 | ZNF29; zinc finger protein, beta BETA alpha, RREII | 98.5 | |
| 2ab3_A | 29 | ZNF29; zinc finger protein, beta BETA alpha, RREII | 98.46 | |
| 1x6f_A | 88 | Zinc finger protein 462; zinc finger domain, KIAA1 | 98.45 | |
| 1zw8_A | 64 | Zinc-responsive transcriptional regulator ZAP1; in | 98.35 | |
| 1vd4_A | 62 | Transcription initiation factor IIE, alpha subunit | 98.32 | |
| 1zr9_A | 124 | Zinc finger protein 593; DNA binding, structural g | 98.32 | |
| 2d9k_A | 75 | FLN29 gene product; zinc finger, ZF-TRAF, structur | 98.08 | |
| 1zr9_A | 124 | Zinc finger protein 593; DNA binding, structural g | 97.82 | |
| 1zw8_A | 64 | Zinc-responsive transcriptional regulator ZAP1; in | 97.68 | |
| 2e72_A | 49 | POGO transposable element with ZNF domain; zinc fi | 97.52 | |
| 1zu1_A | 127 | DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr | 97.44 | |
| 2e72_A | 49 | POGO transposable element with ZNF domain; zinc fi | 96.88 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 95.96 | |
| 3mjh_B | 34 | Early endosome antigen 1; protein-zinc finger comp | 95.26 | |
| 1wjv_A | 79 | Cell growth regulating nucleolar protein LYAR; DNA | 95.12 | |
| 1fu9_A | 36 | U-shaped transcriptional cofactor; zinc-finger, be | 94.72 | |
| 2yrk_A | 55 | Zinc finger homeobox protein 4; structure genomics | 94.61 | |
| 2k5c_A | 95 | Uncharacterized protein PF0385; structural genomic | 93.97 | |
| 1yuz_A | 202 | Nigerythrin; rubrythrin, rubredoxin, hemerythrin, | 93.94 | |
| 2k9h_A | 57 | Glycoprotein; hantavirus, zinc finger, CCHC, metal | 92.89 | |
| 2jvx_A | 28 | NF-kappa-B essential modulator; CCHC classical zin | 92.56 | |
| 2gmg_A | 105 | Hypothetical protein PF0610; winged-helix like pro | 92.52 | |
| 2elu_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 92.41 | |
| 4ayb_P | 48 | DNA-directed RNA polymerase; transferase, multi-su | 91.84 | |
| 3pwf_A | 170 | Rubrerythrin; non heme iron peroxidases, oxidative | 91.22 | |
| 3sp4_A | 204 | Aprataxin-like protein; HIT domain, zinc finger, D | 90.96 | |
| 2i5o_A | 39 | DNA polymerase ETA; zinc finger, DNA polymerase,PO | 90.78 | |
| 1lko_A | 191 | Rubrerythrin all-iron(II) form; reduced form, DIIR | 88.86 | |
| 1vq8_Z | 83 | 50S ribosomal protein L37AE; ribosome 50S, protein | 88.14 | |
| 2kdx_A | 119 | HYPA, hydrogenase/urease nickel incorporation prot | 87.95 | |
| 2yuc_A | 76 | TNF receptor-associated factor 4; ZF-TRAF, cystein | 87.23 | |
| 3h0g_L | 63 | DNA-directed RNA polymerases I, II, and III subuni | 85.19 | |
| 1wir_A | 121 | Protein arginine N-methyltransferase 3; C2H2 zinc | 84.66 | |
| 1twf_L | 70 | ABC10-alpha, DNA-directed RNA polymerases I, II, a | 84.32 | |
| 2djr_A | 76 | Zinc finger BED domain-containing protein 2; C2H2 | 83.43 | |
| 3iyl_X | 1214 | VP3; non-enveloped virus, membrane penetration pro | 81.08 | |
| 1gh9_A | 71 | 8.3 kDa protein (gene MTH1184); beta+alpha complex | 80.59 |
| >4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} | Back alignment and structure |
|---|
Probab=99.90 E-value=1.9e-24 Score=90.77 Aligned_cols=55 Identities=24% Similarity=0.585 Sum_probs=52.4
Q ss_pred CCCceecccccccccchhhHHHhHhhhcCCcCceeCChhhHhhhchHHHHHhhhcC
Q psy12265 16 GLKPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARKYQAHSYHQIR 71 (71)
Q Consensus 16 ~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~~~l~~h~~~~ 71 (71)
.|+||.|.+|++.|...+.|..|++ .|++++||.|.+||+.|...+.|..|++++
T Consensus 1 SEKpy~C~~C~k~F~~~~~L~~H~~-~Ht~ekp~~C~~C~k~F~~~~~L~~H~~~H 55 (60)
T 4gzn_C 1 SERPFFCNFCGKTYRDASGLSRHRR-AHLGYRPRSCPECGKCFRDQSEVNRHLKVH 55 (60)
T ss_dssp CCCCEECTTTCCEESSHHHHHHHHH-HHHTCCCEECTTTCCEESSHHHHHHHGGGG
T ss_pred CCCCccCCCCCCEeCCHHHHHHHHH-HhCCCcCeECCCCCCCcCCHHHHHHHhCcc
Confidence 3799999999999999999999998 899999999999999999999999999874
|
| >2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C | Back alignment and structure |
|---|
| >2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* | Back alignment and structure |
|---|
| >2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* | Back alignment and structure |
|---|
| >2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* | Back alignment and structure |
|---|
| >2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A | Back alignment and structure |
|---|
| >1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A | Back alignment and structure |
|---|
| >1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A | Back alignment and structure |
|---|
| >2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 | Back alignment and structure |
|---|
| >1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A | Back alignment and structure |
|---|
| >4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} | Back alignment and structure |
|---|
| >2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A | Back alignment and structure |
|---|
| >2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A | Back alignment and structure |
|---|
| >2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A | Back alignment and structure |
|---|
| >2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A | Back alignment and structure |
|---|
| >2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A | Back alignment and structure |
|---|
| >2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A | Back alignment and structure |
|---|
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C | Back alignment and structure |
|---|
| >2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A | Back alignment and structure |
|---|
| >2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* | Back alignment and structure |
|---|
| >2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A | Back alignment and structure |
|---|
| >2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A | Back alignment and structure |
|---|
| >2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A | Back alignment and structure |
|---|
| >1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A | Back alignment and structure |
|---|
| >1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A | Back alignment and structure |
|---|
| >2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A | Back alignment and structure |
|---|
| >2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B | Back alignment and structure |
|---|
| >2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A | Back alignment and structure |
|---|
| >2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A | Back alignment and structure |
|---|
| >2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A | Back alignment and structure |
|---|
| >2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A | Back alignment and structure |
|---|
| >3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A | Back alignment and structure |
|---|
| >2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B | Back alignment and structure |
|---|
| >2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A | Back alignment and structure |
|---|
| >2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kfq_A FP1; protein, de novo protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} | Back alignment and structure |
|---|
| >2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A | Back alignment and structure |
|---|
| >2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A | Back alignment and structure |
|---|
| >2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A | Back alignment and structure |
|---|
| >2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A | Back alignment and structure |
|---|
| >2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A | Back alignment and structure |
|---|
| >1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A | Back alignment and structure |
|---|
| >2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2kfq_A FP1; protein, de novo protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A | Back alignment and structure |
|---|
| >1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A | Back alignment and structure |
|---|
| >1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A | Back alignment and structure |
|---|
| >2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A | Back alignment and structure |
|---|
| >2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A | Back alignment and structure |
|---|
| >2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A | Back alignment and structure |
|---|
| >1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 | Back alignment and structure |
|---|
| >1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 | Back alignment and structure |
|---|
| >2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 | Back alignment and structure |
|---|
| >1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 | Back alignment and structure |
|---|
| >2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} | Back alignment and structure |
|---|
| >1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 | Back alignment and structure |
|---|
| >1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A | Back alignment and structure |
|---|
| >2yrk_A Zinc finger homeobox protein 4; structure genomics, ZF-C2H2 domain, ZFH-4, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.37.1.4 | Back alignment and structure |
|---|
| >2k5c_A Uncharacterized protein PF0385; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1yuz_A Nigerythrin; rubrythrin, rubredoxin, hemerythrin, electron transfer, DIIR center, oxidoreductase; 1.40A {Desulfovibrio vulgaris subsp} SCOP: a.25.1.1 g.41.5.1 PDB: 1yv1_A 1yux_A | Back alignment and structure |
|---|
| >2k9h_A Glycoprotein; hantavirus, zinc finger, CCHC, metal binding protein; NMR {Andes virus} | Back alignment and structure |
|---|
| >2jvx_A NF-kappa-B essential modulator; CCHC classical zinc finger, NEMO zinc finger, beta-BETA- alpha fold, coiled coil, cytoplasm, disease mutation; NMR {Synthetic} PDB: 2jvy_A | Back alignment and structure |
|---|
| >2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82 | Back alignment and structure |
|---|
| >2elu_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2elw_A | Back alignment and structure |
|---|
| >4ayb_P DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2pmz_P 2wb1_P 2y0s_P 3hkz_P 2waq_P 4b1o_P 4b1p_X | Back alignment and structure |
|---|
| >3pwf_A Rubrerythrin; non heme iron peroxidases, oxidative stress, oxidoreductase; 1.64A {Pyrococcus furiosus} PDB: 3mps_A 3pza_A 3qvd_A 1nnq_A 2hr5_A | Back alignment and structure |
|---|
| >3sp4_A Aprataxin-like protein; HIT domain, zinc finger, DNA-binding protein, DNA deadenylas hydrolase; 1.80A {Schizosaccharomyces pombe} PDB: 3spd_A* 3spl_A* 3szq_A* | Back alignment and structure |
|---|
| >2i5o_A DNA polymerase ETA; zinc finger, DNA polymerase,POL ETA, UBZ, ubiquitin-binding zinc finger, translesion synthesis, ubiquitin-binding domain; HET: DNA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1lko_A Rubrerythrin all-iron(II) form; reduced form, DIIRON, four-helix bundle, rubre like, electron transport; 1.63A {Desulfovibrio vulgaris} SCOP: a.25.1.1 g.41.5.1 PDB: 1dvb_A 1jyb_A 1b71_A 1lkm_A 1lkp_A 1qyb_A 1s2z_A 1s30_A 1ryt_A | Back alignment and structure |
|---|
| >1vq8_Z 50S ribosomal protein L37AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1vq4_Z* 1vq6_Z* 1vq5_Z* 1vq7_Z* 1vq9_Z* 1vqk_Z* 1vql_Z* 1vqm_Z* 1vqn_Z* 1vqo_Z* 1vqp_Z* 1yhq_Z* 1yi2_Z* 1yij_Z* 1yit_Z* 1yj9_Z* 1yjn_Z* 1yjw_Z* 2qa4_Z* 1s72_Z* ... | Back alignment and structure |
|---|
| >2kdx_A HYPA, hydrogenase/urease nickel incorporation protein HYPA; metallochaperone, metal-binding, metal- binding protein; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >2yuc_A TNF receptor-associated factor 4; ZF-TRAF, cysteine-rich domain associated with ring and TRAF domains protein 1, malignant 62; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3h0g_L DNA-directed RNA polymerases I, II, and III subunit rpabc4; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1wir_A Protein arginine N-methyltransferase 3; C2H2 zinc finger domain, PRMT3, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.37.1.5 | Back alignment and structure |
|---|
| >1twf_L ABC10-alpha, DNA-directed RNA polymerases I, II, and III 7.7 K polypeptide; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: g.41.9.2 PDB: 1i3q_L 1i6h_L 1k83_L* 1nik_L 1nt9_L 1pqv_L 1r5u_L 1r9s_L* 1r9t_L* 1sfo_L* 1twa_L* 1twc_L* 1i50_L* 1twg_L* 1twh_L* 1wcm_L 1y1v_L 1y1w_L 1y1y_L 1y77_L* ... | Back alignment and structure |
|---|
| >2djr_A Zinc finger BED domain-containing protein 2; C2H2 type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3iyl_X VP3; non-enveloped virus, membrane penetration protein, autocleav myristol group, icosahedral virus; HET: MYR; 3.30A {Grass carp reovirus} PDB: 3k1q_C 3k1q_B | Back alignment and structure |
|---|
| >1gh9_A 8.3 kDa protein (gene MTH1184); beta+alpha complex structure, structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: g.41.6.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 71 | ||||
| d2ct1a2 | 36 | g.37.1.1 (A:8-43) Transcriptional repressor CTCF { | 1e-06 | |
| d2epsa1 | 39 | g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ | 3e-06 | |
| d1x6ea1 | 33 | g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H | 1e-04 | |
| d1x6ha2 | 36 | g.37.1.1 (A:8-43) Transcriptional repressor CTCF { | 1e-04 | |
| d1p7aa_ | 37 | g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( | 2e-04 | |
| d2cota2 | 38 | g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont | 9e-04 | |
| d1a1ia2 | 28 | g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) | 0.004 |
| >d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 | Back information, alignment and structure |
|---|
class: Small proteins fold: beta-beta-alpha zinc fingers superfamily: beta-beta-alpha zinc fingers family: Classic zinc finger, C2H2 domain: Transcriptional repressor CTCF species: Human (Homo sapiens) [TaxId: 9606]
Score = 38.4 bits (90), Expect = 1e-06
Identities = 14/34 (41%), Positives = 18/34 (52%)
Query: 12 RVHLGLKPYGCEVCGRHFRQWGDLKYHKASLHSD 45
R H G KPY C +C F Q G +K H H++
Sbjct: 1 RTHSGEKPYECYICHARFTQSGTMKMHILQKHTE 34
|
| >d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 | Back information, alignment and structure |
|---|
| >d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 | Back information, alignment and structure |
|---|
| >d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 | Back information, alignment and structure |
|---|
| >d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 | Back information, alignment and structure |
|---|
| >d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 71 | |||
| d2csha1 | 53 | Zinc finger protein 297b {Human (Homo sapiens) [Ta | 99.88 | |
| d2epsa1 | 39 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 99.69 | |
| d2cota2 | 38 | Zinc finger and SCAN domain-containing protein 16, | 99.61 | |
| d1x6ea1 | 33 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 99.59 | |
| d2csha1 | 53 | Zinc finger protein 297b {Human (Homo sapiens) [Ta | 99.56 | |
| d1p7aa_ | 37 | Kruppel-like factor 3, Bklf {Mouse (Mus musculus) | 99.55 | |
| d1x6ha2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 99.54 | |
| d1p7aa_ | 37 | Kruppel-like factor 3, Bklf {Mouse (Mus musculus) | 99.53 | |
| d2cota2 | 38 | Zinc finger and SCAN domain-containing protein 16, | 99.52 | |
| d1x6ea1 | 33 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 99.51 | |
| d2ct1a2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 99.5 | |
| d1x6ha2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 99.49 | |
| d1srka_ | 35 | Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc | 99.49 | |
| d1srka_ | 35 | Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc | 99.45 | |
| d2adra1 | 29 | ADR1 {Synthetic, based on Saccharomyces cerevisiae | 99.44 | |
| d1a1ia2 | 28 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 99.41 | |
| d2ct1a2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 99.41 | |
| d1sp1a_ | 29 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 99.4 | |
| d1a1ia2 | 28 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 99.33 | |
| d1ncsa_ | 47 | SWI5 zinc-finger domains {Baker's yeast (Saccharom | 99.33 | |
| d1x6ea2 | 26 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 99.32 | |
| d2dlka2 | 36 | Zinc finger protein 692, ZNF692 {Human (Homo sapie | 99.32 | |
| d1x6ea2 | 26 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 99.27 | |
| d2adra1 | 29 | ADR1 {Synthetic, based on Saccharomyces cerevisiae | 99.22 | |
| d1sp1a_ | 29 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 99.2 | |
| d2glia3 | 30 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 99.19 | |
| d1ubdc3 | 30 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 99.14 | |
| d1ncsa_ | 47 | SWI5 zinc-finger domains {Baker's yeast (Saccharom | 99.08 | |
| d1sp2a_ | 31 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 99.07 | |
| d2epsa1 | 39 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 99.01 | |
| d1zfda_ | 32 | SWI5 zinc-finger domains {Baker's yeast (Saccharom | 99.01 | |
| d1a1ia1 | 29 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 98.95 | |
| d2glia3 | 30 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 98.95 | |
| d1zfda_ | 32 | SWI5 zinc-finger domains {Baker's yeast (Saccharom | 98.93 | |
| d1ubdc3 | 30 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 98.9 | |
| d1ubdc4 | 28 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 98.87 | |
| d1a1ia3 | 28 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 98.82 | |
| d2epra1 | 35 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 98.82 | |
| d1a1ia1 | 29 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 98.8 | |
| d1ubdc4 | 28 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 98.79 | |
| d1sp2a_ | 31 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 98.78 | |
| d2dmda2 | 26 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 98.76 | |
| d1ubdc2 | 28 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 98.71 | |
| d1a1ia3 | 28 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 98.71 | |
| d2dlka2 | 36 | Zinc finger protein 692, ZNF692 {Human (Homo sapie | 98.64 | |
| d2dmda2 | 26 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 98.51 | |
| d2dmda3 | 29 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 98.51 | |
| d2epqa1 | 32 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 98.4 | |
| d2epqa1 | 32 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 98.32 | |
| d2csha2 | 44 | Zinc finger protein 297b {Human (Homo sapiens) [Ta | 98.24 | |
| d2adra2 | 31 | ADR1 {Synthetic, based on Saccharomyces cerevisiae | 98.22 | |
| d2dlqa1 | 26 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 98.19 | |
| d1znfa_ | 26 | XFIN, third domain {Xenopus laevis [TaxId: 8355]} | 98.18 | |
| d1klra_ | 30 | ZFY {Human (Homo sapiens) [TaxId: 9606]} | 98.16 | |
| d2glia5 | 29 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 98.13 | |
| d1bboa2 | 29 | Enhancer binding protein {Human (Homo sapiens) [Ta | 98.13 | |
| d2dlqa1 | 26 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 98.11 | |
| d2j7ja2 | 29 | Transcription factor IIIA, TFIIIA {Xenopus laevis | 98.11 | |
| d2dlqa4 | 27 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 98.1 | |
| d1klra_ | 30 | ZFY {Human (Homo sapiens) [TaxId: 9606]} | 98.07 | |
| d1znfa_ | 26 | XFIN, third domain {Xenopus laevis [TaxId: 8355]} | 98.06 | |
| d2adra2 | 31 | ADR1 {Synthetic, based on Saccharomyces cerevisiae | 98.06 | |
| d2dmda3 | 29 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 97.99 | |
| d1ubdc2 | 28 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 97.97 | |
| d1x5wa2 | 29 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 97.96 | |
| d1njqa_ | 37 | SUPERMAN zinc finger domain {Thale cress (Arabidop | 97.94 | |
| d2j7ja2 | 29 | Transcription factor IIIA, TFIIIA {Xenopus laevis | 97.92 | |
| d2glia4 | 31 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 97.91 | |
| d2dmda1 | 28 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 97.91 | |
| d1bboa1 | 28 | Enhancer binding protein {Human (Homo sapiens) [Ta | 97.89 | |
| d1bboa2 | 29 | Enhancer binding protein {Human (Homo sapiens) [Ta | 97.88 | |
| d2csha2 | 44 | Zinc finger protein 297b {Human (Homo sapiens) [Ta | 97.85 | |
| d1bboa1 | 28 | Enhancer binding protein {Human (Homo sapiens) [Ta | 97.85 | |
| d1tf3a2 | 30 | Transcription factor IIIA, TFIIIA {Xenopus laevis | 97.82 | |
| d1njqa_ | 37 | SUPERMAN zinc finger domain {Thale cress (Arabidop | 97.82 | |
| d2dlqa3 | 30 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 97.8 | |
| d2glia5 | 29 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 97.79 | |
| d2dmda1 | 28 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 97.73 | |
| d1bhia_ | 38 | Transactivation domain of cre-bp1/atf-2 {Human (Ho | 97.7 | |
| d2dlqa2 | 28 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 97.54 | |
| d1bhia_ | 38 | Transactivation domain of cre-bp1/atf-2 {Human (Ho | 97.52 | |
| d2dlqa3 | 30 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 97.45 | |
| d2ct1a1 | 28 | Transcriptional repressor CTCF {Human (Homo sapien | 97.39 | |
| d1x5wa2 | 29 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 97.26 | |
| d1x5wa1 | 28 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 97.22 | |
| d1x6ha1 | 37 | Transcriptional repressor CTCF {Human (Homo sapien | 96.97 | |
| d1x5wa1 | 28 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 96.97 | |
| d1zr9a1 | 67 | Zinc finger protein 593, ZNF593 {Human (Homo sapie | 96.71 | |
| d2eppa1 | 53 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 96.53 | |
| d1y0jb1 | 36 | U-shaped transcription factor, different fingers { | 96.49 | |
| d2drpa2 | 26 | Tramtrack protein (two zinc-finger peptide) {Droso | 96.44 | |
| d1vd4a_ | 62 | Transcription initiation factor TFIIE-alpha {Human | 96.43 | |
| d1yuja_ | 54 | GAGA factor {Drosophila melanogaster [TaxId: 7227] | 96.22 | |
| d2eppa1 | 53 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 96.2 | |
| d1yuza2 | 36 | Nigerythrin, C-terminal domain {Desulfovibrio vulg | 95.81 | |
| d2glia2 | 33 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 95.39 | |
| d1nnqa2 | 37 | Rubrerythrin, C-terminal domain {Archaeon Pyrococc | 95.16 | |
| d1zr9a1 | 67 | Zinc finger protein 593, ZNF593 {Human (Homo sapie | 94.7 | |
| d2drpa1 | 37 | Tramtrack protein (two zinc-finger peptide) {Droso | 94.47 | |
| d1m36a_ | 33 | Monocytic leukemia zinc finger protein Moz {Human | 94.29 | |
| d2yrka1 | 48 | Zinc finger homeobox protein 4, ZFHX4 {Human (Homo | 92.72 | |
| d2j7ja1 | 28 | Transcription factor IIIA, TFIIIA {Xenopus laevis | 92.65 | |
| d2ak3a2 | 37 | Microbial and mitochondrial ADK, insert "zinc fing | 92.11 | |
| d2ctda2 | 30 | Zinc finger protein 512, ZNF512 {Human (Homo sapie | 91.73 | |
| d1x6fa1 | 75 | Zinc finger protein 462, ZNF462 {Human (Homo sapie | 91.34 | |
| d1wjpa3 | 41 | Zinc finger protein 295, ZNF295 {Human (Homo sapie | 90.92 | |
| d2ghfa1 | 58 | Zinc fingers and homeoboxes protein 1, ZHX1 {Human | 90.85 | |
| d2dlka1 | 30 | Zinc finger protein 692, ZNF692 {Human (Homo sapie | 89.85 | |
| d1fu9a_ | 36 | U-shaped transcription factor, different fingers { | 89.44 | |
| d1akya2 | 38 | Microbial and mitochondrial ADK, insert "zinc fing | 88.57 | |
| d1tf3a1 | 31 | Transcription factor IIIA, TFIIIA {Xenopus laevis | 87.32 | |
| d1tf3a3 | 31 | Transcription factor IIIA, TFIIIA {Xenopus laevis | 87.12 | |
| d1ubdc1 | 28 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 85.48 | |
| d1wjpa2 | 26 | Zinc finger protein 295, ZNF295 {Human (Homo sapie | 83.69 | |
| d1zina2 | 35 | Microbial and mitochondrial ADK, insert "zinc fing | 83.38 | |
| d1twfl_ | 46 | RBP12 subunit of RNA polymerase II {Baker's yeast | 81.88 | |
| d1s3ga2 | 35 | Microbial and mitochondrial ADK, insert "zinc fing | 81.38 | |
| d1zu1a2 | 55 | dsRNA-binding protein ZFa (ZNF346, JAZ) {African c | 81.13 | |
| d1lkoa2 | 44 | Rubrerythrin, C-terminal domain {Desulfovibrio vul | 80.5 | |
| d1wira_ | 121 | Protein arginine N-methyltransferase 3 {Mouse (Mus | 80.13 |
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: beta-beta-alpha zinc fingers superfamily: beta-beta-alpha zinc fingers family: Classic zinc finger, C2H2 domain: Zinc finger protein 297b species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.88 E-value=1.2e-23 Score=85.44 Aligned_cols=53 Identities=28% Similarity=0.602 Sum_probs=50.4
Q ss_pred CCceecccccccccchhhHHHhHhhhcCCcCceeCChhhHhhhchHHHHHhhhcC
Q psy12265 17 LKPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARKYQAHSYHQIR 71 (71)
Q Consensus 17 ~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~~~l~~h~~~~ 71 (71)
|+||.| .||+.|....+|..|++ .|++++||.|.+||+.|...+.|..|++++
T Consensus 1 EK~y~C-~Cgk~F~~~~~l~~H~~-~Ht~ekpy~C~~C~k~F~~~~~L~~H~r~H 53 (53)
T d2csha1 1 DKLYPC-QCGKSFTHKSQRDRHMS-MHLGLRPYGCGVCGKKFKMKHHLVGHMKIH 53 (53)
T ss_dssp CCCEEC-TTSCEESSHHHHHHHHH-HHSCCCSEECTTTSCEESSSHHHHHHHTTT
T ss_pred CcCCCC-CCCCeECCHHHhHHHhh-ccccccCCcCCCcCCEecCHHHHHHHHhcC
Confidence 689999 59999999999999998 899999999999999999999999999875
|
| >d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} | Back information, alignment and structure |
|---|
| >d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} | Back information, alignment and structure |
|---|
| >d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} | Back information, alignment and structure |
|---|
| >d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} | Back information, alignment and structure |
|---|
| >d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} | Back information, alignment and structure |
|---|
| >d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1m36a_ g.37.1.2 (A:) Monocytic leukemia zinc finger protein Moz {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2yrka1 g.37.1.4 (A:8-55) Zinc finger homeobox protein 4, ZFHX4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d2ak3a2 g.41.2.1 (A:125-161) Microbial and mitochondrial ADK, insert "zinc finger" domain {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wjpa3 g.37.1.1 (A:67-107) Zinc finger protein 295, ZNF295 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fu9a_ g.37.1.2 (A:) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1akya2 g.41.2.1 (A:131-168) Microbial and mitochondrial ADK, insert "zinc finger" domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1tf3a3 g.37.1.1 (A:71-101) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wjpa2 g.37.1.1 (A:43-66) Zinc finger protein 295, ZNF295 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zina2 g.41.2.1 (A:126-160) Microbial and mitochondrial ADK, insert "zinc finger" domain {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1twfl_ g.41.9.2 (L:) RBP12 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1s3ga2 g.41.2.1 (A:126-160) Microbial and mitochondrial ADK, insert "zinc finger" domain {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d1zu1a2 g.37.1.4 (A:74-128) dsRNA-binding protein ZFa (ZNF346, JAZ) {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1lkoa2 g.41.5.1 (A:148-191) Rubrerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} | Back information, alignment and structure |
|---|
| >d1wira_ g.37.1.5 (A:) Protein arginine N-methyltransferase 3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|