Psyllid ID: psy12268
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 410 | ||||||
| 328716306 | 1568 | PREDICTED: hypothetical protein LOC10057 | 0.373 | 0.097 | 0.372 | 4e-22 | |
| 334085159 | 963 | putative reverse transcriptase [Culex qu | 0.409 | 0.174 | 0.331 | 8e-21 | |
| 70907198 | 820 | reverse transcriptase [Aedes aegypti] | 0.412 | 0.206 | 0.339 | 3e-20 | |
| 103015 | 975 | hypothetical protein - African malaria m | 0.363 | 0.152 | 0.355 | 1e-19 | |
| 343481903 | 897 | unknown [Pectinophora gossypiella] | 0.478 | 0.218 | 0.333 | 1e-17 | |
| 270015859 | 1141 | hypothetical protein TcasGA2_TC016102 [T | 0.387 | 0.139 | 0.327 | 1e-17 | |
| 270015858 | 713 | hypothetical protein TcasGA2_TC016101 [T | 0.395 | 0.227 | 0.333 | 2e-17 | |
| 442761621 | 399 | Putative rte ele1 orf1 -h 1e-60 -j 4, pa | 0.380 | 0.390 | 0.371 | 1e-16 | |
| 270003248 | 737 | hypothetical protein TcasGA2_TC002455 [T | 0.365 | 0.203 | 0.346 | 1e-13 | |
| 358386705 | 1232 | hypothetical protein TRIVIDRAFT_30653 [T | 0.270 | 0.090 | 0.316 | 1e-10 |
| >gi|328716306|ref|XP_003245892.1| PREDICTED: hypothetical protein LOC100575767 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 112 bits (279), Expect = 4e-22, Method: Composition-based stats.
Identities = 57/153 (37%), Positives = 85/153 (55%)
Query: 187 LSAFGISGYLLQWIRNFLSGWIQIVRVGTSTSEPIHIPSGCIQGGHMSGLLFSLFINDIA 246
L GI LL W ++LS Q VR+ +S+ SG QG H+S LLF++FIN +
Sbjct: 793 LDRLGIGEPLLSWFGSYLSDRRQFVRLFGKSSDFFRASSGVPQGSHLSPLLFNIFINTMC 852
Query: 247 EIFPGFNFWLFADDLKVALRVGGQREVDSMQSMLSRLYHWCSINKMELNIGKCMVMTYHR 306
LFADD K+ LR+ + ++Q+ L + +WC+ + LNI KC VM++HR
Sbjct: 853 SAISSCRLLLFADDSKIFLRITTNNDCLTLQNTLDKFTNWCNTFNLSLNISKCKVMSFHR 912
Query: 307 NKSPILASYDINGQALARCEQVRDLGVTFQKTL 339
+KS Y + G ++ R QV+DLG+ F +L
Sbjct: 913 SKSVFSFDYKLGGISIQRVNQVQDLGILFVPSL 945
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|334085159|dbj|BAK26811.1| putative reverse transcriptase [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|70907198|gb|AAZ15240.1| reverse transcriptase [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|103015|pir||B34751 hypothetical protein - African malaria mosquito transposon T1-2 (fragment) gi|159644|gb|AAA29367.1| unknown [Anopheles gambiae] | Back alignment and taxonomy information |
|---|
| >gi|343481903|gb|AEM44817.1| unknown [Pectinophora gossypiella] | Back alignment and taxonomy information |
|---|
| >gi|270015859|gb|EFA12307.1| hypothetical protein TcasGA2_TC016102 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|270015858|gb|EFA12306.1| hypothetical protein TcasGA2_TC016101 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|442761621|gb|JAA72969.1| Putative rte ele1 orf1 -h 1e-60 -j 4, partial [Ixodes ricinus] | Back alignment and taxonomy information |
|---|
| >gi|270003248|gb|EEZ99695.1| hypothetical protein TcasGA2_TC002455 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|358386705|gb|EHK24300.1| hypothetical protein TRIVIDRAFT_30653 [Trichoderma virens Gv29-8] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 410 | ||||||
| FB|FBgn0004852 | 1307 | Ac76E "Adenylyl cyclase 76E" [ | 0.231 | 0.072 | 0.395 | 4.7e-08 | |
| RGD|619966 | 95 | Adcy7 "adenylate cyclase 7" [R | 0.097 | 0.421 | 0.560 | 5.3e-05 |
| FB|FBgn0004852 Ac76E "Adenylyl cyclase 76E" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 144 (55.7 bits), Expect = 4.7e-08, Sum P(2) = 4.7e-08
Identities = 38/96 (39%), Positives = 52/96 (54%)
Query: 316 DINGQALARCEQVRDLGVTFQKTLERQINDLIFIYKLVNNQIFCPDILTYSFTFSQEIGK 375
D+N Q L + ++ F K L + I K + + C L K
Sbjct: 1127 DVNKQGLECLRLLNEIICDFDKLLLKPKFSGIEKIKTIASTYMCASGLRPGKEDGATDEK 1186
Query: 376 QAE-HNIIVLVEFAIALVTILDQINRESFQRFRLRM 410
+ E HN+++LVEFAIAL++ILD INRESFQRFRLR+
Sbjct: 1187 RTEEHNVVILVEFAIALMSILDSINRESFQRFRLRI 1222
|
|
| RGD|619966 Adcy7 "adenylate cyclase 7" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 410 | |||
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 1e-16 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-15 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-15 | |
| cd01650 | 220 | cd01650, RT_nLTR_like, RT_nLTR: Non-LTR (long term | 2e-15 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-14 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 3e-14 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 6e-14 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 7e-14 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 7e-14 | |
| PRK05306 | 746 | PRK05306, infB, translation initiation factor IF-2 | 1e-13 | |
| PRK05306 | 746 | PRK05306, infB, translation initiation factor IF-2 | 2e-13 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 4e-13 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 5e-13 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 5e-13 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 5e-13 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 5e-13 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 1e-12 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 1e-12 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-12 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 4e-12 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 4e-12 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 9e-12 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 1e-11 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 1e-11 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-11 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 2e-11 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 3e-11 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 4e-11 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 4e-11 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 4e-11 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 4e-11 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 5e-11 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 5e-11 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 6e-11 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 9e-11 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-10 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 4e-10 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 5e-10 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 6e-10 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 9e-10 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 9e-10 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 1e-09 | |
| PRK05306 | 746 | PRK05306, infB, translation initiation factor IF-2 | 1e-09 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 1e-09 | |
| PTZ00108 | 1388 | PTZ00108, PTZ00108, DNA topoisomerase 2-like prote | 1e-09 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 5e-09 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 6e-09 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 8e-09 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 1e-08 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 1e-08 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 1e-08 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 1e-08 | |
| PTZ00108 | 1388 | PTZ00108, PTZ00108, DNA topoisomerase 2-like prote | 2e-08 | |
| PTZ00372 | 413 | PTZ00372, PTZ00372, endonuclease 4-like protein; P | 2e-08 | |
| pfam05262 | 489 | pfam05262, Borrelia_P83, Borrelia P83/100 protein | 2e-08 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 4e-08 | |
| PTZ00108 | 1388 | PTZ00108, PTZ00108, DNA topoisomerase 2-like prote | 5e-08 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 6e-08 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 7e-08 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 7e-08 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 9e-08 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 9e-08 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 1e-07 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 2e-07 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 2e-07 | |
| pfam09507 | 427 | pfam09507, CDC27, DNA polymerase subunit Cdc27 | 2e-07 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 3e-07 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 3e-07 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 3e-07 | |
| COG1293 | 564 | COG1293, COG1293, Predicted RNA-binding protein ho | 3e-07 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 4e-07 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 4e-07 | |
| pfam05262 | 489 | pfam05262, Borrelia_P83, Borrelia P83/100 protein | 4e-07 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 5e-07 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 5e-07 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 5e-07 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 6e-07 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 7e-07 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 7e-07 | |
| pfam04615 | 728 | pfam04615, Utp14, Utp14 protein | 7e-07 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 8e-07 | |
| PTZ00372 | 413 | PTZ00372, PTZ00372, endonuclease 4-like protein; P | 8e-07 | |
| pfam04615 | 728 | pfam04615, Utp14, Utp14 protein | 8e-07 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 9e-07 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 9e-07 | |
| PTZ00108 | 1388 | PTZ00108, PTZ00108, DNA topoisomerase 2-like prote | 1e-06 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 1e-06 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 1e-06 | |
| pfam09507 | 427 | pfam09507, CDC27, DNA polymerase subunit Cdc27 | 1e-06 | |
| PRK00409 | 782 | PRK00409, PRK00409, recombination and DNA strand e | 1e-06 | |
| PRK05035 | 695 | PRK05035, PRK05035, electron transport complex pro | 1e-06 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 1e-06 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 2e-06 | |
| PTZ00108 | 1388 | PTZ00108, PTZ00108, DNA topoisomerase 2-like prote | 2e-06 | |
| PTZ00108 | 1388 | PTZ00108, PTZ00108, DNA topoisomerase 2-like prote | 2e-06 | |
| PTZ00108 | 1388 | PTZ00108, PTZ00108, DNA topoisomerase 2-like prote | 2e-06 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-06 | |
| PTZ00372 | 413 | PTZ00372, PTZ00372, endonuclease 4-like protein; P | 2e-06 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 2e-06 | |
| TIGR03319 | 514 | TIGR03319, RNase_Y, ribonuclease Y | 2e-06 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 2e-06 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 2e-06 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 3e-06 | |
| PRK13808 | 333 | PRK13808, PRK13808, adenylate kinase; Provisional | 3e-06 | |
| pfam02029 | 431 | pfam02029, Caldesmon, Caldesmon | 3e-06 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 4e-06 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 4e-06 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 4e-06 | |
| PTZ00053 | 470 | PTZ00053, PTZ00053, methionine aminopeptidase 2; P | 4e-06 | |
| pfam13904 | 261 | pfam13904, DUF4207, Domain of unknown function (DU | 4e-06 | |
| PTZ00108 | 1388 | PTZ00108, PTZ00108, DNA topoisomerase 2-like prote | 5e-06 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 5e-06 | |
| PTZ00372 | 413 | PTZ00372, PTZ00372, endonuclease 4-like protein; P | 5e-06 | |
| pfam05262 | 489 | pfam05262, Borrelia_P83, Borrelia P83/100 protein | 5e-06 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 5e-06 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 5e-06 | |
| COG1293 | 564 | COG1293, COG1293, Predicted RNA-binding protein ho | 5e-06 | |
| COG1293 | 564 | COG1293, COG1293, Predicted RNA-binding protein ho | 5e-06 | |
| PLN02967 | 581 | PLN02967, PLN02967, kinase | 5e-06 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 5e-06 | |
| TIGR01554 | 384 | TIGR01554, major_cap_HK97, phage major capsid prot | 5e-06 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 6e-06 | |
| pfam02029 | 431 | pfam02029, Caldesmon, Caldesmon | 6e-06 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 7e-06 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 7e-06 | |
| PRK13808 | 333 | PRK13808, PRK13808, adenylate kinase; Provisional | 7e-06 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 8e-06 | |
| PRK12903 | 925 | PRK12903, secA, preprotein translocase subunit Sec | 8e-06 | |
| PTZ00372 | 413 | PTZ00372, PTZ00372, endonuclease 4-like protein; P | 9e-06 | |
| PRK13808 | 333 | PRK13808, PRK13808, adenylate kinase; Provisional | 9e-06 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 9e-06 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 9e-06 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-05 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 1e-05 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 1e-05 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 1e-05 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 1e-05 | |
| pfam04615 | 728 | pfam04615, Utp14, Utp14 protein | 1e-05 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 1e-05 | |
| PTZ00053 | 470 | PTZ00053, PTZ00053, methionine aminopeptidase 2; P | 1e-05 | |
| pfam00078 | 194 | pfam00078, RVT_1, Reverse transcriptase (RNA-depen | 1e-05 | |
| PRK10811 | 1068 | PRK10811, rne, ribonuclease E; Reviewed | 1e-05 | |
| PRK00247 | 429 | PRK00247, PRK00247, putative inner membrane protei | 1e-05 | |
| pfam06375 | 561 | pfam06375, BLVR, Bovine leukaemia virus receptor ( | 1e-05 | |
| PLN03237 | 1465 | PLN03237, PLN03237, DNA topoisomerase 2; Provision | 1e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-05 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 2e-05 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 2e-05 | |
| pfam04615 | 728 | pfam04615, Utp14, Utp14 protein | 2e-05 | |
| pfam06375 | 561 | pfam06375, BLVR, Bovine leukaemia virus receptor ( | 2e-05 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 2e-05 | |
| CHL00204 | 1832 | CHL00204, ycf1, Ycf1; Provisional | 2e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 3e-05 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 3e-05 | |
| PRK12903 | 925 | PRK12903, secA, preprotein translocase subunit Sec | 3e-05 | |
| PRK10811 | 1068 | PRK10811, rne, ribonuclease E; Reviewed | 3e-05 | |
| PRK00247 | 429 | PRK00247, PRK00247, putative inner membrane protei | 3e-05 | |
| PRK00247 | 429 | PRK00247, PRK00247, putative inner membrane protei | 3e-05 | |
| pfam07767 | 387 | pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | 3e-05 | |
| pfam04086 | 272 | pfam04086, SRP-alpha_N, Signal recognition particl | 3e-05 | |
| pfam05793 | 528 | pfam05793, TFIIF_alpha, Transcription initiation f | 3e-05 | |
| pfam05764 | 238 | pfam05764, YL1, YL1 nuclear protein | 3e-05 | |
| COG4499 | 434 | COG4499, COG4499, Predicted membrane protein [Func | 3e-05 | |
| pfam08432 | 182 | pfam08432, DUF1742, Fungal protein of unknown func | 3e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 4e-05 | |
| PRK13808 | 333 | PRK13808, PRK13808, adenylate kinase; Provisional | 4e-05 | |
| PRK00448 | 1437 | PRK00448, polC, DNA polymerase III PolC; Validated | 4e-05 | |
| pfam05087 | 887 | pfam05087, Rota_VP2, Rotavirus VP2 protein | 4e-05 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 5e-05 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 5e-05 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 5e-05 | |
| pfam09507 | 427 | pfam09507, CDC27, DNA polymerase subunit Cdc27 | 5e-05 | |
| PLN02967 | 581 | PLN02967, PLN02967, kinase | 5e-05 | |
| pfam08432 | 182 | pfam08432, DUF1742, Fungal protein of unknown func | 5e-05 | |
| pfam05262 | 489 | pfam05262, Borrelia_P83, Borrelia P83/100 protein | 6e-05 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 6e-05 | |
| PRK10811 | 1068 | PRK10811, rne, ribonuclease E; Reviewed | 6e-05 | |
| pfam08432 | 182 | pfam08432, DUF1742, Fungal protein of unknown func | 6e-05 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 7e-05 | |
| PRK00409 | 782 | PRK00409, PRK00409, recombination and DNA strand e | 7e-05 | |
| CHL00189 | 742 | CHL00189, infB, translation initiation factor 2; P | 7e-05 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 8e-05 | |
| PTZ00372 | 413 | PTZ00372, PTZ00372, endonuclease 4-like protein; P | 8e-05 | |
| pfam13904 | 261 | pfam13904, DUF4207, Domain of unknown function (DU | 8e-05 | |
| CHL00189 | 742 | CHL00189, infB, translation initiation factor 2; P | 8e-05 | |
| PTZ00108 | 1388 | PTZ00108, PTZ00108, DNA topoisomerase 2-like prote | 9e-05 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 9e-05 | |
| pfam05087 | 887 | pfam05087, Rota_VP2, Rotavirus VP2 protein | 9e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 1e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 1e-04 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 1e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-04 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 1e-04 | |
| PRK05035 | 695 | PRK05035, PRK05035, electron transport complex pro | 1e-04 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 1e-04 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 1e-04 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 1e-04 | |
| pfam06375 | 561 | pfam06375, BLVR, Bovine leukaemia virus receptor ( | 1e-04 | |
| CHL00204 | 1832 | CHL00204, ycf1, Ycf1; Provisional | 1e-04 | |
| PRK07735 | 430 | PRK07735, PRK07735, NADH dehydrogenase subunit C; | 1e-04 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 2e-04 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 2e-04 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 2e-04 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 2e-04 | |
| PRK00409 | 782 | PRK00409, PRK00409, recombination and DNA strand e | 2e-04 | |
| PRK05035 | 695 | PRK05035, PRK05035, electron transport complex pro | 2e-04 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 2e-04 | |
| TIGR03319 | 514 | TIGR03319, RNase_Y, ribonuclease Y | 2e-04 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 2e-04 | |
| PRK13808 | 333 | PRK13808, PRK13808, adenylate kinase; Provisional | 2e-04 | |
| pfam12569 | 516 | pfam12569, NARP1, NMDA receptor-regulated protein | 2e-04 | |
| PRK11642 | 813 | PRK11642, PRK11642, exoribonuclease R; Provisional | 2e-04 | |
| PRK11642 | 813 | PRK11642, PRK11642, exoribonuclease R; Provisional | 2e-04 | |
| pfam07423 | 214 | pfam07423, DUF1510, Protein of unknown function (D | 2e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 3e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 3e-04 | |
| PTZ00372 | 413 | PTZ00372, PTZ00372, endonuclease 4-like protein; P | 3e-04 | |
| PTZ00372 | 413 | PTZ00372, PTZ00372, endonuclease 4-like protein; P | 3e-04 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 3e-04 | |
| pfam09507 | 427 | pfam09507, CDC27, DNA polymerase subunit Cdc27 | 3e-04 | |
| COG5116 | 926 | COG5116, RPN2, 26S proteasome regulatory complex c | 3e-04 | |
| pfam10310 | 436 | pfam10310, DUF2413, Protein of unknown function (D | 3e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 4e-04 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 4e-04 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 4e-04 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 4e-04 | |
| PRK12903 | 925 | PRK12903, secA, preprotein translocase subunit Sec | 4e-04 | |
| pfam06375 | 561 | pfam06375, BLVR, Bovine leukaemia virus receptor ( | 4e-04 | |
| pfam12569 | 516 | pfam12569, NARP1, NMDA receptor-regulated protein | 4e-04 | |
| pfam00183 | 529 | pfam00183, HSP90, Hsp90 protein | 4e-04 | |
| pfam07946 | 322 | pfam07946, DUF1682, Protein of unknown function (D | 4e-04 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 5e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 5e-04 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 5e-04 | |
| pfam09507 | 427 | pfam09507, CDC27, DNA polymerase subunit Cdc27 | 5e-04 | |
| pfam04615 | 728 | pfam04615, Utp14, Utp14 protein | 5e-04 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 5e-04 | |
| PTZ00053 | 470 | PTZ00053, PTZ00053, methionine aminopeptidase 2; P | 5e-04 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 5e-04 | |
| TIGR01554 | 384 | TIGR01554, major_cap_HK97, phage major capsid prot | 5e-04 | |
| pfam06375 | 561 | pfam06375, BLVR, Bovine leukaemia virus receptor ( | 5e-04 | |
| PRK07735 | 430 | PRK07735, PRK07735, NADH dehydrogenase subunit C; | 5e-04 | |
| PRK11642 | 813 | PRK11642, PRK11642, exoribonuclease R; Provisional | 5e-04 | |
| pfam07423 | 214 | pfam07423, DUF1510, Protein of unknown function (D | 5e-04 | |
| pfam07946 | 322 | pfam07946, DUF1682, Protein of unknown function (D | 5e-04 | |
| COG1579 | 239 | COG1579, COG1579, Zn-ribbon protein, possibly nucl | 5e-04 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 6e-04 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 6e-04 | |
| PLN02967 | 581 | PLN02967, PLN02967, kinase | 6e-04 | |
| PRK00247 | 429 | PRK00247, PRK00247, putative inner membrane protei | 6e-04 | |
| pfam07767 | 387 | pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | 6e-04 | |
| pfam08432 | 182 | pfam08432, DUF1742, Fungal protein of unknown func | 6e-04 | |
| CHL00189 | 742 | CHL00189, infB, translation initiation factor 2; P | 6e-04 | |
| pfam07423 | 214 | pfam07423, DUF1510, Protein of unknown function (D | 6e-04 | |
| TIGR01069 | 771 | TIGR01069, mutS2, MutS2 family protein | 6e-04 | |
| PTZ00372 | 413 | PTZ00372, PTZ00372, endonuclease 4-like protein; P | 7e-04 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 7e-04 | |
| PRK13808 | 333 | PRK13808, PRK13808, adenylate kinase; Provisional | 7e-04 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 7e-04 | |
| pfam05793 | 528 | pfam05793, TFIIF_alpha, Transcription initiation f | 7e-04 | |
| COG4499 | 434 | COG4499, COG4499, Predicted membrane protein [Func | 7e-04 | |
| PRK11642 | 813 | PRK11642, PRK11642, exoribonuclease R; Provisional | 7e-04 | |
| COG0810 | 244 | COG0810, TonB, Periplasmic protein TonB, links inn | 7e-04 | |
| PTZ00108 | 1388 | PTZ00108, PTZ00108, DNA topoisomerase 2-like prote | 8e-04 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 8e-04 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 8e-04 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 8e-04 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 8e-04 | |
| PLN02967 | 581 | PLN02967, PLN02967, kinase | 8e-04 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 8e-04 | |
| pfam12569 | 516 | pfam12569, NARP1, NMDA receptor-regulated protein | 8e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 9e-04 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 9e-04 | |
| PRK11642 | 813 | PRK11642, PRK11642, exoribonuclease R; Provisional | 9e-04 | |
| TIGR01069 | 771 | TIGR01069, mutS2, MutS2 family protein | 9e-04 | |
| pfam03154 | 979 | pfam03154, Atrophin-1, Atrophin-1 family | 9e-04 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 0.001 | |
| PTZ00108 | 1388 | PTZ00108, PTZ00108, DNA topoisomerase 2-like prote | 0.001 | |
| PRK05035 | 695 | PRK05035, PRK05035, electron transport complex pro | 0.001 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 0.001 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 0.001 | |
| TIGR03319 | 514 | TIGR03319, RNase_Y, ribonuclease Y | 0.001 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 0.001 | |
| PTZ00053 | 470 | PTZ00053, PTZ00053, methionine aminopeptidase 2; P | 0.001 | |
| pfam13904 | 261 | pfam13904, DUF4207, Domain of unknown function (DU | 0.001 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 0.001 | |
| pfam05087 | 887 | pfam05087, Rota_VP2, Rotavirus VP2 protein | 0.001 | |
| CHL00189 | 742 | CHL00189, infB, translation initiation factor 2; P | 0.001 | |
| pfam12569 | 516 | pfam12569, NARP1, NMDA receptor-regulated protein | 0.001 | |
| pfam07423 | 214 | pfam07423, DUF1510, Protein of unknown function (D | 0.001 | |
| TIGR01069 | 771 | TIGR01069, mutS2, MutS2 family protein | 0.001 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 0.001 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 0.001 | |
| COG5269 | 379 | COG5269, ZUO1, Ribosome-associated chaperone zuoti | 0.001 | |
| pfam03343 | 603 | pfam03343, SART-1, SART-1 family | 0.001 | |
| pfam03343 | 603 | pfam03343, SART-1, SART-1 family | 0.001 | |
| PLN02381 | 1066 | PLN02381, PLN02381, valyl-tRNA synthetase | 0.001 | |
| PLN02381 | 1066 | PLN02381, PLN02381, valyl-tRNA synthetase | 0.001 | |
| PRK13735 | 942 | PRK13735, PRK13735, conjugal transfer mating pair | 0.001 | |
| COG5182 | 429 | COG5182, CUS1, Splicing factor 3b, subunit 2 [RNA | 0.001 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 0.002 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 0.002 | |
| PTZ00108 | 1388 | PTZ00108, PTZ00108, DNA topoisomerase 2-like prote | 0.002 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 0.002 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 0.002 | |
| PTZ00053 | 470 | PTZ00053, PTZ00053, methionine aminopeptidase 2; P | 0.002 | |
| PLN03237 | 1465 | PLN03237, PLN03237, DNA topoisomerase 2; Provision | 0.002 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 0.002 | |
| PRK11642 | 813 | PRK11642, PRK11642, exoribonuclease R; Provisional | 0.002 | |
| pfam07946 | 322 | pfam07946, DUF1682, Protein of unknown function (D | 0.002 | |
| TIGR01069 | 771 | TIGR01069, mutS2, MutS2 family protein | 0.002 | |
| pfam03154 | 979 | pfam03154, Atrophin-1, Atrophin-1 family | 0.002 | |
| pfam03154 | 979 | pfam03154, Atrophin-1, Atrophin-1 family | 0.002 | |
| pfam03154 | 979 | pfam03154, Atrophin-1, Atrophin-1 family | 0.002 | |
| COG5269 | 379 | COG5269, ZUO1, Ribosome-associated chaperone zuoti | 0.002 | |
| pfam08208 | 193 | pfam08208, RNA_polI_A34, DNA-directed RNA polymera | 0.002 | |
| TIGR01642 | 509 | TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la | 0.002 | |
| pfam14181 | 155 | pfam14181, YqfQ, YqfQ-like protein | 0.002 | |
| pfam13476 | 204 | pfam13476, AAA_23, AAA domain | 0.002 | |
| smart00435 | 391 | smart00435, TOPEUc, DNA Topoisomerase I (eukaryota | 0.002 | |
| pfam05758 | 832 | pfam05758, Ycf1, Ycf1 | 0.002 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 0.003 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.003 | |
| PRK00409 | 782 | PRK00409, PRK00409, recombination and DNA strand e | 0.003 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 0.003 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 0.003 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 0.003 | |
| TIGR01554 | 384 | TIGR01554, major_cap_HK97, phage major capsid prot | 0.003 | |
| CHL00204 | 1832 | CHL00204, ycf1, Ycf1; Provisional | 0.003 | |
| PRK07735 | 430 | PRK07735, PRK07735, NADH dehydrogenase subunit C; | 0.003 | |
| PRK11642 | 813 | PRK11642, PRK11642, exoribonuclease R; Provisional | 0.003 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 0.003 | |
| pfam03343 | 603 | pfam03343, SART-1, SART-1 family | 0.003 | |
| pfam08208 | 193 | pfam08208, RNA_polI_A34, DNA-directed RNA polymera | 0.003 | |
| COG4942 | 420 | COG4942, COG4942, Membrane-bound metallopeptidase | 0.003 | |
| COG4487 | 438 | COG4487, COG4487, Uncharacterized protein conserve | 0.003 | |
| pfam13166 | 713 | pfam13166, AAA_13, AAA domain | 0.003 | |
| PTZ00399 | 651 | PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Pro | 0.003 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.004 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 0.004 | |
| TIGR03319 | 514 | TIGR03319, RNase_Y, ribonuclease Y | 0.004 | |
| COG4499 | 434 | COG4499, COG4499, Predicted membrane protein [Func | 0.004 | |
| pfam12569 | 516 | pfam12569, NARP1, NMDA receptor-regulated protein | 0.004 | |
| COG0810 | 244 | COG0810, TonB, Periplasmic protein TonB, links inn | 0.004 | |
| PLN02381 | 1066 | PLN02381, PLN02381, valyl-tRNA synthetase | 0.004 | |
| PLN02381 | 1066 | PLN02381, PLN02381, valyl-tRNA synthetase | 0.004 | |
| pfam14181 | 155 | pfam14181, YqfQ, YqfQ-like protein | 0.004 | |
| COG4487 | 438 | COG4487, COG4487, Uncharacterized protein conserve | 0.004 | |
| pfam13166 | 713 | pfam13166, AAA_13, AAA domain | 0.004 | |
| PRK05771 | 646 | PRK05771, PRK05771, V-type ATP synthase subunit I; | 0.004 |
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
Score = 82.1 bits (202), Expect = 1e-16
Identities = 62/182 (34%), Positives = 95/182 (52%), Gaps = 3/182 (1%)
Query: 4 KKEEKKKKKKRRTKKKEKNKNKSRKEEEEEKRTKKKEKNKKNKNKSRKEEEKKKRTKKKE 63
KK E+KKK K +EK K K++ EE + + K K + K + + KKK + K+
Sbjct: 1284 KKAEEKKKADEAKKAEEKKKADEAKKKAEEAKKADEAKKKAEEAKKKADAAKKKAEEAKK 1343
Query: 64 KNKNKNRKEEKKKKKKRRTKKKEKNKNKSRKEEKKKEAEEEKKKTKNKEKNKNKSRKEEE 123
+ + E + ++K + + +KEE KK+A+ KKK + K+K +K EE
Sbjct: 1344 AAEAAKAEAEAAADEAEAAEEKAE-AAEKKKEEAKKKADAAKKKAEEKKKADEAKKKAEE 1402
Query: 124 EKKKEAEEKKKKRTKKK--EKNKNKSRKEEEEEEKKKKKKKKKKKRTKKKEEEKRKNEKA 181
+KKK E KK KKK E K K++ +E KKK ++ KK KKK EE +K E+A
Sbjct: 1403 DKKKADELKKAAAAKKKADEAKKKAEEKKKADEAKKKAEEAKKADEAKKKAEEAKKAEEA 1462
Query: 182 VR 183
+
Sbjct: 1463 KK 1464
|
Length = 2084 |
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238827 cd01650, RT_nLTR_like, RT_nLTR: Non-LTR (long terminal repeat) retrotransposon and non-LTR retrovirus reverse transcriptase (RT) | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235401 PRK05306, infB, translation initiation factor IF-2; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235401 PRK05306, infB, translation initiation factor IF-2; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235401 PRK05306, infB, translation initiation factor IF-2; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|114011 pfam05262, Borrelia_P83, Borrelia P83/100 protein | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|220271 pfam09507, CDC27, DNA polymerase subunit Cdc27 | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|224212 COG1293, COG1293, Predicted RNA-binding protein homologous to eukaryotic snRNP [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|114011 pfam05262, Borrelia_P83, Borrelia P83/100 protein | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|218177 pfam04615, Utp14, Utp14 protein | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218177 pfam04615, Utp14, Utp14 protein | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220271 pfam09507, CDC27, DNA polymerase subunit Cdc27 | Back alignment and domain information |
|---|
| >gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235334 PRK05035, PRK05035, electron transport complex protein RnfC; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|188306 TIGR03319, RNase_Y, ribonuclease Y | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172341 PRK13808, PRK13808, adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|202096 pfam02029, Caldesmon, Caldesmon | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|240246 PTZ00053, PTZ00053, methionine aminopeptidase 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222447 pfam13904, DUF4207, Domain of unknown function (DUF4207) | Back alignment and domain information |
|---|
| >gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|114011 pfam05262, Borrelia_P83, Borrelia P83/100 protein | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224212 COG1293, COG1293, Predicted RNA-binding protein homologous to eukaryotic snRNP [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|224212 COG1293, COG1293, Predicted RNA-binding protein homologous to eukaryotic snRNP [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|215521 PLN02967, PLN02967, kinase | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233467 TIGR01554, major_cap_HK97, phage major capsid protein, HK97 family | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|202096 pfam02029, Caldesmon, Caldesmon | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|172341 PRK13808, PRK13808, adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|237258 PRK12903, secA, preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172341 PRK13808, PRK13808, adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218177 pfam04615, Utp14, Utp14 protein | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|240246 PTZ00053, PTZ00053, methionine aminopeptidase 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215698 pfam00078, RVT_1, Reverse transcriptase (RNA-dependent DNA polymerase) | Back alignment and domain information |
|---|
| >gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|178945 PRK00247, PRK00247, putative inner membrane protein translocase component YidC; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|115057 pfam06375, BLVR, Bovine leukaemia virus receptor (BLVR) | Back alignment and domain information |
|---|
| >gnl|CDD|215641 PLN03237, PLN03237, DNA topoisomerase 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|218177 pfam04615, Utp14, Utp14 protein | Back alignment and domain information |
|---|
| >gnl|CDD|115057 pfam06375, BLVR, Bovine leukaemia virus receptor (BLVR) | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|214395 CHL00204, ycf1, Ycf1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237258 PRK12903, secA, preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|178945 PRK00247, PRK00247, putative inner membrane protein translocase component YidC; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|178945 PRK00247, PRK00247, putative inner membrane protein translocase component YidC; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | Back alignment and domain information |
|---|
| >gnl|CDD|217884 pfam04086, SRP-alpha_N, Signal recognition particle, alpha subunit, N-terminal | Back alignment and domain information |
|---|
| >gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) | Back alignment and domain information |
|---|
| >gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein | Back alignment and domain information |
|---|
| >gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|172341 PRK13808, PRK13808, adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234767 PRK00448, polC, DNA polymerase III PolC; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|191187 pfam05087, Rota_VP2, Rotavirus VP2 protein | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220271 pfam09507, CDC27, DNA polymerase subunit Cdc27 | Back alignment and domain information |
|---|
| >gnl|CDD|215521 PLN02967, PLN02967, kinase | Back alignment and domain information |
|---|
| >gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) | Back alignment and domain information |
|---|
| >gnl|CDD|114011 pfam05262, Borrelia_P83, Borrelia P83/100 protein | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|177089 CHL00189, infB, translation initiation factor 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222447 pfam13904, DUF4207, Domain of unknown function (DUF4207) | Back alignment and domain information |
|---|
| >gnl|CDD|177089 CHL00189, infB, translation initiation factor 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|191187 pfam05087, Rota_VP2, Rotavirus VP2 protein | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|235334 PRK05035, PRK05035, electron transport complex protein RnfC; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|115057 pfam06375, BLVR, Bovine leukaemia virus receptor (BLVR) | Back alignment and domain information |
|---|
| >gnl|CDD|214395 CHL00204, ycf1, Ycf1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236081 PRK07735, PRK07735, NADH dehydrogenase subunit C; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235334 PRK05035, PRK05035, electron transport complex protein RnfC; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|188306 TIGR03319, RNase_Y, ribonuclease Y | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172341 PRK13808, PRK13808, adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|236944 PRK11642, PRK11642, exoribonuclease R; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236944 PRK11642, PRK11642, exoribonuclease R; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220271 pfam09507, CDC27, DNA polymerase subunit Cdc27 | Back alignment and domain information |
|---|
| >gnl|CDD|227446 COG5116, RPN2, 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|220684 pfam10310, DUF2413, Protein of unknown function (DUF2413) | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|237258 PRK12903, secA, preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|115057 pfam06375, BLVR, Bovine leukaemia virus receptor (BLVR) | Back alignment and domain information |
|---|
| >gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein | Back alignment and domain information |
|---|
| >gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220271 pfam09507, CDC27, DNA polymerase subunit Cdc27 | Back alignment and domain information |
|---|
| >gnl|CDD|218177 pfam04615, Utp14, Utp14 protein | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|240246 PTZ00053, PTZ00053, methionine aminopeptidase 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233467 TIGR01554, major_cap_HK97, phage major capsid protein, HK97 family | Back alignment and domain information |
|---|
| >gnl|CDD|115057 pfam06375, BLVR, Bovine leukaemia virus receptor (BLVR) | Back alignment and domain information |
|---|
| >gnl|CDD|236081 PRK07735, PRK07735, NADH dehydrogenase subunit C; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236944 PRK11642, PRK11642, exoribonuclease R; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) | Back alignment and domain information |
|---|
| >gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) | Back alignment and domain information |
|---|
| >gnl|CDD|224495 COG1579, COG1579, Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|215521 PLN02967, PLN02967, kinase | Back alignment and domain information |
|---|
| >gnl|CDD|178945 PRK00247, PRK00247, putative inner membrane protein translocase component YidC; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | Back alignment and domain information |
|---|
| >gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) | Back alignment and domain information |
|---|
| >gnl|CDD|177089 CHL00189, infB, translation initiation factor 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) | Back alignment and domain information |
|---|
| >gnl|CDD|130141 TIGR01069, mutS2, MutS2 family protein | Back alignment and domain information |
|---|
| >gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172341 PRK13808, PRK13808, adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) | Back alignment and domain information |
|---|
| >gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|236944 PRK11642, PRK11642, exoribonuclease R; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215521 PLN02967, PLN02967, kinase | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|236944 PRK11642, PRK11642, exoribonuclease R; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130141 TIGR01069, mutS2, MutS2 family protein | Back alignment and domain information |
|---|
| >gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235334 PRK05035, PRK05035, electron transport complex protein RnfC; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|188306 TIGR03319, RNase_Y, ribonuclease Y | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240246 PTZ00053, PTZ00053, methionine aminopeptidase 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222447 pfam13904, DUF4207, Domain of unknown function (DUF4207) | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|191187 pfam05087, Rota_VP2, Rotavirus VP2 protein | Back alignment and domain information |
|---|
| >gnl|CDD|177089 CHL00189, infB, translation initiation factor 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) | Back alignment and domain information |
|---|
| >gnl|CDD|130141 TIGR01069, mutS2, MutS2 family protein | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|227594 COG5269, ZUO1, Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|217502 pfam03343, SART-1, SART-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|217502 pfam03343, SART-1, SART-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|215214 PLN02381, PLN02381, valyl-tRNA synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|215214 PLN02381, PLN02381, valyl-tRNA synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|184287 PRK13735, PRK13735, conjugal transfer mating pair stabilization protein TraG; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227509 COG5182, CUS1, Splicing factor 3b, subunit 2 [RNA processing and modification] | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|240246 PTZ00053, PTZ00053, methionine aminopeptidase 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215641 PLN03237, PLN03237, DNA topoisomerase 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|236944 PRK11642, PRK11642, exoribonuclease R; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) | Back alignment and domain information |
|---|
| >gnl|CDD|130141 TIGR01069, mutS2, MutS2 family protein | Back alignment and domain information |
|---|
| >gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|227594 COG5269, ZUO1, Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 | Back alignment and domain information |
|---|
| >gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor | Back alignment and domain information |
|---|
| >gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|222160 pfam13476, AAA_23, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|214661 smart00435, TOPEUc, DNA Topoisomerase I (eukaryota) | Back alignment and domain information |
|---|
| >gnl|CDD|218734 pfam05758, Ycf1, Ycf1 | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233467 TIGR01554, major_cap_HK97, phage major capsid protein, HK97 family | Back alignment and domain information |
|---|
| >gnl|CDD|214395 CHL00204, ycf1, Ycf1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236081 PRK07735, PRK07735, NADH dehydrogenase subunit C; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236944 PRK11642, PRK11642, exoribonuclease R; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|217502 pfam03343, SART-1, SART-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 | Back alignment and domain information |
|---|
| >gnl|CDD|227278 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|226889 COG4487, COG4487, Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|221952 pfam13166, AAA_13, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|240402 PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|188306 TIGR03319, RNase_Y, ribonuclease Y | Back alignment and domain information |
|---|
| >gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|215214 PLN02381, PLN02381, valyl-tRNA synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|215214 PLN02381, PLN02381, valyl-tRNA synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|226889 COG4487, COG4487, Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|221952 pfam13166, AAA_13, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|235600 PRK05771, PRK05771, V-type ATP synthase subunit I; Validated | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 410 | |||
| cd01651 | 226 | RT_G2_intron RT_G2_intron: Reverse transcriptases | 99.83 | |
| cd01650 | 220 | RT_nLTR_like RT_nLTR: Non-LTR (long terminal repea | 99.83 | |
| cd03487 | 214 | RT_Bac_retron_II RT_Bac_retron_II: Reverse transcr | 99.79 | |
| PF00078 | 214 | RVT_1: Reverse transcriptase (RNA-dependent DNA po | 99.79 | |
| cd01709 | 346 | RT_like_1 RT_like_1: A subfamily of reverse transc | 99.78 | |
| cd01646 | 158 | RT_Bac_retron_I RT_Bac_retron_I: Reverse transcrip | 99.76 | |
| cd01648 | 119 | TERT TERT: Telomerase reverse transcriptase (TERT) | 99.71 | |
| cd00304 | 98 | RT_like RT_like: Reverse transcriptase (RT, RNA-de | 99.38 | |
| KOG4768|consensus | 796 | 99.36 | ||
| cd03714 | 119 | RT_DIRS1 RT_DIRS1: Reverse transcriptases (RTs) oc | 98.74 | |
| cd01645 | 213 | RT_Rtv RT_Rtv: Reverse transcriptases (RTs) from r | 98.7 | |
| KOG1005|consensus | 888 | 98.52 | ||
| cd03715 | 210 | RT_ZFREV_like RT_ZFREV_like: A subfamily of revers | 98.49 | |
| cd01647 | 177 | RT_LTR RT_LTR: Reverse transcriptases (RTs) from r | 98.2 | |
| COG3344 | 328 | Retron-type reverse transcriptase [DNA replication | 96.74 | |
| cd01699 | 278 | RNA_dep_RNAP RNA_dep_RNAP: RNA-dependent RNA polym | 96.47 | |
| cd01644 | 213 | RT_pepA17 RT_pepA17: Reverse transcriptase (RTs) i | 96.34 | |
| CHL00002 | 504 | matK maturase K | 91.45 | |
| PF00680 | 491 | RdRP_1: RNA dependent RNA polymerase; InterPro: IP | 88.97 | |
| KOG4364|consensus | 811 | 85.33 | ||
| PTZ00121 | 2084 | MAEBL; Provisional | 83.52 | |
| PF03431 | 542 | RNA_replicase_B: RNA replicase, beta-chain ; Inter | 81.78 |
| >cd01651 RT_G2_intron RT_G2_intron: Reverse transcriptases (RTs) with group II intron origin | Back alignment and domain information |
|---|
Probab=99.83 E-value=6.3e-21 Score=178.20 Aligned_cols=134 Identities=19% Similarity=0.283 Sum_probs=113.9
Q ss_pred HhhhcCCCHHHHHHHHHhCCCChHHHHHHHHHhhcceEEEeeCCccCCccccCccccCCCcchhhhhhhhhhhhhhcc--
Q psy12268 172 EEEKRKNEKAVRLTKLSAFGISGYLLQWIRNFLSGWIQIVRVGTSTSEPIHIPSGCIQGGHMSGLLFSLFINDIAEIF-- 249 (410)
Q Consensus 172 ~~~~~~vdH~~Ll~~L~~~G~p~~li~lI~s~Ls~rs~~V~~~g~~S~~~~i~~GVPQGs~LSPLLFnL~l~~L~~~l-- 249 (410)
+.+||.|+|+.|+..|...|.++.++.||.+|+.... ...+..+....|||||+++||+||++|+++++..+
T Consensus 78 ~~~Fdsi~~~~l~~~l~~~~~~~~~~~~i~~~~~~~~------~~~~~~~~~~~GlpqG~~lSp~L~~~~l~~ld~~l~~ 151 (226)
T cd01651 78 KGFFDNIDHDLLLKILKRRIGDKRVLRLIRKWLKAGV------LEDGKLVETEKGTPQGGVISPLLANIYLHELDKFVEE 151 (226)
T ss_pred HHhcCCCCHHHHHHHHHHhcccHHHHHHHHHHHhceE------ccCCeEeCCCCCcCCCccHHHHHHHHHHHHHHHHHHH
Confidence 5689999999999999999999999999999864332 22345678899999999999999999999998754
Q ss_pred -------------CCcccccccchhhhhhhcCChhhhhhHHHHHHHHHhhhhhccccccccceeEEEeecCCCCccceee
Q psy12268 250 -------------PGFNFWLFADDLKVALRVGGQREVDSMQSMLSRLYHWCSINKMELNIGKCMVMTYHRNKSPILASYD 316 (410)
Q Consensus 250 -------------~~i~~l~YADDivIis~s~s~~~~~~Lq~~Ld~L~~w~~~~GLkIN~~KTeim~f~~~~~~~~~~~t 316 (410)
.++.+++||||++|++.+ ...++.+++.+..|+..+||.+|++||.++.++
T Consensus 152 ~~~~~~~~~~~~~~~~~~~rY~DD~~i~~~~-----~~~~~~~~~~i~~~~~~~gl~ln~~Kt~i~~~~----------- 215 (226)
T cd01651 152 KLKEYYDTSDPKFRRLRYVRYADDFVIGVRG-----PKEAEEIKELIREFLEELGLELNPEKTRITHFK----------- 215 (226)
T ss_pred hhhhcccccccccCceEEEEecCceEEecCC-----HHHHHHHHHHHHHHHHHcCCeechhhcceeecC-----------
Confidence 457899999999999843 344888899999999999999999999999985
Q ss_pred eCCccccccccccccceee
Q psy12268 317 INGQALARCEQVRDLGVTF 335 (410)
Q Consensus 317 i~g~~I~~ves~KYLGV~L 335 (410)
.+.+.|||+.|
T Consensus 216 --------~~~~~fLG~~~ 226 (226)
T cd01651 216 --------SEGFDFLGFTF 226 (226)
T ss_pred --------CCCCeeCCeEC
Confidence 33589999875
|
RT transcribes DNA using RNA as template. Proteins in this subfamily are found in bacterial and mitochondrial group II introns. Their most probable ancestor was a retrotransposable element with both gag-like and pol-like genes. This subfamily of proteins appears to have captured the RT sequences from transposable elements, which lack long terminal repeats (LTRs). |
| >cd01650 RT_nLTR_like RT_nLTR: Non-LTR (long terminal repeat) retrotransposon and non-LTR retrovirus reverse transcriptase (RT) | Back alignment and domain information |
|---|
| >cd03487 RT_Bac_retron_II RT_Bac_retron_II: Reverse transcriptases (RTs) in bacterial retrotransposons or retrons | Back alignment and domain information |
|---|
| >PF00078 RVT_1: Reverse transcriptase (RNA-dependent DNA polymerase); InterPro: IPR000477 The use of an RNA template to produce DNA, for integration into the host genome and exploitation of a host cell, is a strategy employed in the replication of retroid elements, such as the retroviruses and bacterial retrons | Back alignment and domain information |
|---|
| >cd01709 RT_like_1 RT_like_1: A subfamily of reverse transcriptases (RTs) | Back alignment and domain information |
|---|
| >cd01646 RT_Bac_retron_I RT_Bac_retron_I: Reverse transcriptases (RTs) in bacterial retrotransposons or retrons | Back alignment and domain information |
|---|
| >cd01648 TERT TERT: Telomerase reverse transcriptase (TERT) | Back alignment and domain information |
|---|
| >cd00304 RT_like RT_like: Reverse transcriptase (RT, RNA-dependent DNA polymerase)_like family | Back alignment and domain information |
|---|
| >KOG4768|consensus | Back alignment and domain information |
|---|
| >cd03714 RT_DIRS1 RT_DIRS1: Reverse transcriptases (RTs) occurring in the DIRS1 group of retransposons | Back alignment and domain information |
|---|
| >cd01645 RT_Rtv RT_Rtv: Reverse transcriptases (RTs) from retroviruses (Rtvs) | Back alignment and domain information |
|---|
| >KOG1005|consensus | Back alignment and domain information |
|---|
| >cd03715 RT_ZFREV_like RT_ZFREV_like: A subfamily of reverse transcriptases (RTs) found in sequences similar to the intact endogenous retrovirus ZFERV from zebrafish and to Moloney murine leukemia virus RT | Back alignment and domain information |
|---|
| >cd01647 RT_LTR RT_LTR: Reverse transcriptases (RTs) from retrotransposons and retroviruses which have long terminal repeats (LTRs) in their DNA copies but not in their RNA template | Back alignment and domain information |
|---|
| >COG3344 Retron-type reverse transcriptase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >cd01699 RNA_dep_RNAP RNA_dep_RNAP: RNA-dependent RNA polymerase (RdRp) is an essential protein encoded in the genomes of all RNA containing viruses with no DNA stage | Back alignment and domain information |
|---|
| >cd01644 RT_pepA17 RT_pepA17: Reverse transcriptase (RTs) in retrotransposons | Back alignment and domain information |
|---|
| >CHL00002 matK maturase K | Back alignment and domain information |
|---|
| >PF00680 RdRP_1: RNA dependent RNA polymerase; InterPro: IPR001205 RNA-directed RNA polymerase (RdRp) (2 | Back alignment and domain information |
|---|
| >KOG4364|consensus | Back alignment and domain information |
|---|
| >PTZ00121 MAEBL; Provisional | Back alignment and domain information |
|---|
| >PF03431 RNA_replicase_B: RNA replicase, beta-chain ; InterPro: IPR005093 RNA-directed RNA polymerase (RdRp) (2 | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 410 | |||
| 3kyl_A | 596 | Telomerase reverse transcriptase; reverse transcri | 99.64 | |
| 3fsi_A | 255 | RT, reverse transcriptase domain; transferase/DNA | 98.57 | |
| 1rw3_A | 455 | POL polyprotein; RNA and DNA dependent DNA polymer | 98.25 | |
| 2zd1_A | 557 | Reverse transcriptase/ribonuclease H; P51/P66, het | 98.18 | |
| 2zd1_B | 428 | P51 RT; P51/P66, hetero dimer, NNRTI, nonnucleosid | 98.15 | |
| 1mu2_A | 555 | HIV-2 RT; HIV-2 reverse transcriptase, AIDS, polym | 98.07 | |
| 1ra6_A | 461 | P3D, genome polyprotein; nucleotidyltransferase, R | 96.01 | |
| 1xr5_A | 466 | Genome polyprotein; RNA-dependent RNA polymerase, | 95.96 | |
| 2ckw_A | 515 | RNA-directed RNA polymerase; hydrolase, nucleotide | 94.75 | |
| 3uqs_A | 515 | RNA-dependent RNA polymerase; transferase; 2.00A { | 94.21 | |
| 1khv_A | 516 | RNA-directed RNA polymerase; RNA-dependent RNA pol | 92.77 | |
| 3n6m_A | 462 | RNA-dependent RNA polymerase; EV71, RDRP, GTP, tra | 90.94 | |
| 2ijd_1 | 644 | Picornain 3C, RNA-directed RNA polymerase; RNA-dep | 84.87 | |
| 1xr7_A | 460 | Genome polyprotein; RNA-dependent RNA polymerase, | 82.8 | |
| 3bso_A | 510 | RNA dependent RNA polymerase; RNA-dependent RNA po | 80.77 | |
| 1u09_A | 476 | Polyprotein; protein-DNA complex, RNA-dependent RN | 80.38 |
| >3kyl_A Telomerase reverse transcriptase; reverse transcriptase; 2.70A {Tribolium castaneum} PDB: 3du5_A 3du6_A | Back alignment and structure |
|---|
Probab=99.64 E-value=2.1e-16 Score=162.57 Aligned_cols=114 Identities=13% Similarity=0.105 Sum_probs=91.1
Q ss_pred hhhcCCCHHHHHHHHHhCCC---ChHHHHHHHHHhhcceEEEeeCCccCCccccCccccCCCcchhhhhhhhhhhhhhcc
Q psy12268 173 EEKRKNEKAVRLTKLSAFGI---SGYLLQWIRNFLSGWIQIVRVGTSTSEPIHIPSGCIQGGHMSGLLFSLFINDIAEIF 249 (410)
Q Consensus 173 ~~~~~vdH~~Ll~~L~~~G~---p~~li~lI~s~Ls~rs~~V~~~g~~S~~~~i~~GVPQGs~LSPLLFnL~l~~L~~~l 249 (410)
.-+|.|+|+.|+..|+..+. +..++.||..++...- |..+| ..+....|+|||++|||+|.|||++.+...+
T Consensus 254 kFFDnINHdkLLk~L~~~i~~IlDk~Il~LIkk~Lka~L--V~igG---k~y~qekGTPQGGVISPLLANIYLheLDkel 328 (596)
T 3kyl_A 254 DAYGNVKIPVLCKLIQSIPTHLLDSEKKNFIVDHISNQF--VAFRR---KIYKWNHGLLQGDPLSGCLCELYMAFMDRLY 328 (596)
T ss_dssp STTTTCCHHHHHHHHTTSCTTTSCHHHHHHHHHHHHCEE--EESSS---SEEEECSSSCBTCTTHHHHHHHHHHHHHHHH
T ss_pred hhCCCCCHHHHHHHHHhhccccccHHHHHHHHHHHhhCe--EEECC---EEEecCCcccCCcchhHHHHHHHHHHHHHHH
Confidence 46899999999999999875 7888999999986544 45565 3466789999999999999999999999764
Q ss_pred -----CCcccccccchhhhhhhcCChhhhhhHHHHHHHHHhhhhhccccccccceeE
Q psy12268 250 -----PGFNFWLFADDLKVALRVGGQREVDSMQSMLSRLYHWCSINKMELNIGKCMV 301 (410)
Q Consensus 250 -----~~i~~l~YADDivIis~s~s~~~~~~Lq~~Ld~L~~w~~~~GLkIN~~KTei 301 (410)
.+..+++||||++|++.+ ...++.++..+..| +++|++||.+
T Consensus 329 ~~~l~kd~~LVRYADDFVIi~~S-----ke~Aerfl~~Lkg~-----leLNpEKTrI 375 (596)
T 3kyl_A 329 FSNLDKDAFIHRTVDDYFFCSPH-----PHKVYDFELLIKGV-----YQVNPTKTRT 375 (596)
T ss_dssp STTSCTTSEEEECSSEEEEEESC-----HHHHHHHHHHHHHH-----SCEEEEEEEE
T ss_pred HHhhccCceEEEEcCcEEEEECC-----HHHHHHHHHHhhCc-----ceECchhcee
Confidence 356799999999999843 24455555555544 3999999986
|
| >3fsi_A RT, reverse transcriptase domain; transferase/DNA MMLV RT, protein-DNA complex, drug-DNA complex; HET: OWL; 1.75A {Moloney murine leukemia virus} SCOP: e.8.1.2 PDB: 1d1u_A 1n4l_A* 1ztt_A 2fjv_A* 2fjw_A 2fjx_A* 2fvp_A 2fvq_A 2fvr_A 2fvs_A 2r2r_A* 2r2s_A* 2r2t_A* 2r2u_A* 1ztw_A* 1i6j_A 1qaj_A* 1d0e_A* 1nnd_A 1mml_A ... | Back alignment and structure |
|---|
| >1rw3_A POL polyprotein; RNA and DNA dependent DNA polymerase, reverse transcriptase, transferase, replication; 3.00A {Moloney murine leukemia virus} SCOP: e.8.1.2 | Back alignment and structure |
|---|
| >2zd1_A Reverse transcriptase/ribonuclease H; P51/P66, hetero dimer, NNRTI, nonnucleoside inhibitor, AIDS, HIV, rilpivirine, diarylpyrimidine, DAPY, DNA recombination; HET: T27; 1.80A {Human immunodeficiency virus 1} PDB: 3is9_A* 3irx_A* 2ze2_A* 3bgr_A* 3qlh_A* 3klf_A* 3qo9_A* 1dlo_A 1bqm_A 2be2_A* 1s6q_A* 1s6p_A* 1s9g_A* 1suq_A* 2b5j_A* 2b6a_A* 2ban_A* 1s9e_A* 1hni_A* 1hnv_A* ... | Back alignment and structure |
|---|
| >2zd1_B P51 RT; P51/P66, hetero dimer, NNRTI, nonnucleoside inhibitor, AIDS, HIV, rilpivirine, diarylpyrimidine, DAPY, DNA recombination; HET: T27; 1.80A {Human immunodeficiency virus 1} SCOP: e.8.1.2 PDB: 2ykm_B* 2ykn_B* 2ze2_B* 3bgr_B* 3ig1_B* 3irx_B* 3is9_B* 3qo9_B* 3v4i_B* 3v6d_B* 3v81_B* 3klf_B* 3kk1_B* 3kjv_B* 3kk2_B* 3kk3_B* 2be2_B* 1n5y_B* 1bqm_B* 1n6q_B* ... | Back alignment and structure |
|---|
| >1mu2_A HIV-2 RT; HIV-2 reverse transcriptase, AIDS, polymerase, drug design, transferase; 2.35A {Human immunodeficiency virus 2} SCOP: c.55.3.1 e.8.1.2 PDB: 1mu2_B | Back alignment and structure |
|---|
| >1ra6_A P3D, genome polyprotein; nucleotidyltransferase, RNA-dependent, polym terminus, transferase; 2.00A {Human poliovirus 1} SCOP: e.8.1.4 PDB: 1ra7_A* 2ily_A* 2ilz_A* 2im0_A* 2im1_A* 2im2_A* 2im3_A* 2ijf_A 3ol9_A* 3ol7_A 3ol8_A 3ol6_A* 3ola_A* 3olb_A* 1tql_A 1rdr_A 1raj_A 3ddk_A 3cdu_A 3cdw_A | Back alignment and structure |
|---|
| >1xr5_A Genome polyprotein; RNA-dependent RNA polymerase, transferase; 2.80A {Human rhinovirus 14} SCOP: e.8.1.4 | Back alignment and structure |
|---|
| >2ckw_A RNA-directed RNA polymerase; hydrolase, nucleotide-binding, nucleotidyltransferase, covalent protein-RNA linkage, RNA elongation; 2.3A {Sapporo virus} PDB: 2uuw_A 2wk4_A 2uut_A | Back alignment and structure |
|---|
| >3uqs_A RNA-dependent RNA polymerase; transferase; 2.00A {Murine norovirus} PDB: 3ur0_A* 3upf_A* 3sfg_A* 3nah_A 3nai_A 3qid_A* 3sfu_A* | Back alignment and structure |
|---|
| >1khv_A RNA-directed RNA polymerase; RNA-dependent RNA polymerase, transferase; 2.50A {Rabbit hemorrhagic disease virus} SCOP: e.8.1.4 PDB: 1khw_A | Back alignment and structure |
|---|
| >3n6m_A RNA-dependent RNA polymerase; EV71, RDRP, GTP, transferase; HET: GTP; 2.50A {Human enterovirus 71} SCOP: e.8.1.4 PDB: 3n6l_A* 3n6n_A* | Back alignment and structure |
|---|
| >2ijd_1 Picornain 3C, RNA-directed RNA polymerase; RNA-dependent RNA polymerase, picornavirus, protease, hydrolase, transferase; 3.40A {Human poliovirus 1} SCOP: b.47.1.4 e.8.1.4 | Back alignment and structure |
|---|
| >1xr7_A Genome polyprotein; RNA-dependent RNA polymerase, transferase; 2.30A {Human rhinovirus 16} SCOP: e.8.1.4 PDB: 1tp7_A* 1xr6_A | Back alignment and structure |
|---|
| >3bso_A RNA dependent RNA polymerase; RNA-dependent RNA polymerase, viral replication, antiviral E inhibitor, helicase, hydrolase; HET: CTP; 1.74A {Norwalk virus} PDB: 3bsn_A* 3h5x_A* 3h5y_A* 1sh0_A 1sh2_A 1sh3_A 2b43_A | Back alignment and structure |
|---|
| >1u09_A Polyprotein; protein-DNA complex, RNA-dependent RNA polymerase, foot and disease virus, transferase; 1.91A {Foot-and-mouth disease virus} SCOP: e.8.1.4 PDB: 1wne_A 2e9r_X* 2e9t_A* 2e9z_A* 2ec0_A 3kmq_A 3kms_A 3koa_A 3kna_A 3klv_A 3nky_A 3nma_A 2f8e_X* 2d7s_A* 3nl0_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 410 | ||||
| d2es4d1 | 280 | a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) | 3e-05 | |
| d2es4d1 | 280 | a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) | 0.003 |
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 410 | |||
| d1ztwa1 | 255 | MMLV reverse transcriptase {Moloney murine leukemi | 98.34 | |
| d1mu2a2 | 427 | HIV-1 reverse transcriptase {Human immunodeficienc | 97.99 | |
| d2zd1b1 | 424 | HIV-1 reverse transcriptase {Human immunodeficienc | 97.92 | |
| d1hara_ | 216 | HIV-1 reverse transcriptase {Human immunodeficienc | 95.87 | |
| d1khva_ | 497 | Viral RNA polymerase {Rabbit hemorrhagic disease v | 94.41 | |
| d1sh0a_ | 502 | Viral RNA polymerase {Norwalk virus [TaxId: 11983] | 89.68 | |
| d1xr7a_ | 460 | Viral RNA polymerase {Human rhinovirus 16, HRV-16 | 83.49 | |
| d1ra6a_ | 461 | Viral RNA polymerase {Poliovirus type 1, strain Ma | 81.54 |
| >d1ztwa1 e.8.1.2 (A:24-278) MMLV reverse transcriptase {Moloney murine leukemia virus, MoMLV [TaxId: 11801]} | Back information, alignment and structure |
|---|
class: Multi-domain proteins (alpha and beta) fold: DNA/RNA polymerases superfamily: DNA/RNA polymerases family: Reverse transcriptase domain: MMLV reverse transcriptase species: Moloney murine leukemia virus, MoMLV [TaxId: 11801]
Probab=98.34 E-value=1.2e-07 Score=88.49 Aligned_cols=86 Identities=21% Similarity=0.149 Sum_probs=70.0
Q ss_pred ccccCCCcchhhhhhhhhhhhhhcc----CCcccccccchhhhhhhcCChhhhhhHHHHHHHHHhhhhhcccccccccee
Q psy12268 225 SGCIQGGHMSGLLFSLFINDIAEIF----PGFNFWLFADDLKVALRVGGQREVDSMQSMLSRLYHWCSINKMELNIGKCM 300 (410)
Q Consensus 225 ~GVPQGs~LSPLLFnL~l~~L~~~l----~~i~~l~YADDivIis~s~s~~~~~~Lq~~Ld~L~~w~~~~GLkIN~~KTe 300 (410)
..+|||..-||.+|.-+|+.++..+ +++.+..|.||++|++ .+...+...++.+...+..+||.+|++||+
T Consensus 163 ~~lPfGl~~spa~fq~~~~~il~~~~~~~~~~~~~~Y~DDili~s-----~t~~eh~~~l~~vl~~l~~~gl~~~~~K~~ 237 (255)
T d1ztwa1 163 TRLPQGFKNSPTLFDEALHRDLADFRIQHPDLILLQYVDDLLLAA-----TSELDCQQGTRALLQTLGNLGYRASAKKAQ 237 (255)
T ss_dssp SBCCTTCTTHHHHHHHHHHHHTHHHHHHCTTCEEEEETTEEEEEE-----SSHHHHHHHHHHHHHHHHHHTCCBCTTTCE
T ss_pred eeeehhcccchhhhHHHHHHHHHHhhccCCceEEEEEeeeeeccC-----CCHHHHHHHHHHHHHHHHHCcCEeCHHHeE
Confidence 4589999999999999888877543 4667888999999987 344666677888888889999999999999
Q ss_pred EEEeecCCCCccceeeeCCccccccccccccceeecC
Q psy12268 301 VMTYHRNKSPILASYDINGQALARCEQVRDLGVTFQK 337 (410)
Q Consensus 301 im~f~~~~~~~~~~~ti~g~~I~~ves~KYLGV~Ld~ 337 (410)
.. ..++.|||+.|+.
T Consensus 238 ~~----------------------~~~v~fLG~~I~~ 252 (255)
T d1ztwa1 238 IC----------------------QKQVKYLGYLLKE 252 (255)
T ss_dssp EE----------------------ESEEEETTEEEET
T ss_pred CC----------------------CCCcEEeEEEEeC
Confidence 62 2347899999874
|
| >d1mu2a2 e.8.1.2 (A:3-429) HIV-1 reverse transcriptase {Human immunodeficiency virus type 2 [TaxId: 11709]} | Back information, alignment and structure |
|---|
| >d2zd1b1 e.8.1.2 (B:5-428) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1 [TaxId: 11676]} | Back information, alignment and structure |
|---|
| >d1hara_ e.8.1.2 (A:) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1 [TaxId: 11676]} | Back information, alignment and structure |
|---|
| >d1khva_ e.8.1.4 (A:) Viral RNA polymerase {Rabbit hemorrhagic disease virus [TaxId: 11976]} | Back information, alignment and structure |
|---|
| >d1sh0a_ e.8.1.4 (A:) Viral RNA polymerase {Norwalk virus [TaxId: 11983]} | Back information, alignment and structure |
|---|
| >d1xr7a_ e.8.1.4 (A:) Viral RNA polymerase {Human rhinovirus 16, HRV-16 [TaxId: 31708]} | Back information, alignment and structure |
|---|
| >d1ra6a_ e.8.1.4 (A:) Viral RNA polymerase {Poliovirus type 1, strain Mahoney [TaxId: 12080]} | Back information, alignment and structure |
|---|