Psyllid ID: psy12265


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70-
MEKFTYLKVHNRVHLGLKPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARKYQAHSYHQIR
cccccccHHHHccccccccccccccccEEcccccHHHHHcccccccccccccccccccccccccccccccc
ccccHHHHHHHEEcccccccccccccccEcccccHHHHEEEEcccccccEcccccccccccccHHHHEccc
MEKFTYLKVHNrvhlglkpygcevcgrhfrqwgdlkyhkaslhsdvkafqceycgkdfarkyqahsyhqir
mekftylkvhnrvhlglkpyGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARKYQAHSYHQIR
MEKFTYLKVHNRVHLGLKPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARKYQAHSYHQIR
***FTYLKVHNRVHLGLKPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARKYQA*******
*EKFTYLKVHNRVHLGLKPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARKYQAHSYHQI*
MEKFTYLKVHNRVHLGLKPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARKYQ********
***FTYLKVHNRVHLGLKPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARKYQ*H******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooo
iiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEKFTYLKVHNRVHLGLKPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARKYQAHSYHQIR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query71 2.2.26 [Sep-21-2011]
P41696 914 Asparagine-rich zinc fing yes N/A 0.788 0.061 0.456 3e-10
P17038 809 Zinc finger protein 43 OS yes N/A 0.774 0.067 0.5 7e-10
Q9NYT6 803 Zinc finger protein 226 O no N/A 0.887 0.078 0.453 2e-09
Q9UK10706 Zinc finger protein 225 O no N/A 0.887 0.089 0.437 5e-09
Q61116 645 Zinc finger protein 235 O no N/A 0.887 0.097 0.421 5e-09
Q504L7898 Zinc finger protein 574 O no N/A 0.760 0.060 0.509 6e-09
Q8BY46900 Zinc finger protein 574 O no N/A 0.760 0.06 0.509 7e-09
Q6ZN55896 Zinc finger protein 574 O no N/A 0.760 0.060 0.509 7e-09
Q5R4P8895 Zinc finger protein 574 O no N/A 0.760 0.060 0.509 7e-09
Q6P2A1853 Histone-lysine N-methyltr no N/A 0.887 0.073 0.453 7e-09
>sp|P41696|AZF1_YEAST Asparagine-rich zinc finger protein AZF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AZF1 PE=1 SV=1 Back     alignment and function desciption
 Score = 63.9 bits (154), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 26/57 (45%), Positives = 39/57 (68%), Gaps = 1/57 (1%)

Query: 5   TYLKVHNRVHLGLKPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARK 61
           T+L+VH R H+G KP+ C+ CG+ F Q G+L+ H+  LH+  K + C+ C K F+RK
Sbjct: 606 THLEVHVRSHIGYKPFVCDYCGKRFTQGGNLRTHE-RLHTGEKPYSCDICDKKFSRK 661




Potential transcription factor; suppressor for a mitochondrial RNA polymerase mutant.
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (taxid: 559292)
>sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 Back     alignment and function description
>sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=1 SV=2 Back     alignment and function description
>sp|Q9UK10|ZN225_HUMAN Zinc finger protein 225 OS=Homo sapiens GN=ZNF225 PE=2 SV=2 Back     alignment and function description
>sp|Q61116|ZN235_MOUSE Zinc finger protein 235 OS=Mus musculus GN=Znf235 PE=2 SV=1 Back     alignment and function description
>sp|Q504L7|ZN574_RAT Zinc finger protein 574 OS=Rattus norvegicus GN=Znf574 PE=2 SV=1 Back     alignment and function description
>sp|Q8BY46|ZN574_MOUSE Zinc finger protein 574 OS=Mus musculus GN=Znf574 PE=2 SV=1 Back     alignment and function description
>sp|Q6ZN55|ZN574_HUMAN Zinc finger protein 574 OS=Homo sapiens GN=ZNF574 PE=1 SV=2 Back     alignment and function description
>sp|Q5R4P8|ZN574_PONAB Zinc finger protein 574 OS=Pongo abelii GN=ZNF574 PE=2 SV=1 Back     alignment and function description
>sp|Q6P2A1|PRDM9_DANRE Histone-lysine N-methyltransferase PRDM9 OS=Danio rerio GN=prdm9 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query71
383853992 649 PREDICTED: zinc finger protein 195-like 0.774 0.084 0.767 1e-20
350411473 647 PREDICTED: zinc finger protein 45-like [ 0.774 0.085 0.767 2e-20
340729771 647 PREDICTED: zinc finger protein 45-like [ 0.887 0.097 0.687 3e-20
328787424 646 PREDICTED: zinc finger protein 227-like 0.774 0.085 0.767 3e-20
380020763 644 PREDICTED: zinc finger protein 227-like 0.774 0.085 0.767 4e-20
242009920 900 zinc finger protein, putative [Pediculus 0.887 0.07 0.687 2e-19
332016289 642 Zinc finger protein 192 [Acromyrmex echi 0.690 0.076 0.75 2e-19
328722486 756 PREDICTED: zinc finger protein 611-like 0.774 0.072 0.785 6e-19
270005714 779 hypothetical protein TcasGA2_TC007815 [T 0.690 0.062 0.75 2e-18
91080335 696 PREDICTED: similar to AGAP010009-PA [Tri 0.690 0.070 0.75 5e-18
>gi|383853992|ref|XP_003702506.1| PREDICTED: zinc finger protein 195-like [Megachile rotundata] Back     alignment and taxonomy information
 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 43/56 (76%), Positives = 47/56 (83%)

Query: 7   LKVHNRVHLGLKPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARKY 62
           LKVH R+H G KPY CE CGRHFRQWGDLKYH  S+HS+ K +QCEYCGKDFARKY
Sbjct: 428 LKVHKRLHSGDKPYKCEECGRHFRQWGDLKYHSTSIHSEQKQYQCEYCGKDFARKY 483




Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|350411473|ref|XP_003489363.1| PREDICTED: zinc finger protein 45-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340729771|ref|XP_003403169.1| PREDICTED: zinc finger protein 45-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|328787424|ref|XP_395120.3| PREDICTED: zinc finger protein 227-like [Apis mellifera] Back     alignment and taxonomy information
>gi|380020763|ref|XP_003694248.1| PREDICTED: zinc finger protein 227-like [Apis florea] Back     alignment and taxonomy information
>gi|242009920|ref|XP_002425730.1| zinc finger protein, putative [Pediculus humanus corporis] gi|212509631|gb|EEB12992.1| zinc finger protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|332016289|gb|EGI57202.1| Zinc finger protein 192 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|328722486|ref|XP_001946974.2| PREDICTED: zinc finger protein 611-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|270005714|gb|EFA02162.1| hypothetical protein TcasGA2_TC007815 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|91080335|ref|XP_974602.1| PREDICTED: similar to AGAP010009-PA [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query71
FB|FBgn0031573 714 CG3407 [Drosophila melanogaste 0.901 0.089 0.562 4.1e-16
UNIPROTKB|E1BCC4 646 LOC787057 "Uncharacterized pro 0.915 0.100 0.449 6.9e-12
RGD|620595 744 Zfp111 "zinc finger protein 11 0.887 0.084 0.421 3.8e-11
UNIPROTKB|G3V9G6 744 Zfp111 "Protein Zfp111" [Rattu 0.887 0.084 0.421 3.8e-11
UNIPROTKB|F1LYN5149 F1LYN5 "Uncharacterized protei 0.915 0.436 0.378 4.5e-11
UNIPROTKB|I3L6L1650 ZNF226 "Uncharacterized protei 0.816 0.089 0.524 6.5e-11
UNIPROTKB|J9P2R7668 ZNF234 "Uncharacterized protei 0.887 0.094 0.453 6.8e-11
UNIPROTKB|Q9NYT6 803 ZNF226 "Zinc finger protein 22 0.816 0.072 0.524 8.8e-11
UNIPROTKB|J9P984 805 ZNF226 "Uncharacterized protei 0.816 0.072 0.524 8.8e-11
ZFIN|ZDB-GENE-071004-59217 zgc:173620 "zgc:173620" [Danio 0.887 0.290 0.421 9.4e-11
FB|FBgn0031573 CG3407 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 211 (79.3 bits), Expect = 4.1e-16, P = 4.1e-16
 Identities = 36/64 (56%), Positives = 44/64 (68%)

Query:     7 LKVHNRVHLGLKPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARKYQAHS 66
             LK H R H G+KP+ C+ C   FRQWGDLKYH  S HSDVKA  CE+CGK F+R+Y    
Sbjct:   538 LKAHERTHSGVKPFKCDKCEFQFRQWGDLKYHIISRHSDVKAHMCEFCGKSFSRRYSLVV 597

Query:    67 YHQI 70
             + +I
Sbjct:   598 HRRI 601


GO:0008270 "zinc ion binding" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
UNIPROTKB|E1BCC4 LOC787057 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|620595 Zfp111 "zinc finger protein 111" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|G3V9G6 Zfp111 "Protein Zfp111" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1LYN5 F1LYN5 "Uncharacterized protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|I3L6L1 ZNF226 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|J9P2R7 ZNF234 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NYT6 ZNF226 "Zinc finger protein 226" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J9P984 ZNF226 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-071004-59 zgc:173620 "zgc:173620" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query71
COG5189423 COG5189, SFP1, Putative transcriptional repressor 0.001
>gnl|CDD|227516 COG5189, SFP1, Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
 Score = 34.7 bits (79), Expect = 0.001
 Identities = 13/34 (38%), Positives = 17/34 (50%)

Query: 10  HNRVHLGLKPYGCEVCGRHFRQWGDLKYHKASLH 43
            N      KPY CEVC + ++    LKYH+   H
Sbjct: 389 MNIFSAKDKPYRCEVCDKRYKNLNGLKYHRKHSH 422


Length = 423

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 71
KOG2462|consensus279 99.86
KOG2462|consensus279 99.85
KOG3623|consensus1007 99.73
KOG3576|consensus267 99.59
KOG3623|consensus 1007 99.59
PHA00733128 hypothetical protein 99.42
PHA0276855 hypothetical protein; Provisional 99.4
KOG1074|consensus 958 99.37
KOG3576|consensus267 99.31
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 99.24
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 99.17
KOG1074|consensus958 99.17
KOG3608|consensus 467 99.14
KOG3608|consensus 467 99.1
PHA0073279 hypothetical protein 99.01
PHA0061644 hypothetical protein 98.88
PHA00733128 hypothetical protein 98.72
KOG3993|consensus 500 98.67
COG5189423 SFP1 Putative transcriptional repressor regulating 98.65
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.61
PLN03086567 PRLI-interacting factor K; Provisional 98.59
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 98.56
PHA0061644 hypothetical protein 98.47
PLN03086567 PRLI-interacting factor K; Provisional 98.4
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 98.37
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 98.33
PHA0276855 hypothetical protein; Provisional 98.31
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 98.3
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 98.29
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 98.07
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 98.05
PRK04860160 hypothetical protein; Provisional 97.98
smart0035526 ZnF_C2H2 zinc finger. 97.95
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 97.82
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 97.8
smart0035526 ZnF_C2H2 zinc finger. 97.6
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 97.59
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 97.58
KOG3993|consensus 500 97.58
PHA0073279 hypothetical protein 97.56
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 97.54
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 97.35
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 97.17
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 97.03
PRK04860160 hypothetical protein; Provisional 96.46
COG404965 Uncharacterized protein containing archaeal-type C 96.31
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 95.99
KOG1146|consensus 1406 95.86
COG5048 467 FOG: Zn-finger [General function prediction only] 95.54
KOG2893|consensus 341 95.39
TIGR00373158 conserved hypothetical protein TIGR00373. This fam 95.33
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 95.27
COG1592166 Rubrerythrin [Energy production and conversion] 95.13
smart00531147 TFIIE Transcription initiation factor IIE. 95.12
PF1371937 zinc_ribbon_5: zinc-ribbon domain 94.7
PRK06266178 transcription initiation factor E subunit alpha; V 94.67
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 94.61
TIGR0209838 MJ0042_CXXC MJ0042 family finger-like domain. This 94.4
PF1371736 zinc_ribbon_4: zinc-ribbon domain 94.18
KOG2186|consensus 276 93.96
PF09986 214 DUF2225: Uncharacterized protein conserved in bact 93.54
COG288861 Predicted Zn-ribbon RNA-binding protein with a fun 93.24
KOG1146|consensus1406 93.16
COG5189423 SFP1 Putative transcriptional repressor regulating 93.04
cd0072934 rubredoxin_SM Rubredoxin, Small Modular nonheme ir 92.72
PRK0039846 rpoP DNA-directed RNA polymerase subunit P; Provis 92.69
TIGR02300129 FYDLN_acid conserved hypothetical protein TIGR0230 92.54
smart0065944 RPOLCX RNA polymerase subunit CX. present in RNA p 92.28
KOG2593|consensus 436 92.2
PF0972342 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR0134 92.07
KOG2893|consensus 341 91.63
KOG3408|consensus129 91.6
PRK00464 154 nrdR transcriptional regulator NrdR; Validated 91.25
KOG2785|consensus 390 91.16
PF0775424 DUF1610: Domain of unknown function (DUF1610); Int 90.98
PF0289245 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc 90.88
KOG4167|consensus907 90.79
PF1526954 zf-C2H2_7: Zinc-finger 90.69
smart0073426 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18 90.66
PF04959 214 ARS2: Arsenite-resistance protein 2; InterPro: IPR 90.55
TIGR0260552 CxxC_CxxC_SSSS putative regulatory protein, FmdB f 90.39
COG5048467 FOG: Zn-finger [General function prediction only] 90.38
PF1345149 zf-trcl: Probable zinc-binding domain 90.09
COG199649 RPC10 DNA-directed RNA polymerase, subunit RPC10 ( 89.99
KOG2482|consensus 423 89.53
PRK1489059 putative Zn-ribbon RNA-binding protein; Provisiona 88.18
PF0519136 ADK_lid: Adenylate kinase, active site lid; InterP 87.89
PF0217660 zf-TRAF: TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 87.06
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 86.89
PHA0062659 hypothetical protein 86.59
PF0360432 DNA_RNApol_7kD: DNA directed RNA polymerase, 7 kDa 86.2
PF1001342 DUF2256: Uncharacterized protein conserved in bact 85.55
smart0061450 ZnF_BED BED zinc finger. DNA-binding domain in chr 85.23
PRK03824135 hypA hydrogenase nickel incorporation protein; Pro 84.99
PF04780 466 DUF629: Protein of unknown function (DUF629); Inte 84.67
smart0083441 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_C 84.2
PF04959214 ARS2: Arsenite-resistance protein 2; InterPro: IPR 83.97
PF1290740 zf-met2: Zinc-binding 83.9
PF0728269 OrfB_Zn_ribbon: Putative transposase DNA-binding d 83.84
PF0996356 DUF2197: Uncharacterized protein conserved in bact 83.39
COG1675176 TFA1 Transcription initiation factor IIE, alpha su 83.34
COG3364112 Zn-ribbon containing protein [General function pre 83.01
PLN02748468 tRNA dimethylallyltransferase 82.96
PF0797551 C1_4: TFIIH C1-like domain; InterPro: IPR004595 Al 82.91
COG4530129 Uncharacterized protein conserved in bacteria [Fun 82.45
COG3091156 SprT Zn-dependent metalloprotease, SprT family [Ge 82.22
COG433854 Uncharacterized protein conserved in bacteria [Fun 81.68
COG5236 493 Uncharacterized conserved protein, contains RING Z 81.56
KOG2231|consensus 669 81.35
>KOG2462|consensus Back     alignment and domain information
Probab=99.86  E-value=1.8e-22  Score=104.19  Aligned_cols=66  Identities=39%  Similarity=0.677  Sum_probs=56.5

Q ss_pred             ChHHHHHHHhHhhCCCceecccccccccchhhHHHhHhhhcCCcCceeCChhhHhhhchHHHHHhhh
Q psy12265          3 KFTYLKVHNRVHLGLKPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARKYQAHSYHQ   69 (71)
Q Consensus         3 ~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~~~l~~h~~   69 (71)
                      -+=.|+-|+|+|+||+||.|..|+++|...++|..||+ +|.+.++|+|..|++.|+..+.|.+|..
T Consensus       199 RPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQ-THS~~K~~qC~~C~KsFsl~SyLnKH~E  264 (279)
T KOG2462|consen  199 RPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQ-THSDVKKHQCPRCGKSFALKSYLNKHSE  264 (279)
T ss_pred             chHHhhcccccccCCCCccCCcccchhcchHHHHHHHH-hhcCCccccCcchhhHHHHHHHHHHhhh
Confidence            33456678899999999999999999999999999988 7988889999999999999999988864



>KOG2462|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>TIGR00373 conserved hypothetical protein TIGR00373 Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>COG1592 Rubrerythrin [Energy production and conversion] Back     alignment and domain information
>smart00531 TFIIE Transcription initiation factor IIE Back     alignment and domain information
>PF13719 zinc_ribbon_5: zinc-ribbon domain Back     alignment and domain information
>PRK06266 transcription initiation factor E subunit alpha; Validated Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain Back     alignment and domain information
>PF13717 zinc_ribbon_4: zinc-ribbon domain Back     alignment and domain information
>KOG2186|consensus Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase Back     alignment and domain information
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional Back     alignment and domain information
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300 Back     alignment and domain information
>smart00659 RPOLCX RNA polymerase subunit CX Back     alignment and domain information
>KOG2593|consensus Back     alignment and domain information
>PF09723 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR013429 This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>KOG3408|consensus Back     alignment and domain information
>PRK00464 nrdR transcriptional regulator NrdR; Validated Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>PF07754 DUF1610: Domain of unknown function (DUF1610); InterPro: IPR011668 This domain is found in archaeal species Back     alignment and domain information
>PF02892 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG4167|consensus Back     alignment and domain information
>PF15269 zf-C2H2_7: Zinc-finger Back     alignment and domain information
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger Back     alignment and domain information
>PF04959 ARS2: Arsenite-resistance protein 2; InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity [] Back     alignment and domain information
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF13451 zf-trcl: Probable zinc-binding domain Back     alignment and domain information
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription] Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional Back     alignment and domain information
>PF05191 ADK_lid: Adenylate kinase, active site lid; InterPro: IPR007862 Adenylate kinases (ADK; 2 Back     alignment and domain information
>PF02176 zf-TRAF: TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>PHA00626 hypothetical protein Back     alignment and domain information
>PF03604 DNA_RNApol_7kD: DNA directed RNA polymerase, 7 kDa subunit; InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates Back     alignment and domain information
>PF10013 DUF2256: Uncharacterized protein conserved in bacteria (DUF2256); InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>smart00614 ZnF_BED BED zinc finger Back     alignment and domain information
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional Back     alignment and domain information
>PF04780 DUF629: Protein of unknown function (DUF629); InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function Back     alignment and domain information
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein Back     alignment and domain information
>PF04959 ARS2: Arsenite-resistance protein 2; InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity [] Back     alignment and domain information
>PF12907 zf-met2: Zinc-binding Back     alignment and domain information
>PF07282 OrfB_Zn_ribbon: Putative transposase DNA-binding domain; InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins Back     alignment and domain information
>PF09963 DUF2197: Uncharacterized protein conserved in bacteria (DUF2197); InterPro: IPR019241 This family represents various hypothetical bacterial proteins with no known function Back     alignment and domain information
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription] Back     alignment and domain information
>COG3364 Zn-ribbon containing protein [General function prediction only] Back     alignment and domain information
>PLN02748 tRNA dimethylallyltransferase Back     alignment and domain information
>PF07975 C1_4: TFIIH C1-like domain; InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair Back     alignment and domain information
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only] Back     alignment and domain information
>COG4338 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query71
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 8e-09
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 2e-08
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 1e-07
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 5e-07
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 1e-06
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 2e-06
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 2e-06
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 2e-06
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 2e-06
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 2e-06
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 2e-06
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 2e-06
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 3e-06
2csh_A110 Solution Structure Of Tandem Repeat Of The Zf-C2h2 5e-06
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 1e-05
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 2e-05
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 5e-05
2ct1_A77 Solution Structure Of The Zinc Finger Domain Of Tra 3e-04
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 3e-04
1llm_C88 Crystal Structure Of A Zif23-Gcn4 Chimera Bound To 4e-04
1f2i_G73 Cocrystal Structure Of Selected Zinc Finger Dimer B 5e-04
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 5e-04
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 6e-04
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure

Iteration: 1

Score = 55.5 bits (132), Expect = 8e-09, Method: Compositional matrix adjust. Identities = 24/64 (37%), Positives = 37/64 (57%), Gaps = 1/64 (1%) Query: 7 LKVHNRVHLGLKPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARKYQAHS 66 L+ H R H G KPY C CG+ F Q L+ H+ + H+ K ++C CGK F+R+ H+ Sbjct: 93 LRAHQRTHTGEKPYACPECGKSFSQLAHLRAHQRT-HTGEKPYKCPECGKSFSREDNLHT 151 Query: 67 YHQI 70 + + Sbjct: 152 HQRT 155
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|2CSH|A Chain A, Solution Structure Of Tandem Repeat Of The Zf-C2h2 Domains Of Human Zinc Finger Protein 297b Length = 110 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|2CT1|A Chain A, Solution Structure Of The Zinc Finger Domain Of Transcriptional Repressor Ctcf Protein Length = 77 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|1LLM|C Chain C, Crystal Structure Of A Zif23-Gcn4 Chimera Bound To Dna Length = 88 Back     alignment and structure
>pdb|1F2I|G Chain G, Cocrystal Structure Of Selected Zinc Finger Dimer Bound To Dna Length = 73 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query71
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 3e-13
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 1e-06
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 2e-11
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 3e-07
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 3e-06
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-11
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 4e-04
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 1e-10
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 9e-08
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 1e-10
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 2e-10
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 4e-08
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 4e-07
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 2e-10
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 2e-06
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 3e-10
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 3e-07
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 1e-05
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 3e-10
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 6e-10
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 3e-10
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 5e-10
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 2e-05
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 3e-10
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 1e-07
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-04
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 4e-10
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 4e-08
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 5e-06
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 9e-06
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 5e-10
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 2e-05
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 7e-10
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 1e-09
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 3e-05
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 9e-04
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 9e-10
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-05
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 3e-04
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 1e-09
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 7e-07
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-09
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-06
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-05
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 3e-04
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 3e-09
2i13_A 190 AART; DNA binding, zinc finger, DNA binding protei 9e-09
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-08
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 3e-08
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 2e-08
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 2e-04
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 2e-08
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 8e-05
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 2e-08
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 4e-05
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 4e-08
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 4e-06
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 3e-04
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 1e-07
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 8e-06
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-07
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 5e-07
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 7e-07
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 1e-06
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-04
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 1e-06
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-06
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 4e-05
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 9e-05
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 2e-06
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 9e-05
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 2e-06
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 2e-05
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 3e-06
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 2e-05
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 4e-06
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-06
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 6e-06
1tf6_A190 Protein (transcription factor IIIA); complex (tran 9e-06
1tf6_A190 Protein (transcription factor IIIA); complex (tran 1e-05
1tf6_A 190 Protein (transcription factor IIIA); complex (tran 5e-05
1tf6_A190 Protein (transcription factor IIIA); complex (tran 7e-05
1tf6_A190 Protein (transcription factor IIIA); complex (tran 5e-04
1tf6_A190 Protein (transcription factor IIIA); complex (tran 9e-04
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-06
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-05
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-05
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-05
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-05
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 5e-05
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-05
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 6e-05
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-05
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-05
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 7e-05
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 7e-05
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-05
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-05
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-04
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-04
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-04
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 1e-04
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-04
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 1e-04
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-04
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-04
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-04
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-04
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-04
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 2e-04
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-04
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-04
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-04
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 2e-04
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-04
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-04
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-04
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-04
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-04
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-04
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-04
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-04
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-04
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-04
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-04
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-04
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-04
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-04
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-04
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-04
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-04
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 3e-04
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-04
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 3e-04
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-04
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-04
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-04
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 4e-04
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-04
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 4e-04
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-04
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-04
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-04
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 5e-04
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-04
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-04
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-04
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-04
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-04
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-04
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-04
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-04
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 6e-04
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 6e-04
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-04
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 7e-04
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-04
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-04
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-04
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-04
1ej6_B 1275 Lambda1; icosahedral, non-equivalence, dsRNA virus 8e-04
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
 Score = 57.1 bits (139), Expect = 3e-13
 Identities = 21/56 (37%), Positives = 26/56 (46%), Gaps = 1/56 (1%)

Query: 7  LKVHNRVHLGLKPYGCEVCGRHFRQWGDLKYHKASLHS-DVKAFQCEYCGKDFARK 61
               R H G KPY C +C   F Q G +K H    H+ +V  F C +C    ARK
Sbjct: 3  SGSSGRTHSGEKPYECYICHARFTQSGTMKMHILQKHTENVAKFHCPHCDTVIARK 58


>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>1ej6_B Lambda1; icosahedral, non-equivalence, dsRNA virus, methylase, methyltransferase, guanylyltransferase, zinc finger, icosahedral virus; 3.60A {Reovirus SP} SCOP: i.7.1.1 PDB: 2cse_V Length = 1275 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query71
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.9
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.88
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.86
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.86
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.85
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.85
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.83
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.83
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.83
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.83
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.82
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.82
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.82
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.82
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.81
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.8
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.8
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.79
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.79
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.79
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.78
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.78
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.78
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.78
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.78
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.77
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.77
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.77
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.77
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.76
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.76
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.76
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.75
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.75
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.75
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.75
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.75
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.75
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.74
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.73
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.73
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.73
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.73
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.73
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.71
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.7
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.69
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.69
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.69
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.68
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.67
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.66
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.66
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.66
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.66
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.66
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.66
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.66
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.66
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.65
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.65
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.65
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.65
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.65
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.65
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.65
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.65
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.65
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.65
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.65
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.65
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.65
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.65
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.65
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.65
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.65
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.65
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.65
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.65
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.65
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.64
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.64
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.64
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.64
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.64
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.64
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.64
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.64
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.64
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.64
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.64
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.64
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.64
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.64
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.64
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.63
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.63
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.63
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.63
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.63
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.62
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.62
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.62
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.62
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.6
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.6
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.6
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.59
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.59
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.58
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.57
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.57
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.57
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.57
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.57
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.57
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.57
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.57
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.57
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.56
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.56
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.56
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.56
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.56
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.56
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.56
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.56
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.56
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.56
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.56
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.56
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.56
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.56
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.56
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.56
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.56
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.55
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.55
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.55
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.55
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.55
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.55
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.55
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.54
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.54
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.54
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.54
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.54
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.54
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.54
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.54
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.53
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.53
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.53
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.53
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.52
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.51
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.51
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.51
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.51
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.51
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.5
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 99.5
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.49
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.49
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.49
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 99.48
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 99.48
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.47
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.47
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.46
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.43
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.41
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.41
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.39
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 99.37
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 99.37
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.36
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.34
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.34
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.34
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 99.32
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.3
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.29
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.27
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.27
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.26
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 99.24
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 99.21
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.21
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 99.18
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 99.18
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.17
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 99.16
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.15
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.15
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.14
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.11
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.11
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.1
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.1
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.09
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.09
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 99.09
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.08
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.08
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.08
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 99.08
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.08
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.07
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.07
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.07
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.06
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.06
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.06
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.06
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.06
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.06
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.06
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.06
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.06
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.06
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.06
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.06
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.06
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.06
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.06
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.06
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.06
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.05
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.05
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.05
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.05
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.05
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.05
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 99.05
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.05
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.04
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.04
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.04
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.04
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.04
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.04
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.04
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.04
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.04
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.04
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.04
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.04
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 99.04
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.04
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.04
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.04
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.03
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.03
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.03
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.03
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.03
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.03
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.03
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 99.03
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.03
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.03
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.03
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.03
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.03
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.02
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.02
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.02
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.02
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.02
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.02
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.02
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.02
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.02
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 99.02
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.02
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.01
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.01
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.01
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.01
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.01
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.01
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.01
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.01
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.0
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.0
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.0
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.0
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.0
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 99.0
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.0
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.0
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 98.99
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.99
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.99
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.99
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.99
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.99
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.99
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.99
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.99
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.99
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.98
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.98
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.98
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.97
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.97
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.97
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.96
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.96
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 98.95
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.95
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.92
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.92
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.92
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.91
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.9
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.9
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.9
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.89
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.89
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.88
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.84
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.84
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.83
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.83
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.83
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.82
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.82
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 98.31
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.81
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.81
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.8
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.8
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.79
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.78
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.77
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.77
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.76
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 98.76
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.75
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.75
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.75
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.73
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.72
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 98.18
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.71
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 98.18
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.7
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.7
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 98.16
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.69
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.69
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 98.14
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.68
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.67
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.65
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.65
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.62
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.59
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.57
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.57
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.97
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.55
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.54
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.54
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 98.5
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 98.46
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.45
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 98.35
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.32
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 98.32
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.08
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 97.82
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.68
2e72_A49 POGO transposable element with ZNF domain; zinc fi 97.52
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 97.44
2e72_A49 POGO transposable element with ZNF domain; zinc fi 96.88
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 95.96
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 95.26
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 95.12
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 94.72
2yrk_A55 Zinc finger homeobox protein 4; structure genomics 94.61
2k5c_A95 Uncharacterized protein PF0385; structural genomic 93.97
1yuz_A202 Nigerythrin; rubrythrin, rubredoxin, hemerythrin, 93.94
2k9h_A57 Glycoprotein; hantavirus, zinc finger, CCHC, metal 92.89
2jvx_A28 NF-kappa-B essential modulator; CCHC classical zin 92.56
2gmg_A105 Hypothetical protein PF0610; winged-helix like pro 92.52
2elu_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 92.41
4ayb_P48 DNA-directed RNA polymerase; transferase, multi-su 91.84
3pwf_A170 Rubrerythrin; non heme iron peroxidases, oxidative 91.22
3sp4_A204 Aprataxin-like protein; HIT domain, zinc finger, D 90.96
2i5o_A39 DNA polymerase ETA; zinc finger, DNA polymerase,PO 90.78
1lko_A191 Rubrerythrin all-iron(II) form; reduced form, DIIR 88.86
1vq8_Z83 50S ribosomal protein L37AE; ribosome 50S, protein 88.14
2kdx_A119 HYPA, hydrogenase/urease nickel incorporation prot 87.95
2yuc_A76 TNF receptor-associated factor 4; ZF-TRAF, cystein 87.23
3h0g_L63 DNA-directed RNA polymerases I, II, and III subuni 85.19
1wir_A121 Protein arginine N-methyltransferase 3; C2H2 zinc 84.66
1twf_L70 ABC10-alpha, DNA-directed RNA polymerases I, II, a 84.32
2djr_A76 Zinc finger BED domain-containing protein 2; C2H2 83.43
3iyl_X 1214 VP3; non-enveloped virus, membrane penetration pro 81.08
1gh9_A71 8.3 kDa protein (gene MTH1184); beta+alpha complex 80.59
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
Probab=99.90  E-value=1.9e-24  Score=90.77  Aligned_cols=55  Identities=24%  Similarity=0.585  Sum_probs=52.4

Q ss_pred             CCCceecccccccccchhhHHHhHhhhcCCcCceeCChhhHhhhchHHHHHhhhcC
Q psy12265         16 GLKPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARKYQAHSYHQIR   71 (71)
Q Consensus        16 ~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~~~l~~h~~~~   71 (71)
                      .|+||.|.+|++.|...+.|..|++ .|++++||.|.+||+.|...+.|..|++++
T Consensus         1 SEKpy~C~~C~k~F~~~~~L~~H~~-~Ht~ekp~~C~~C~k~F~~~~~L~~H~~~H   55 (60)
T 4gzn_C            1 SERPFFCNFCGKTYRDASGLSRHRR-AHLGYRPRSCPECGKCFRDQSEVNRHLKVH   55 (60)
T ss_dssp             CCCCEECTTTCCEESSHHHHHHHHH-HHHTCCCEECTTTCCEESSHHHHHHHGGGG
T ss_pred             CCCCccCCCCCCEeCCHHHHHHHHH-HhCCCcCeECCCCCCCcCCHHHHHHHhCcc
Confidence            3799999999999999999999998 899999999999999999999999999874



>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>2yrk_A Zinc finger homeobox protein 4; structure genomics, ZF-C2H2 domain, ZFH-4, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.37.1.4 Back     alignment and structure
>2k5c_A Uncharacterized protein PF0385; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Pyrococcus furiosus} Back     alignment and structure
>1yuz_A Nigerythrin; rubrythrin, rubredoxin, hemerythrin, electron transfer, DIIR center, oxidoreductase; 1.40A {Desulfovibrio vulgaris subsp} SCOP: a.25.1.1 g.41.5.1 PDB: 1yv1_A 1yux_A Back     alignment and structure
>2k9h_A Glycoprotein; hantavirus, zinc finger, CCHC, metal binding protein; NMR {Andes virus} Back     alignment and structure
>2jvx_A NF-kappa-B essential modulator; CCHC classical zinc finger, NEMO zinc finger, beta-BETA- alpha fold, coiled coil, cytoplasm, disease mutation; NMR {Synthetic} PDB: 2jvy_A Back     alignment and structure
>2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82 Back     alignment and structure
>2elu_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2elw_A Back     alignment and structure
>4ayb_P DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2pmz_P 2wb1_P 2y0s_P 3hkz_P 2waq_P 4b1o_P 4b1p_X Back     alignment and structure
>3pwf_A Rubrerythrin; non heme iron peroxidases, oxidative stress, oxidoreductase; 1.64A {Pyrococcus furiosus} PDB: 3mps_A 3pza_A 3qvd_A 1nnq_A 2hr5_A Back     alignment and structure
>3sp4_A Aprataxin-like protein; HIT domain, zinc finger, DNA-binding protein, DNA deadenylas hydrolase; 1.80A {Schizosaccharomyces pombe} PDB: 3spd_A* 3spl_A* 3szq_A* Back     alignment and structure
>2i5o_A DNA polymerase ETA; zinc finger, DNA polymerase,POL ETA, UBZ, ubiquitin-binding zinc finger, translesion synthesis, ubiquitin-binding domain; HET: DNA; NMR {Homo sapiens} Back     alignment and structure
>1lko_A Rubrerythrin all-iron(II) form; reduced form, DIIRON, four-helix bundle, rubre like, electron transport; 1.63A {Desulfovibrio vulgaris} SCOP: a.25.1.1 g.41.5.1 PDB: 1dvb_A 1jyb_A 1b71_A 1lkm_A 1lkp_A 1qyb_A 1s2z_A 1s30_A 1ryt_A Back     alignment and structure
>1vq8_Z 50S ribosomal protein L37AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1vq4_Z* 1vq6_Z* 1vq5_Z* 1vq7_Z* 1vq9_Z* 1vqk_Z* 1vql_Z* 1vqm_Z* 1vqn_Z* 1vqo_Z* 1vqp_Z* 1yhq_Z* 1yi2_Z* 1yij_Z* 1yit_Z* 1yj9_Z* 1yjn_Z* 1yjw_Z* 2qa4_Z* 1s72_Z* ... Back     alignment and structure
>2kdx_A HYPA, hydrogenase/urease nickel incorporation protein HYPA; metallochaperone, metal-binding, metal- binding protein; NMR {Helicobacter pylori} Back     alignment and structure
>2yuc_A TNF receptor-associated factor 4; ZF-TRAF, cysteine-rich domain associated with ring and TRAF domains protein 1, malignant 62; NMR {Homo sapiens} Back     alignment and structure
>3h0g_L DNA-directed RNA polymerases I, II, and III subunit rpabc4; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Back     alignment and structure
>1wir_A Protein arginine N-methyltransferase 3; C2H2 zinc finger domain, PRMT3, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.37.1.5 Back     alignment and structure
>1twf_L ABC10-alpha, DNA-directed RNA polymerases I, II, and III 7.7 K polypeptide; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: g.41.9.2 PDB: 1i3q_L 1i6h_L 1k83_L* 1nik_L 1nt9_L 1pqv_L 1r5u_L 1r9s_L* 1r9t_L* 1sfo_L* 1twa_L* 1twc_L* 1i50_L* 1twg_L* 1twh_L* 1wcm_L 1y1v_L 1y1w_L 1y1y_L 1y77_L* ... Back     alignment and structure
>2djr_A Zinc finger BED domain-containing protein 2; C2H2 type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3iyl_X VP3; non-enveloped virus, membrane penetration protein, autocleav myristol group, icosahedral virus; HET: MYR; 3.30A {Grass carp reovirus} PDB: 3k1q_C 3k1q_B Back     alignment and structure
>1gh9_A 8.3 kDa protein (gene MTH1184); beta+alpha complex structure, structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: g.41.6.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 71
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 1e-06
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 3e-06
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 1e-04
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 1e-04
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 2e-04
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 9e-04
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 0.004
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Transcriptional repressor CTCF
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 38.4 bits (90), Expect = 1e-06
 Identities = 14/34 (41%), Positives = 18/34 (52%)

Query: 12 RVHLGLKPYGCEVCGRHFRQWGDLKYHKASLHSD 45
          R H G KPY C +C   F Q G +K H    H++
Sbjct: 1  RTHSGEKPYECYICHARFTQSGTMKMHILQKHTE 34


>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query71
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.88
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.69
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.61
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.59
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.56
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.55
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.54
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.53
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.52
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.51
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.5
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.49
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.49
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.45
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.44
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.41
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.41
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.4
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.33
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.33
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.32
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 99.32
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.27
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.22
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.2
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 99.19
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 99.14
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.08
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.07
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.01
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.01
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.95
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.95
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.93
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.9
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.87
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.82
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.82
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.8
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.79
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.78
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.76
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.71
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.71
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.64
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.51
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.51
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.4
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.32
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 98.24
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.22
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 98.19
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 98.18
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 98.16
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.13
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 98.13
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 98.11
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 98.11
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 98.1
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 98.07
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 98.06
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.06
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.99
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.97
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.96
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.94
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.92
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.91
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.91
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.89
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.88
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.85
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.85
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.82
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.82
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.8
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.79
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.73
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 97.7
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.54
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 97.52
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.45
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 97.39
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.26
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.22
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 96.97
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.97
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 96.71
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 96.53
d1y0jb136 U-shaped transcription factor, different fingers { 96.49
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 96.44
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 96.43
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 96.22
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 96.2
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 95.81
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.39
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 95.16
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 94.7
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 94.47
d1m36a_33 Monocytic leukemia zinc finger protein Moz {Human 94.29
d2yrka148 Zinc finger homeobox protein 4, ZFHX4 {Human (Homo 92.72
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 92.65
d2ak3a237 Microbial and mitochondrial ADK, insert "zinc fing 92.11
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 91.73
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 91.34
d1wjpa341 Zinc finger protein 295, ZNF295 {Human (Homo sapie 90.92
d2ghfa158 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 90.85
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 89.85
d1fu9a_36 U-shaped transcription factor, different fingers { 89.44
d1akya238 Microbial and mitochondrial ADK, insert "zinc fing 88.57
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 87.32
d1tf3a331 Transcription factor IIIA, TFIIIA {Xenopus laevis 87.12
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 85.48
d1wjpa226 Zinc finger protein 295, ZNF295 {Human (Homo sapie 83.69
d1zina235 Microbial and mitochondrial ADK, insert "zinc fing 83.38
d1twfl_46 RBP12 subunit of RNA polymerase II {Baker's yeast 81.88
d1s3ga235 Microbial and mitochondrial ADK, insert "zinc fing 81.38
d1zu1a255 dsRNA-binding protein ZFa (ZNF346, JAZ) {African c 81.13
d1lkoa244 Rubrerythrin, C-terminal domain {Desulfovibrio vul 80.5
d1wira_121 Protein arginine N-methyltransferase 3 {Mouse (Mus 80.13
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.88  E-value=1.2e-23  Score=85.44  Aligned_cols=53  Identities=28%  Similarity=0.602  Sum_probs=50.4

Q ss_pred             CCceecccccccccchhhHHHhHhhhcCCcCceeCChhhHhhhchHHHHHhhhcC
Q psy12265         17 LKPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARKYQAHSYHQIR   71 (71)
Q Consensus        17 ~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~~~l~~h~~~~   71 (71)
                      |+||.| .||+.|....+|..|++ .|++++||.|.+||+.|...+.|..|++++
T Consensus         1 EK~y~C-~Cgk~F~~~~~l~~H~~-~Ht~ekpy~C~~C~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           1 DKLYPC-QCGKSFTHKSQRDRHMS-MHLGLRPYGCGVCGKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             CCCEEC-TTSCEESSHHHHHHHHH-HHSCCCSEECTTTSCEESSSHHHHHHHTTT
T ss_pred             CcCCCC-CCCCeECCHHHhHHHhh-ccccccCCcCCCcCCEecCHHHHHHHHhcC
Confidence            689999 59999999999999998 899999999999999999999999999875



>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1m36a_ g.37.1.2 (A:) Monocytic leukemia zinc finger protein Moz {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2yrka1 g.37.1.4 (A:8-55) Zinc finger homeobox protein 4, ZFHX4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2ak3a2 g.41.2.1 (A:125-161) Microbial and mitochondrial ADK, insert "zinc finger" domain {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjpa3 g.37.1.1 (A:67-107) Zinc finger protein 295, ZNF295 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fu9a_ g.37.1.2 (A:) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1akya2 g.41.2.1 (A:131-168) Microbial and mitochondrial ADK, insert "zinc finger" domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1tf3a3 g.37.1.1 (A:71-101) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjpa2 g.37.1.1 (A:43-66) Zinc finger protein 295, ZNF295 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zina2 g.41.2.1 (A:126-160) Microbial and mitochondrial ADK, insert "zinc finger" domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1twfl_ g.41.9.2 (L:) RBP12 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s3ga2 g.41.2.1 (A:126-160) Microbial and mitochondrial ADK, insert "zinc finger" domain {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1zu1a2 g.37.1.4 (A:74-128) dsRNA-binding protein ZFa (ZNF346, JAZ) {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1lkoa2 g.41.5.1 (A:148-191) Rubrerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1wira_ g.37.1.5 (A:) Protein arginine N-methyltransferase 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure