Psyllid ID: psy12268


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410
CKNKKEEKKKKKKRRTKKKEKNKNKSRKEEEEEKRTKKKEKNKKNKNKSRKEEEKKKRTKKKEKNKNKNRKEEKKKKKKRRTKKKEKNKNKSRKEEKKKEAEEEKKKTKNKEKNKNKSRKEEEEKKKEAEEKKKKRTKKKEKNKNKSRKEEEEEEKKKKKKKKKKKRTKKKEEEKRKNEKAVRLTKLSAFGISGYLLQWIRNFLSGWIQIVRVGTSTSEPIHIPSGCIQGGHMSGLLFSLFINDIAEIFPGFNFWLFADDLKVALRVGGQREVDSMQSMLSRLYHWCSINKMELNIGKCMVMTYHRNKSPILASYDINGQALARCEQVRDLGVTFQKTLERQINDLIFIYKLVNNQIFCPDILTYSFTFSQEIGKQAEHNIIVLVEFAIALVTILDQINRESFQRFRLRM
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccEEEEEEcccccccccccccccccccHHHHHHHHHHccccccccccccEEEEcccHHEEEcccHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEEccccccccEEEEccccccccccEEEEEEEEEccHHHHHHHHHHHHHHHccccccccccEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc
ccccHHHHHHHHHHccHHHHcccccccHHHHHHHHHHHHHHcccccccccHHHHHHHHcHHHHHccccccHHHHHHHHHHccHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccHHHHHHHHHHHcccEEEEEEccccccccEccccccccccHHHHHHHHHHHcHHccccccEEEEEHcccEEEccccccccHHHHHHHHHHHHHHHHHccccccccccEEEEEEccccccccEEEEcccEcccccHHHHcEEEEcccHHHHHHHHHHHHHHHHccEEEccHHHcccEccccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHcccc
cknkkeekKKKKKRRTKKKEKNKNKSRKEEEEEKRTKKKEKNKKNKNKSRKEEEKKKRTKKKEKNKNKNRKEEKKKKKKRRTKKKEKNKNKSRKEEKKKEAEEEKKKTKNKEKNKNKSRKEEEEKKKEAEEKKKKRTKKKEKNKNKSRKEEEEEEKKKKKKKKKKKRTKKKEEEKRKNEKAVRLTKLSAFGISGYLLQWIRNFLSGWIQIVRVgtstsepihipsgciqgghmsgLLFSLFINDIAeifpgfnfwlFADDLKVALRVGGQREVDSMQSMLSRLYHWCSINKMELNIGKCMVMtyhrnkspilasydingQALARCEQVRDLGVTFQKTLERQINDLIFIYKLVNnqifcpdiltysftFSQEIGKQAEHNIIVLVEFAIALVTILDQINRESFQRFRLRM
cknkkeekkkkkkrrtkkkeknknksrkeeeeekrtkkkeknkknknksrkeeekkkrtkkkeknknknrkeekkkkkkrrtkkkeknknksrkeekkkeaeeekkktknkeknknksrkeeeekkkeaeekkkkrtkkkeknknksrkeeeeeekkkkkkkkkkkrtkkkeeekrknekavrltklsafGISGYLLQWIRNFLSGWIQIVRVGTSTSEPIHIPSGCIQGGHMSGLLFSLFINDIAEIFPGFNFWLFADDLKVALRVGGQREVDSMQSMLSRLYHWCSINKMELNIGKCMVMTYHRNKSPILASYDINGQALARCEQVRDLGVTFQKTLERQINDLIFIYKLVNNQIFCPDILTYSFTFSQEIGKQAEHNIIVLVEFAIALVTILDQINRESFQRFRLRM
CknkkeekkkkkkrrtkkkeknknksrkeeeeekrtkkkeknkknknksrkeeekkkrtkkkeknknknrkeekkkkkkrrtkkkeknknksrkeekkkeaeeekkktknkeknknksrkeeeekkkeaeekkkkrtkkkeknknksrkeeeeeekkkkkkkkkkkrtkkkeeekrknekAVRLTKLSAFGISGYLLQWIRNFLSGWIQIVRVGTSTSEPIHIPSGCIQGGHMSGLLFSLFINDIAEIFPGFNFWLFADDLKVALRVGGQREVDSMQSMLSRLYHWCSINKMELNIGKCMVMTYHRNKSPILASYDINGQALARCEQVRDLGVTFQKTLERQINDLIFIYKLVNNQIFCPDILTYSFTFSQEIGKQAEHNIIVLVEFAIALVTILDQINRESFQRFRLRM
*************************************************************************************************************************************************************************************VRLTKLSAFGISGYLLQWIRNFLSGWIQIVRVGTSTSEPIHIPSGCIQGGHMSGLLFSLFINDIAEIFPGFNFWLFADDLKVALRVGGQREVDSMQSMLSRLYHWCSINKMELNIGKCMVMTYHRNKSPILASYDINGQALARCEQVRDLGVTFQKTLERQINDLIFIYKLVNNQIFCPDILTYSFTFSQEIGKQAEHNIIVLVEFAIALVTILDQINRE*********
***************************************************************************************************************************************************************************************LTKLSAFGISGYLLQWIRNFLSGWIQIVRVGTSTSEPIHIPSGCIQGGHMSGLLFSLFINDIAEIFPGFNFWLFADDLKVALRVGGQREVDSMQSMLSRLYHWCSINKMELNIGKCMVMTYHRNKSPILASYDINGQALARCEQVRDLGVTFQKTLERQINDLIFIYKLVNNQIFCPDILTYSFTFSQEIGKQAEHNIIVLVEFAIALVTILDQINRESFQRFRLRM
*************************************************************************************************************************************************************************************VRLTKLSAFGISGYLLQWIRNFLSGWIQIVRVGTSTSEPIHIPSGCIQGGHMSGLLFSLFINDIAEIFPGFNFWLFADDLKVALRVGGQREVDSMQSMLSRLYHWCSINKMELNIGKCMVMTYHRNKSPILASYDINGQALARCEQVRDLGVTFQKTLERQINDLIFIYKLVNNQIFCPDILTYSFTFSQEIGKQAEHNIIVLVEFAIALVTILDQINRESFQRFRLRM
CKNKKEEK*KKK**********************************************T************************************EKKKEAEEEKKKTKNKEKNKNKSRKEEEEKKKEAEEKKKKRTKKKEKNKNKSRKEEEEEEKKKKKKKKKKKRTKKKEEEKRKNEKAVRLTKLSAFGISGYLLQWIRNFLSGWIQIVRVGTSTSEPIHIPSGCIQGGHMSGLLFSLFINDIAEIFPGFNFWLFADDLKVALRVGGQREVDSMQSMLSRLYHWCSINKMELNIGKCMVMTYHRNKSPILASYDINGQALARCEQVRDLGVTFQKTLERQINDLIFIYKLVNNQIFCPDILTYSFTFSQEIGKQAEHNIIVLVEFAIALVTILDQINRESFQRFRLR*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRLTKLSAFGISGYLLQWIRNFLSGWIQIVRVGTSTSEPIHIPSGCIQGGHMSGLLFSLFINDIAEIFPGFNFWLFADDLKVALRVGGQREVDSMQSMLSRLYHWCSINKMELNIGKCMVMTYHRNKSPILASYDINGQALARCEQVRDLGVTFQKTLERQINDLIFIYKLVNNQIFCPDILTYSFTFSQEIGKQAEHNIIVLVEFAIALVTILDQINRESFQRFRLRM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query410 2.2.26 [Sep-21-2011]
Q4PBP6 1520 Stress response protein N N/A N/A 0.373 0.100 0.237 2e-06
F1QBY1 2876 Nipped-B-like protein B O no N/A 0.421 0.060 0.340 1e-05
A4R2R1 1311 Stress response protein N N/A N/A 0.407 0.127 0.241 2e-05
O01761 8081 Muscle M-line assembly pr yes N/A 0.434 0.022 0.328 3e-05
Q2GZN9 1255 Stress response protein N N/A N/A 0.407 0.133 0.255 5e-05
>sp|Q4PBP6|NST1_USTMA Stress response protein NST1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=NST1 PE=3 SV=1 Back     alignment and function desciption
 Score = 54.3 bits (129), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 37/156 (23%), Positives = 93/156 (59%), Gaps = 3/156 (1%)

Query: 29   EEEEEKRTKKKEKNKKNKNKSRKEEEKKKRTKKKEKNKNKNRKEEKKKKKKRRTKKKEKN 88
            E+  E R  K+ + KK+K K+++E ++ +R KK ++      +   +++ +R  + K++ 
Sbjct: 853  EKAREARRMKESQKKKDKKKAQREAKEAERLKKDQERAAAEAEVRAQQQAQRDAELKKQE 912

Query: 89   KNKSRKEEKKKEAEEEKKKTKNKEKNKNKSRKEEEEKKKEAEEKKKKRTKKKEKNKNKSR 148
            + + +KE ++K  E+EK K   + + +    +E + + +    +K+++ + + + + K++
Sbjct: 913  EIRLKKEAERKAREDEKAKKDEERRRRQAEERERQLEVERKRREKEEKIRLERELQEKAK 972

Query: 149  KEEEEEEKKKKKKKKKKKRTKK---KEEEKRKNEKA 181
            ++ EE ++K K+++++ +R K+   KEE++RK E A
Sbjct: 973  RDREEAQRKAKEEQQRVQRAKELKAKEEQERKAEAA 1008




May act as a negative regulator of salt tolerance.
Ustilago maydis (strain 521 / FGSC 9021) (taxid: 237631)
>sp|F1QBY1|NIPLB_DANRE Nipped-B-like protein B OS=Danio rerio GN=nipblb PE=2 SV=1 Back     alignment and function description
>sp|A4R2R1|NST1_MAGO7 Stress response protein NST1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=NST1 PE=3 SV=2 Back     alignment and function description
>sp|O01761|UNC89_CAEEL Muscle M-line assembly protein unc-89 OS=Caenorhabditis elegans GN=unc-89 PE=1 SV=3 Back     alignment and function description
>sp|Q2GZN9|NST1_CHAGB Stress response protein NST1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=NST1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query410
328716306 1568 PREDICTED: hypothetical protein LOC10057 0.373 0.097 0.372 4e-22
334085159 963 putative reverse transcriptase [Culex qu 0.409 0.174 0.331 8e-21
70907198 820 reverse transcriptase [Aedes aegypti] 0.412 0.206 0.339 3e-20
103015 975 hypothetical protein - African malaria m 0.363 0.152 0.355 1e-19
343481903 897 unknown [Pectinophora gossypiella] 0.478 0.218 0.333 1e-17
270015859 1141 hypothetical protein TcasGA2_TC016102 [T 0.387 0.139 0.327 1e-17
270015858 713 hypothetical protein TcasGA2_TC016101 [T 0.395 0.227 0.333 2e-17
442761621399 Putative rte ele1 orf1 -h 1e-60 -j 4, pa 0.380 0.390 0.371 1e-16
270003248 737 hypothetical protein TcasGA2_TC002455 [T 0.365 0.203 0.346 1e-13
358386705 1232 hypothetical protein TRIVIDRAFT_30653 [T 0.270 0.090 0.316 1e-10
>gi|328716306|ref|XP_003245892.1| PREDICTED: hypothetical protein LOC100575767 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  112 bits (279), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 57/153 (37%), Positives = 85/153 (55%)

Query: 187 LSAFGISGYLLQWIRNFLSGWIQIVRVGTSTSEPIHIPSGCIQGGHMSGLLFSLFINDIA 246
           L   GI   LL W  ++LS   Q VR+   +S+     SG  QG H+S LLF++FIN + 
Sbjct: 793 LDRLGIGEPLLSWFGSYLSDRRQFVRLFGKSSDFFRASSGVPQGSHLSPLLFNIFINTMC 852

Query: 247 EIFPGFNFWLFADDLKVALRVGGQREVDSMQSMLSRLYHWCSINKMELNIGKCMVMTYHR 306
                    LFADD K+ LR+    +  ++Q+ L +  +WC+   + LNI KC VM++HR
Sbjct: 853 SAISSCRLLLFADDSKIFLRITTNNDCLTLQNTLDKFTNWCNTFNLSLNISKCKVMSFHR 912

Query: 307 NKSPILASYDINGQALARCEQVRDLGVTFQKTL 339
           +KS     Y + G ++ R  QV+DLG+ F  +L
Sbjct: 913 SKSVFSFDYKLGGISIQRVNQVQDLGILFVPSL 945




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|334085159|dbj|BAK26811.1| putative reverse transcriptase [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|70907198|gb|AAZ15240.1| reverse transcriptase [Aedes aegypti] Back     alignment and taxonomy information
>gi|103015|pir||B34751 hypothetical protein - African malaria mosquito transposon T1-2 (fragment) gi|159644|gb|AAA29367.1| unknown [Anopheles gambiae] Back     alignment and taxonomy information
>gi|343481903|gb|AEM44817.1| unknown [Pectinophora gossypiella] Back     alignment and taxonomy information
>gi|270015859|gb|EFA12307.1| hypothetical protein TcasGA2_TC016102 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270015858|gb|EFA12306.1| hypothetical protein TcasGA2_TC016101 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|442761621|gb|JAA72969.1| Putative rte ele1 orf1 -h 1e-60 -j 4, partial [Ixodes ricinus] Back     alignment and taxonomy information
>gi|270003248|gb|EEZ99695.1| hypothetical protein TcasGA2_TC002455 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|358386705|gb|EHK24300.1| hypothetical protein TRIVIDRAFT_30653 [Trichoderma virens Gv29-8] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query410
FB|FBgn00048521307 Ac76E "Adenylyl cyclase 76E" [ 0.231 0.072 0.395 4.7e-08
RGD|61996695 Adcy7 "adenylate cyclase 7" [R 0.097 0.421 0.560 5.3e-05
FB|FBgn0004852 Ac76E "Adenylyl cyclase 76E" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 144 (55.7 bits), Expect = 4.7e-08, Sum P(2) = 4.7e-08
 Identities = 38/96 (39%), Positives = 52/96 (54%)

Query:   316 DINGQALARCEQVRDLGVTFQKTLERQINDLIFIYKLVNNQIFCPDILTYSFTFSQEIGK 375
             D+N Q L     + ++   F K L +     I   K + +   C   L           K
Sbjct:  1127 DVNKQGLECLRLLNEIICDFDKLLLKPKFSGIEKIKTIASTYMCASGLRPGKEDGATDEK 1186

Query:   376 QAE-HNIIVLVEFAIALVTILDQINRESFQRFRLRM 410
             + E HN+++LVEFAIAL++ILD INRESFQRFRLR+
Sbjct:  1187 RTEEHNVVILVEFAIALMSILDSINRESFQRFRLRI 1222


GO:0004016 "adenylate cyclase activity" evidence=ISS;NAS
GO:0009190 "cyclic nucleotide biosynthetic process" evidence=IEA
GO:0035556 "intracellular signal transduction" evidence=IEA
RGD|619966 Adcy7 "adenylate cyclase 7" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query410
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 1e-16
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 2e-15
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 2e-15
cd01650220 cd01650, RT_nLTR_like, RT_nLTR: Non-LTR (long term 2e-15
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 2e-14
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 3e-14
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 6e-14
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 7e-14
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 7e-14
PRK05306 746 PRK05306, infB, translation initiation factor IF-2 1e-13
PRK05306 746 PRK05306, infB, translation initiation factor IF-2 2e-13
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 4e-13
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 5e-13
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 5e-13
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 5e-13
TIGR02794346 TIGR02794, tolA_full, TolA protein 5e-13
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 1e-12
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 1e-12
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 2e-12
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 4e-12
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 4e-12
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 9e-12
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 1e-11
TIGR02794346 TIGR02794, tolA_full, TolA protein 1e-11
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 2e-11
pfam10243506 pfam10243, MIP-T3, Microtubule-binding protein MIP 2e-11
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 3e-11
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 4e-11
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 4e-11
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 4e-11
PRK09510387 PRK09510, tolA, cell envelope integrity inner memb 4e-11
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 5e-11
pfam10243506 pfam10243, MIP-T3, Microtubule-binding protein MIP 5e-11
PRK09510387 PRK09510, tolA, cell envelope integrity inner memb 6e-11
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 9e-11
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 2e-10
PRK05901509 PRK05901, PRK05901, RNA polymerase sigma factor; P 4e-10
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 5e-10
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 6e-10
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 9e-10
COG3064387 COG3064, TolA, Membrane protein involved in colici 9e-10
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 1e-09
PRK05306 746 PRK05306, infB, translation initiation factor IF-2 1e-09
pfam10243506 pfam10243, MIP-T3, Microtubule-binding protein MIP 1e-09
PTZ001081388 PTZ00108, PTZ00108, DNA topoisomerase 2-like prote 1e-09
PRK05901509 PRK05901, PRK05901, RNA polymerase sigma factor; P 5e-09
PRK12704520 PRK12704, PRK12704, phosphodiesterase; Provisional 6e-09
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 8e-09
pfam10243506 pfam10243, MIP-T3, Microtubule-binding protein MIP 1e-08
pfam10243506 pfam10243, MIP-T3, Microtubule-binding protein MIP 1e-08
COG3064387 COG3064, TolA, Membrane protein involved in colici 1e-08
pfam02463 1162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 1e-08
PTZ001081388 PTZ00108, PTZ00108, DNA topoisomerase 2-like prote 2e-08
PTZ00372413 PTZ00372, PTZ00372, endonuclease 4-like protein; P 2e-08
pfam05262489 pfam05262, Borrelia_P83, Borrelia P83/100 protein 2e-08
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 4e-08
PTZ001081388 PTZ00108, PTZ00108, DNA topoisomerase 2-like prote 5e-08
PRK04195482 PRK04195, PRK04195, replication factor C large sub 6e-08
PRK04195482 PRK04195, PRK04195, replication factor C large sub 7e-08
PRK04195482 PRK04195, PRK04195, replication factor C large sub 7e-08
PRK05901 509 PRK05901, PRK05901, RNA polymerase sigma factor; P 9e-08
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 9e-08
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 1e-07
pfam10243506 pfam10243, MIP-T3, Microtubule-binding protein MIP 2e-07
COG3064387 COG3064, TolA, Membrane protein involved in colici 2e-07
pfam09507427 pfam09507, CDC27, DNA polymerase subunit Cdc27 2e-07
PRK09510387 PRK09510, tolA, cell envelope integrity inner memb 3e-07
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 3e-07
pfam02463 1162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 3e-07
COG1293564 COG1293, COG1293, Predicted RNA-binding protein ho 3e-07
PRK05901 509 PRK05901, PRK05901, RNA polymerase sigma factor; P 4e-07
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 4e-07
pfam05262489 pfam05262, Borrelia_P83, Borrelia P83/100 protein 4e-07
PRK05901 509 PRK05901, PRK05901, RNA polymerase sigma factor; P 5e-07
PRK05901509 PRK05901, PRK05901, RNA polymerase sigma factor; P 5e-07
PRK12704 520 PRK12704, PRK12704, phosphodiesterase; Provisional 5e-07
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 6e-07
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 7e-07
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 7e-07
pfam04615728 pfam04615, Utp14, Utp14 protein 7e-07
pfam02463 1162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 8e-07
PTZ00372413 PTZ00372, PTZ00372, endonuclease 4-like protein; P 8e-07
pfam04615728 pfam04615, Utp14, Utp14 protein 8e-07
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 9e-07
PRK04195482 PRK04195, PRK04195, replication factor C large sub 9e-07
PTZ001081388 PTZ00108, PTZ00108, DNA topoisomerase 2-like prote 1e-06
PRK12704 520 PRK12704, PRK12704, phosphodiesterase; Provisional 1e-06
PRK12704 520 PRK12704, PRK12704, phosphodiesterase; Provisional 1e-06
pfam09507427 pfam09507, CDC27, DNA polymerase subunit Cdc27 1e-06
PRK00409782 PRK00409, PRK00409, recombination and DNA strand e 1e-06
PRK05035695 PRK05035, PRK05035, electron transport complex pro 1e-06
COG0419908 COG0419, SbcC, ATPase involved in DNA repair [DNA 1e-06
COG3064387 COG3064, TolA, Membrane protein involved in colici 2e-06
PTZ001081388 PTZ00108, PTZ00108, DNA topoisomerase 2-like prote 2e-06
PTZ001081388 PTZ00108, PTZ00108, DNA topoisomerase 2-like prote 2e-06
PTZ001081388 PTZ00108, PTZ00108, DNA topoisomerase 2-like prote 2e-06
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-06
PTZ00372413 PTZ00372, PTZ00372, endonuclease 4-like protein; P 2e-06
PRK04195482 PRK04195, PRK04195, replication factor C large sub 2e-06
TIGR03319514 TIGR03319, RNase_Y, ribonuclease Y 2e-06
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 2e-06
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 2e-06
PRK04195482 PRK04195, PRK04195, replication factor C large sub 3e-06
PRK13808333 PRK13808, PRK13808, adenylate kinase; Provisional 3e-06
pfam02029431 pfam02029, Caldesmon, Caldesmon 3e-06
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 4e-06
pfam02463 1162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 4e-06
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 4e-06
PTZ00053470 PTZ00053, PTZ00053, methionine aminopeptidase 2; P 4e-06
pfam13904261 pfam13904, DUF4207, Domain of unknown function (DU 4e-06
PTZ001081388 PTZ00108, PTZ00108, DNA topoisomerase 2-like prote 5e-06
pfam02463 1162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 5e-06
PTZ00372413 PTZ00372, PTZ00372, endonuclease 4-like protein; P 5e-06
pfam05262489 pfam05262, Borrelia_P83, Borrelia P83/100 protein 5e-06
PRK04195482 PRK04195, PRK04195, replication factor C large sub 5e-06
PRK04195482 PRK04195, PRK04195, replication factor C large sub 5e-06
COG1293564 COG1293, COG1293, Predicted RNA-binding protein ho 5e-06
COG1293564 COG1293, COG1293, Predicted RNA-binding protein ho 5e-06
PLN02967 581 PLN02967, PLN02967, kinase 5e-06
PRK03918 880 PRK03918, PRK03918, chromosome segregation protein 5e-06
TIGR01554384 TIGR01554, major_cap_HK97, phage major capsid prot 5e-06
PRK04195482 PRK04195, PRK04195, replication factor C large sub 6e-06
pfam02029431 pfam02029, Caldesmon, Caldesmon 6e-06
pfam02463 1162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 7e-06
pfam024631162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 7e-06
PRK13808333 PRK13808, PRK13808, adenylate kinase; Provisional 7e-06
pfam02463 1162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 8e-06
PRK12903925 PRK12903, secA, preprotein translocase subunit Sec 8e-06
PTZ00372413 PTZ00372, PTZ00372, endonuclease 4-like protein; P 9e-06
PRK13808333 PRK13808, PRK13808, adenylate kinase; Provisional 9e-06
PRK03918 880 PRK03918, PRK03918, chromosome segregation protein 9e-06
PRK03918 880 PRK03918, PRK03918, chromosome segregation protein 9e-06
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 1e-05
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 1e-05
pfam02463 1162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 1e-05
PRK04195482 PRK04195, PRK04195, replication factor C large sub 1e-05
PRK04195482 PRK04195, PRK04195, replication factor C large sub 1e-05
PRK04195482 PRK04195, PRK04195, replication factor C large sub 1e-05
pfam04615728 pfam04615, Utp14, Utp14 protein 1e-05
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 1e-05
PTZ00053470 PTZ00053, PTZ00053, methionine aminopeptidase 2; P 1e-05
pfam00078194 pfam00078, RVT_1, Reverse transcriptase (RNA-depen 1e-05
PRK10811 1068 PRK10811, rne, ribonuclease E; Reviewed 1e-05
PRK00247429 PRK00247, PRK00247, putative inner membrane protei 1e-05
pfam06375561 pfam06375, BLVR, Bovine leukaemia virus receptor ( 1e-05
PLN032371465 PLN03237, PLN03237, DNA topoisomerase 2; Provision 1e-05
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 2e-05
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-05
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-05
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-05
pfam024631162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 2e-05
pfam024631162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 2e-05
pfam04615728 pfam04615, Utp14, Utp14 protein 2e-05
pfam06375561 pfam06375, BLVR, Bovine leukaemia virus receptor ( 2e-05
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 2e-05
CHL002041832 CHL00204, ycf1, Ycf1; Provisional 2e-05
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 3e-05
PRK04195482 PRK04195, PRK04195, replication factor C large sub 3e-05
PRK12903925 PRK12903, secA, preprotein translocase subunit Sec 3e-05
PRK10811 1068 PRK10811, rne, ribonuclease E; Reviewed 3e-05
PRK00247429 PRK00247, PRK00247, putative inner membrane protei 3e-05
PRK00247429 PRK00247, PRK00247, putative inner membrane protei 3e-05
pfam07767387 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) 3e-05
pfam04086272 pfam04086, SRP-alpha_N, Signal recognition particl 3e-05
pfam05793528 pfam05793, TFIIF_alpha, Transcription initiation f 3e-05
pfam05764238 pfam05764, YL1, YL1 nuclear protein 3e-05
COG4499434 COG4499, COG4499, Predicted membrane protein [Func 3e-05
pfam08432182 pfam08432, DUF1742, Fungal protein of unknown func 3e-05
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 4e-05
PRK13808333 PRK13808, PRK13808, adenylate kinase; Provisional 4e-05
PRK00448 1437 PRK00448, polC, DNA polymerase III PolC; Validated 4e-05
pfam05087 887 pfam05087, Rota_VP2, Rotavirus VP2 protein 4e-05
pfam024631162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 5e-05
pfam024631162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 5e-05
PRK04195482 PRK04195, PRK04195, replication factor C large sub 5e-05
pfam09507427 pfam09507, CDC27, DNA polymerase subunit Cdc27 5e-05
PLN02967 581 PLN02967, PLN02967, kinase 5e-05
pfam08432182 pfam08432, DUF1742, Fungal protein of unknown func 5e-05
pfam05262489 pfam05262, Borrelia_P83, Borrelia P83/100 protein 6e-05
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 6e-05
PRK108111068 PRK10811, rne, ribonuclease E; Reviewed 6e-05
pfam08432182 pfam08432, DUF1742, Fungal protein of unknown func 6e-05
PRK04195482 PRK04195, PRK04195, replication factor C large sub 7e-05
PRK00409782 PRK00409, PRK00409, recombination and DNA strand e 7e-05
CHL00189 742 CHL00189, infB, translation initiation factor 2; P 7e-05
pfam02463 1162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 8e-05
PTZ00372413 PTZ00372, PTZ00372, endonuclease 4-like protein; P 8e-05
pfam13904261 pfam13904, DUF4207, Domain of unknown function (DU 8e-05
CHL00189 742 CHL00189, infB, translation initiation factor 2; P 8e-05
PTZ001081388 PTZ00108, PTZ00108, DNA topoisomerase 2-like prote 9e-05
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 9e-05
pfam05087 887 pfam05087, Rota_VP2, Rotavirus VP2 protein 9e-05
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 1e-04
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 1e-04
TIGR02794346 TIGR02794, tolA_full, TolA protein 1e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 1e-04
pfam024631162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 1e-04
PRK05035695 PRK05035, PRK05035, electron transport complex pro 1e-04
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 1e-04
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 1e-04
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 1e-04
pfam06375561 pfam06375, BLVR, Bovine leukaemia virus receptor ( 1e-04
CHL002041832 CHL00204, ycf1, Ycf1; Provisional 1e-04
PRK07735430 PRK07735, PRK07735, NADH dehydrogenase subunit C; 1e-04
COG3064387 COG3064, TolA, Membrane protein involved in colici 2e-04
pfam024631162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 2e-04
pfam02463 1162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 2e-04
pfam02463 1162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 2e-04
PRK00409782 PRK00409, PRK00409, recombination and DNA strand e 2e-04
PRK05035695 PRK05035, PRK05035, electron transport complex pro 2e-04
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 2e-04
TIGR03319514 TIGR03319, RNase_Y, ribonuclease Y 2e-04
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 2e-04
PRK13808333 PRK13808, PRK13808, adenylate kinase; Provisional 2e-04
pfam12569516 pfam12569, NARP1, NMDA receptor-regulated protein 2e-04
PRK11642813 PRK11642, PRK11642, exoribonuclease R; Provisional 2e-04
PRK11642813 PRK11642, PRK11642, exoribonuclease R; Provisional 2e-04
pfam07423214 pfam07423, DUF1510, Protein of unknown function (D 2e-04
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 3e-04
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 3e-04
PTZ00372413 PTZ00372, PTZ00372, endonuclease 4-like protein; P 3e-04
PTZ00372413 PTZ00372, PTZ00372, endonuclease 4-like protein; P 3e-04
PRK04195482 PRK04195, PRK04195, replication factor C large sub 3e-04
pfam09507427 pfam09507, CDC27, DNA polymerase subunit Cdc27 3e-04
COG5116926 COG5116, RPN2, 26S proteasome regulatory complex c 3e-04
pfam10310436 pfam10310, DUF2413, Protein of unknown function (D 3e-04
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 4e-04
pfam02463 1162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 4e-04
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 4e-04
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 4e-04
PRK12903925 PRK12903, secA, preprotein translocase subunit Sec 4e-04
pfam06375561 pfam06375, BLVR, Bovine leukaemia virus receptor ( 4e-04
pfam12569516 pfam12569, NARP1, NMDA receptor-regulated protein 4e-04
pfam00183 529 pfam00183, HSP90, Hsp90 protein 4e-04
pfam07946322 pfam07946, DUF1682, Protein of unknown function (D 4e-04
PRK05901 509 PRK05901, PRK05901, RNA polymerase sigma factor; P 5e-04
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 5e-04
PRK04195482 PRK04195, PRK04195, replication factor C large sub 5e-04
pfam09507427 pfam09507, CDC27, DNA polymerase subunit Cdc27 5e-04
pfam04615728 pfam04615, Utp14, Utp14 protein 5e-04
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 5e-04
PTZ00053 470 PTZ00053, PTZ00053, methionine aminopeptidase 2; P 5e-04
PRK03918 880 PRK03918, PRK03918, chromosome segregation protein 5e-04
TIGR01554384 TIGR01554, major_cap_HK97, phage major capsid prot 5e-04
pfam06375 561 pfam06375, BLVR, Bovine leukaemia virus receptor ( 5e-04
PRK07735430 PRK07735, PRK07735, NADH dehydrogenase subunit C; 5e-04
PRK11642813 PRK11642, PRK11642, exoribonuclease R; Provisional 5e-04
pfam07423214 pfam07423, DUF1510, Protein of unknown function (D 5e-04
pfam07946322 pfam07946, DUF1682, Protein of unknown function (D 5e-04
COG1579239 COG1579, COG1579, Zn-ribbon protein, possibly nucl 5e-04
pfam024631162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 6e-04
pfam024631162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 6e-04
PLN02967 581 PLN02967, PLN02967, kinase 6e-04
PRK00247429 PRK00247, PRK00247, putative inner membrane protei 6e-04
pfam07767387 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) 6e-04
pfam08432182 pfam08432, DUF1742, Fungal protein of unknown func 6e-04
CHL00189 742 CHL00189, infB, translation initiation factor 2; P 6e-04
pfam07423214 pfam07423, DUF1510, Protein of unknown function (D 6e-04
TIGR01069771 TIGR01069, mutS2, MutS2 family protein 6e-04
PTZ00372413 PTZ00372, PTZ00372, endonuclease 4-like protein; P 7e-04
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 7e-04
PRK13808333 PRK13808, PRK13808, adenylate kinase; Provisional 7e-04
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 7e-04
pfam05793528 pfam05793, TFIIF_alpha, Transcription initiation f 7e-04
COG4499434 COG4499, COG4499, Predicted membrane protein [Func 7e-04
PRK11642813 PRK11642, PRK11642, exoribonuclease R; Provisional 7e-04
COG0810244 COG0810, TonB, Periplasmic protein TonB, links inn 7e-04
PTZ001081388 PTZ00108, PTZ00108, DNA topoisomerase 2-like prote 8e-04
pfam02463 1162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 8e-04
PRK04195482 PRK04195, PRK04195, replication factor C large sub 8e-04
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 8e-04
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 8e-04
PLN02967 581 PLN02967, PLN02967, kinase 8e-04
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 8e-04
pfam12569516 pfam12569, NARP1, NMDA receptor-regulated protein 8e-04
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 9e-04
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 9e-04
PRK11642813 PRK11642, PRK11642, exoribonuclease R; Provisional 9e-04
TIGR01069771 TIGR01069, mutS2, MutS2 family protein 9e-04
pfam03154979 pfam03154, Atrophin-1, Atrophin-1 family 9e-04
pfam10243506 pfam10243, MIP-T3, Microtubule-binding protein MIP 0.001
PTZ001081388 PTZ00108, PTZ00108, DNA topoisomerase 2-like prote 0.001
PRK05035695 PRK05035, PRK05035, electron transport complex pro 0.001
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 0.001
COG0419908 COG0419, SbcC, ATPase involved in DNA repair [DNA 0.001
TIGR03319 514 TIGR03319, RNase_Y, ribonuclease Y 0.001
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 0.001
PTZ00053 470 PTZ00053, PTZ00053, methionine aminopeptidase 2; P 0.001
pfam13904261 pfam13904, DUF4207, Domain of unknown function (DU 0.001
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 0.001
pfam05087 887 pfam05087, Rota_VP2, Rotavirus VP2 protein 0.001
CHL00189 742 CHL00189, infB, translation initiation factor 2; P 0.001
pfam12569516 pfam12569, NARP1, NMDA receptor-regulated protein 0.001
pfam07423214 pfam07423, DUF1510, Protein of unknown function (D 0.001
TIGR01069771 TIGR01069, mutS2, MutS2 family protein 0.001
TIGR009271096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 0.001
TIGR009271096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 0.001
COG5269379 COG5269, ZUO1, Ribosome-associated chaperone zuoti 0.001
pfam03343603 pfam03343, SART-1, SART-1 family 0.001
pfam03343603 pfam03343, SART-1, SART-1 family 0.001
PLN02381 1066 PLN02381, PLN02381, valyl-tRNA synthetase 0.001
PLN02381 1066 PLN02381, PLN02381, valyl-tRNA synthetase 0.001
PRK13735942 PRK13735, PRK13735, conjugal transfer mating pair 0.001
COG5182429 COG5182, CUS1, Splicing factor 3b, subunit 2 [RNA 0.001
pfam10243 506 pfam10243, MIP-T3, Microtubule-binding protein MIP 0.002
COG3064387 COG3064, TolA, Membrane protein involved in colici 0.002
PTZ001081388 PTZ00108, PTZ00108, DNA topoisomerase 2-like prote 0.002
pfam024631162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 0.002
COG0419908 COG0419, SbcC, ATPase involved in DNA repair [DNA 0.002
PTZ00053 470 PTZ00053, PTZ00053, methionine aminopeptidase 2; P 0.002
PLN032371465 PLN03237, PLN03237, DNA topoisomerase 2; Provision 0.002
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 0.002
PRK11642813 PRK11642, PRK11642, exoribonuclease R; Provisional 0.002
pfam07946322 pfam07946, DUF1682, Protein of unknown function (D 0.002
TIGR01069771 TIGR01069, mutS2, MutS2 family protein 0.002
pfam03154 979 pfam03154, Atrophin-1, Atrophin-1 family 0.002
pfam03154979 pfam03154, Atrophin-1, Atrophin-1 family 0.002
pfam03154 979 pfam03154, Atrophin-1, Atrophin-1 family 0.002
COG5269379 COG5269, ZUO1, Ribosome-associated chaperone zuoti 0.002
pfam08208193 pfam08208, RNA_polI_A34, DNA-directed RNA polymera 0.002
TIGR01642 509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 0.002
pfam14181155 pfam14181, YqfQ, YqfQ-like protein 0.002
pfam13476204 pfam13476, AAA_23, AAA domain 0.002
smart00435391 smart00435, TOPEUc, DNA Topoisomerase I (eukaryota 0.002
pfam05758 832 pfam05758, Ycf1, Ycf1 0.002
pfam10243 506 pfam10243, MIP-T3, Microtubule-binding protein MIP 0.003
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.003
PRK00409782 PRK00409, PRK00409, recombination and DNA strand e 0.003
COG0419908 COG0419, SbcC, ATPase involved in DNA repair [DNA 0.003
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 0.003
PRK03918 880 PRK03918, PRK03918, chromosome segregation protein 0.003
TIGR01554384 TIGR01554, major_cap_HK97, phage major capsid prot 0.003
CHL002041832 CHL00204, ycf1, Ycf1; Provisional 0.003
PRK07735430 PRK07735, PRK07735, NADH dehydrogenase subunit C; 0.003
PRK11642813 PRK11642, PRK11642, exoribonuclease R; Provisional 0.003
TIGR009271096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 0.003
pfam03343603 pfam03343, SART-1, SART-1 family 0.003
pfam08208193 pfam08208, RNA_polI_A34, DNA-directed RNA polymera 0.003
COG4942420 COG4942, COG4942, Membrane-bound metallopeptidase 0.003
COG4487438 COG4487, COG4487, Uncharacterized protein conserve 0.003
pfam13166 713 pfam13166, AAA_13, AAA domain 0.003
PTZ00399651 PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Pro 0.003
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.004
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 0.004
TIGR03319 514 TIGR03319, RNase_Y, ribonuclease Y 0.004
COG4499434 COG4499, COG4499, Predicted membrane protein [Func 0.004
pfam12569516 pfam12569, NARP1, NMDA receptor-regulated protein 0.004
COG0810244 COG0810, TonB, Periplasmic protein TonB, links inn 0.004
PLN02381 1066 PLN02381, PLN02381, valyl-tRNA synthetase 0.004
PLN02381 1066 PLN02381, PLN02381, valyl-tRNA synthetase 0.004
pfam14181155 pfam14181, YqfQ, YqfQ-like protein 0.004
COG4487438 COG4487, COG4487, Uncharacterized protein conserve 0.004
pfam13166 713 pfam13166, AAA_13, AAA domain 0.004
PRK05771 646 PRK05771, PRK05771, V-type ATP synthase subunit I; 0.004
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
 Score = 82.1 bits (202), Expect = 1e-16
 Identities = 62/182 (34%), Positives = 95/182 (52%), Gaps = 3/182 (1%)

Query: 4    KKEEKKKKKKRRTKKKEKNKNKSRKEEEEEKRTKKKEKNKKNKNKSRKEEEKKKRTKKKE 63
            KK E+KKK     K +EK K    K++ EE +   + K K  + K + +  KKK  + K+
Sbjct: 1284 KKAEEKKKADEAKKAEEKKKADEAKKKAEEAKKADEAKKKAEEAKKKADAAKKKAEEAKK 1343

Query: 64   KNKNKNRKEEKKKKKKRRTKKKEKNKNKSRKEEKKKEAEEEKKKTKNKEKNKNKSRKEEE 123
              +    + E    +    ++K +   + +KEE KK+A+  KKK + K+K     +K EE
Sbjct: 1344 AAEAAKAEAEAAADEAEAAEEKAE-AAEKKKEEAKKKADAAKKKAEEKKKADEAKKKAEE 1402

Query: 124  EKKKEAEEKKKKRTKKK--EKNKNKSRKEEEEEEKKKKKKKKKKKRTKKKEEEKRKNEKA 181
            +KKK  E KK    KKK  E  K    K++ +E KKK ++ KK    KKK EE +K E+A
Sbjct: 1403 DKKKADELKKAAAAKKKADEAKKKAEEKKKADEAKKKAEEAKKADEAKKKAEEAKKAEEA 1462

Query: 182  VR 183
             +
Sbjct: 1463 KK 1464


Length = 2084

>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|238827 cd01650, RT_nLTR_like, RT_nLTR: Non-LTR (long terminal repeat) retrotransposon and non-LTR retrovirus reverse transcriptase (RT) Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|235401 PRK05306, infB, translation initiation factor IF-2; Validated Back     alignment and domain information
>gnl|CDD|235401 PRK05306, infB, translation initiation factor IF-2; Validated Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|234017 TIGR02794, tolA_full, TolA protein Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|234017 TIGR02794, tolA_full, TolA protein Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|235401 PRK05306, infB, translation initiation factor IF-2; Validated Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional Back     alignment and domain information
>gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional Back     alignment and domain information
>gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional Back     alignment and domain information
>gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|114011 pfam05262, Borrelia_P83, Borrelia P83/100 protein Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|220271 pfam09507, CDC27, DNA polymerase subunit Cdc27 Back     alignment and domain information
>gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|224212 COG1293, COG1293, Predicted RNA-binding protein homologous to eukaryotic snRNP [Transcription] Back     alignment and domain information
>gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|114011 pfam05262, Borrelia_P83, Borrelia P83/100 protein Back     alignment and domain information
>gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional Back     alignment and domain information
>gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional Back     alignment and domain information
>gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|218177 pfam04615, Utp14, Utp14 protein Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|218177 pfam04615, Utp14, Utp14 protein Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional Back     alignment and domain information
>gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional Back     alignment and domain information
>gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional Back     alignment and domain information
>gnl|CDD|220271 pfam09507, CDC27, DNA polymerase subunit Cdc27 Back     alignment and domain information
>gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>gnl|CDD|235334 PRK05035, PRK05035, electron transport complex protein RnfC; Provisional Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional Back     alignment and domain information
>gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional Back     alignment and domain information
>gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|188306 TIGR03319, RNase_Y, ribonuclease Y Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|172341 PRK13808, PRK13808, adenylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|202096 pfam02029, Caldesmon, Caldesmon Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|240246 PTZ00053, PTZ00053, methionine aminopeptidase 2; Provisional Back     alignment and domain information
>gnl|CDD|222447 pfam13904, DUF4207, Domain of unknown function (DUF4207) Back     alignment and domain information
>gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|114011 pfam05262, Borrelia_P83, Borrelia P83/100 protein Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|224212 COG1293, COG1293, Predicted RNA-binding protein homologous to eukaryotic snRNP [Transcription] Back     alignment and domain information
>gnl|CDD|224212 COG1293, COG1293, Predicted RNA-binding protein homologous to eukaryotic snRNP [Transcription] Back     alignment and domain information
>gnl|CDD|215521 PLN02967, PLN02967, kinase Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|233467 TIGR01554, major_cap_HK97, phage major capsid protein, HK97 family Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|202096 pfam02029, Caldesmon, Caldesmon Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|172341 PRK13808, PRK13808, adenylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|237258 PRK12903, secA, preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|172341 PRK13808, PRK13808, adenylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|218177 pfam04615, Utp14, Utp14 protein Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|240246 PTZ00053, PTZ00053, methionine aminopeptidase 2; Provisional Back     alignment and domain information
>gnl|CDD|215698 pfam00078, RVT_1, Reverse transcriptase (RNA-dependent DNA polymerase) Back     alignment and domain information
>gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed Back     alignment and domain information
>gnl|CDD|178945 PRK00247, PRK00247, putative inner membrane protein translocase component YidC; Validated Back     alignment and domain information
>gnl|CDD|115057 pfam06375, BLVR, Bovine leukaemia virus receptor (BLVR) Back     alignment and domain information
>gnl|CDD|215641 PLN03237, PLN03237, DNA topoisomerase 2; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|218177 pfam04615, Utp14, Utp14 protein Back     alignment and domain information
>gnl|CDD|115057 pfam06375, BLVR, Bovine leukaemia virus receptor (BLVR) Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|214395 CHL00204, ycf1, Ycf1; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|237258 PRK12903, secA, preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed Back     alignment and domain information
>gnl|CDD|178945 PRK00247, PRK00247, putative inner membrane protein translocase component YidC; Validated Back     alignment and domain information
>gnl|CDD|178945 PRK00247, PRK00247, putative inner membrane protein translocase component YidC; Validated Back     alignment and domain information
>gnl|CDD|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) Back     alignment and domain information
>gnl|CDD|217884 pfam04086, SRP-alpha_N, Signal recognition particle, alpha subunit, N-terminal Back     alignment and domain information
>gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) Back     alignment and domain information
>gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein Back     alignment and domain information
>gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] Back     alignment and domain information
>gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|172341 PRK13808, PRK13808, adenylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|234767 PRK00448, polC, DNA polymerase III PolC; Validated Back     alignment and domain information
>gnl|CDD|191187 pfam05087, Rota_VP2, Rotavirus VP2 protein Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|220271 pfam09507, CDC27, DNA polymerase subunit Cdc27 Back     alignment and domain information
>gnl|CDD|215521 PLN02967, PLN02967, kinase Back     alignment and domain information
>gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) Back     alignment and domain information
>gnl|CDD|114011 pfam05262, Borrelia_P83, Borrelia P83/100 protein Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed Back     alignment and domain information
>gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>gnl|CDD|177089 CHL00189, infB, translation initiation factor 2; Provisional Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222447 pfam13904, DUF4207, Domain of unknown function (DUF4207) Back     alignment and domain information
>gnl|CDD|177089 CHL00189, infB, translation initiation factor 2; Provisional Back     alignment and domain information
>gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|191187 pfam05087, Rota_VP2, Rotavirus VP2 protein Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|234017 TIGR02794, tolA_full, TolA protein Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|235334 PRK05035, PRK05035, electron transport complex protein RnfC; Provisional Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|115057 pfam06375, BLVR, Bovine leukaemia virus receptor (BLVR) Back     alignment and domain information
>gnl|CDD|214395 CHL00204, ycf1, Ycf1; Provisional Back     alignment and domain information
>gnl|CDD|236081 PRK07735, PRK07735, NADH dehydrogenase subunit C; Validated Back     alignment and domain information
>gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>gnl|CDD|235334 PRK05035, PRK05035, electron transport complex protein RnfC; Provisional Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|188306 TIGR03319, RNase_Y, ribonuclease Y Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|172341 PRK13808, PRK13808, adenylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 Back     alignment and domain information
>gnl|CDD|236944 PRK11642, PRK11642, exoribonuclease R; Provisional Back     alignment and domain information
>gnl|CDD|236944 PRK11642, PRK11642, exoribonuclease R; Provisional Back     alignment and domain information
>gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|220271 pfam09507, CDC27, DNA polymerase subunit Cdc27 Back     alignment and domain information
>gnl|CDD|227446 COG5116, RPN2, 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|220684 pfam10310, DUF2413, Protein of unknown function (DUF2413) Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|237258 PRK12903, secA, preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>gnl|CDD|115057 pfam06375, BLVR, Bovine leukaemia virus receptor (BLVR) Back     alignment and domain information
>gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 Back     alignment and domain information
>gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein Back     alignment and domain information
>gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) Back     alignment and domain information
>gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|220271 pfam09507, CDC27, DNA polymerase subunit Cdc27 Back     alignment and domain information
>gnl|CDD|218177 pfam04615, Utp14, Utp14 protein Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|240246 PTZ00053, PTZ00053, methionine aminopeptidase 2; Provisional Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|233467 TIGR01554, major_cap_HK97, phage major capsid protein, HK97 family Back     alignment and domain information
>gnl|CDD|115057 pfam06375, BLVR, Bovine leukaemia virus receptor (BLVR) Back     alignment and domain information
>gnl|CDD|236081 PRK07735, PRK07735, NADH dehydrogenase subunit C; Validated Back     alignment and domain information
>gnl|CDD|236944 PRK11642, PRK11642, exoribonuclease R; Provisional Back     alignment and domain information
>gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) Back     alignment and domain information
>gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) Back     alignment and domain information
>gnl|CDD|224495 COG1579, COG1579, Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|215521 PLN02967, PLN02967, kinase Back     alignment and domain information
>gnl|CDD|178945 PRK00247, PRK00247, putative inner membrane protein translocase component YidC; Validated Back     alignment and domain information
>gnl|CDD|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) Back     alignment and domain information
>gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) Back     alignment and domain information
>gnl|CDD|177089 CHL00189, infB, translation initiation factor 2; Provisional Back     alignment and domain information
>gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) Back     alignment and domain information
>gnl|CDD|130141 TIGR01069, mutS2, MutS2 family protein Back     alignment and domain information
>gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|172341 PRK13808, PRK13808, adenylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) Back     alignment and domain information
>gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] Back     alignment and domain information
>gnl|CDD|236944 PRK11642, PRK11642, exoribonuclease R; Provisional Back     alignment and domain information
>gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|215521 PLN02967, PLN02967, kinase Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|236944 PRK11642, PRK11642, exoribonuclease R; Provisional Back     alignment and domain information
>gnl|CDD|130141 TIGR01069, mutS2, MutS2 family protein Back     alignment and domain information
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional Back     alignment and domain information
>gnl|CDD|235334 PRK05035, PRK05035, electron transport complex protein RnfC; Provisional Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|188306 TIGR03319, RNase_Y, ribonuclease Y Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|240246 PTZ00053, PTZ00053, methionine aminopeptidase 2; Provisional Back     alignment and domain information
>gnl|CDD|222447 pfam13904, DUF4207, Domain of unknown function (DUF4207) Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|191187 pfam05087, Rota_VP2, Rotavirus VP2 protein Back     alignment and domain information
>gnl|CDD|177089 CHL00189, infB, translation initiation factor 2; Provisional Back     alignment and domain information
>gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 Back     alignment and domain information
>gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) Back     alignment and domain information
>gnl|CDD|130141 TIGR01069, mutS2, MutS2 family protein Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|227594 COG5269, ZUO1, Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|217502 pfam03343, SART-1, SART-1 family Back     alignment and domain information
>gnl|CDD|217502 pfam03343, SART-1, SART-1 family Back     alignment and domain information
>gnl|CDD|215214 PLN02381, PLN02381, valyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|215214 PLN02381, PLN02381, valyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|184287 PRK13735, PRK13735, conjugal transfer mating pair stabilization protein TraG; Provisional Back     alignment and domain information
>gnl|CDD|227509 COG5182, CUS1, Splicing factor 3b, subunit 2 [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|240246 PTZ00053, PTZ00053, methionine aminopeptidase 2; Provisional Back     alignment and domain information
>gnl|CDD|215641 PLN03237, PLN03237, DNA topoisomerase 2; Provisional Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|236944 PRK11642, PRK11642, exoribonuclease R; Provisional Back     alignment and domain information
>gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) Back     alignment and domain information
>gnl|CDD|130141 TIGR01069, mutS2, MutS2 family protein Back     alignment and domain information
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family Back     alignment and domain information
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family Back     alignment and domain information
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family Back     alignment and domain information
>gnl|CDD|227594 COG5269, ZUO1, Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein Back     alignment and domain information
>gnl|CDD|222160 pfam13476, AAA_23, AAA domain Back     alignment and domain information
>gnl|CDD|214661 smart00435, TOPEUc, DNA Topoisomerase I (eukaryota) Back     alignment and domain information
>gnl|CDD|218734 pfam05758, Ycf1, Ycf1 Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|233467 TIGR01554, major_cap_HK97, phage major capsid protein, HK97 family Back     alignment and domain information
>gnl|CDD|214395 CHL00204, ycf1, Ycf1; Provisional Back     alignment and domain information
>gnl|CDD|236081 PRK07735, PRK07735, NADH dehydrogenase subunit C; Validated Back     alignment and domain information
>gnl|CDD|236944 PRK11642, PRK11642, exoribonuclease R; Provisional Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|217502 pfam03343, SART-1, SART-1 family Back     alignment and domain information
>gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 Back     alignment and domain information
>gnl|CDD|227278 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|226889 COG4487, COG4487, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>gnl|CDD|221952 pfam13166, AAA_13, AAA domain Back     alignment and domain information
>gnl|CDD|240402 PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|188306 TIGR03319, RNase_Y, ribonuclease Y Back     alignment and domain information
>gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] Back     alignment and domain information
>gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 Back     alignment and domain information
>gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|215214 PLN02381, PLN02381, valyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|215214 PLN02381, PLN02381, valyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein Back     alignment and domain information
>gnl|CDD|226889 COG4487, COG4487, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>gnl|CDD|221952 pfam13166, AAA_13, AAA domain Back     alignment and domain information
>gnl|CDD|235600 PRK05771, PRK05771, V-type ATP synthase subunit I; Validated Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 410
cd01651226 RT_G2_intron RT_G2_intron: Reverse transcriptases 99.83
cd01650220 RT_nLTR_like RT_nLTR: Non-LTR (long terminal repea 99.83
cd03487214 RT_Bac_retron_II RT_Bac_retron_II: Reverse transcr 99.79
PF00078214 RVT_1: Reverse transcriptase (RNA-dependent DNA po 99.79
cd01709346 RT_like_1 RT_like_1: A subfamily of reverse transc 99.78
cd01646158 RT_Bac_retron_I RT_Bac_retron_I: Reverse transcrip 99.76
cd01648119 TERT TERT: Telomerase reverse transcriptase (TERT) 99.71
cd0030498 RT_like RT_like: Reverse transcriptase (RT, RNA-de 99.38
KOG4768|consensus 796 99.36
cd03714119 RT_DIRS1 RT_DIRS1: Reverse transcriptases (RTs) oc 98.74
cd01645213 RT_Rtv RT_Rtv: Reverse transcriptases (RTs) from r 98.7
KOG1005|consensus888 98.52
cd03715210 RT_ZFREV_like RT_ZFREV_like: A subfamily of revers 98.49
cd01647177 RT_LTR RT_LTR: Reverse transcriptases (RTs) from r 98.2
COG3344328 Retron-type reverse transcriptase [DNA replication 96.74
cd01699278 RNA_dep_RNAP RNA_dep_RNAP: RNA-dependent RNA polym 96.47
cd01644213 RT_pepA17 RT_pepA17: Reverse transcriptase (RTs) i 96.34
CHL00002504 matK maturase K 91.45
PF00680491 RdRP_1: RNA dependent RNA polymerase; InterPro: IP 88.97
KOG4364|consensus 811 85.33
PTZ001212084 MAEBL; Provisional 83.52
PF03431542 RNA_replicase_B: RNA replicase, beta-chain ; Inter 81.78
>cd01651 RT_G2_intron RT_G2_intron: Reverse transcriptases (RTs) with group II intron origin Back     alignment and domain information
Probab=99.83  E-value=6.3e-21  Score=178.20  Aligned_cols=134  Identities=19%  Similarity=0.283  Sum_probs=113.9

Q ss_pred             HhhhcCCCHHHHHHHHHhCCCChHHHHHHHHHhhcceEEEeeCCccCCccccCccccCCCcchhhhhhhhhhhhhhcc--
Q psy12268        172 EEEKRKNEKAVRLTKLSAFGISGYLLQWIRNFLSGWIQIVRVGTSTSEPIHIPSGCIQGGHMSGLLFSLFINDIAEIF--  249 (410)
Q Consensus       172 ~~~~~~vdH~~Ll~~L~~~G~p~~li~lI~s~Ls~rs~~V~~~g~~S~~~~i~~GVPQGs~LSPLLFnL~l~~L~~~l--  249 (410)
                      +.+||.|+|+.|+..|...|.++.++.||.+|+....      ...+..+....|||||+++||+||++|+++++..+  
T Consensus        78 ~~~Fdsi~~~~l~~~l~~~~~~~~~~~~i~~~~~~~~------~~~~~~~~~~~GlpqG~~lSp~L~~~~l~~ld~~l~~  151 (226)
T cd01651          78 KGFFDNIDHDLLLKILKRRIGDKRVLRLIRKWLKAGV------LEDGKLVETEKGTPQGGVISPLLANIYLHELDKFVEE  151 (226)
T ss_pred             HHhcCCCCHHHHHHHHHHhcccHHHHHHHHHHHhceE------ccCCeEeCCCCCcCCCccHHHHHHHHHHHHHHHHHHH
Confidence            5689999999999999999999999999999864332      22345678899999999999999999999998754  


Q ss_pred             -------------CCcccccccchhhhhhhcCChhhhhhHHHHHHHHHhhhhhccccccccceeEEEeecCCCCccceee
Q psy12268        250 -------------PGFNFWLFADDLKVALRVGGQREVDSMQSMLSRLYHWCSINKMELNIGKCMVMTYHRNKSPILASYD  316 (410)
Q Consensus       250 -------------~~i~~l~YADDivIis~s~s~~~~~~Lq~~Ld~L~~w~~~~GLkIN~~KTeim~f~~~~~~~~~~~t  316 (410)
                                   .++.+++||||++|++.+     ...++.+++.+..|+..+||.+|++||.++.++           
T Consensus       152 ~~~~~~~~~~~~~~~~~~~rY~DD~~i~~~~-----~~~~~~~~~~i~~~~~~~gl~ln~~Kt~i~~~~-----------  215 (226)
T cd01651         152 KLKEYYDTSDPKFRRLRYVRYADDFVIGVRG-----PKEAEEIKELIREFLEELGLELNPEKTRITHFK-----------  215 (226)
T ss_pred             hhhhcccccccccCceEEEEecCceEEecCC-----HHHHHHHHHHHHHHHHHcCCeechhhcceeecC-----------
Confidence                         457899999999999843     344888899999999999999999999999985           


Q ss_pred             eCCccccccccccccceee
Q psy12268        317 INGQALARCEQVRDLGVTF  335 (410)
Q Consensus       317 i~g~~I~~ves~KYLGV~L  335 (410)
                              .+.+.|||+.|
T Consensus       216 --------~~~~~fLG~~~  226 (226)
T cd01651         216 --------SEGFDFLGFTF  226 (226)
T ss_pred             --------CCCCeeCCeEC
Confidence                    33589999875



RT transcribes DNA using RNA as template. Proteins in this subfamily are found in bacterial and mitochondrial group II introns. Their most probable ancestor was a retrotransposable element with both gag-like and pol-like genes. This subfamily of proteins appears to have captured the RT sequences from transposable elements, which lack long terminal repeats (LTRs).

>cd01650 RT_nLTR_like RT_nLTR: Non-LTR (long terminal repeat) retrotransposon and non-LTR retrovirus reverse transcriptase (RT) Back     alignment and domain information
>cd03487 RT_Bac_retron_II RT_Bac_retron_II: Reverse transcriptases (RTs) in bacterial retrotransposons or retrons Back     alignment and domain information
>PF00078 RVT_1: Reverse transcriptase (RNA-dependent DNA polymerase); InterPro: IPR000477 The use of an RNA template to produce DNA, for integration into the host genome and exploitation of a host cell, is a strategy employed in the replication of retroid elements, such as the retroviruses and bacterial retrons Back     alignment and domain information
>cd01709 RT_like_1 RT_like_1: A subfamily of reverse transcriptases (RTs) Back     alignment and domain information
>cd01646 RT_Bac_retron_I RT_Bac_retron_I: Reverse transcriptases (RTs) in bacterial retrotransposons or retrons Back     alignment and domain information
>cd01648 TERT TERT: Telomerase reverse transcriptase (TERT) Back     alignment and domain information
>cd00304 RT_like RT_like: Reverse transcriptase (RT, RNA-dependent DNA polymerase)_like family Back     alignment and domain information
>KOG4768|consensus Back     alignment and domain information
>cd03714 RT_DIRS1 RT_DIRS1: Reverse transcriptases (RTs) occurring in the DIRS1 group of retransposons Back     alignment and domain information
>cd01645 RT_Rtv RT_Rtv: Reverse transcriptases (RTs) from retroviruses (Rtvs) Back     alignment and domain information
>KOG1005|consensus Back     alignment and domain information
>cd03715 RT_ZFREV_like RT_ZFREV_like: A subfamily of reverse transcriptases (RTs) found in sequences similar to the intact endogenous retrovirus ZFERV from zebrafish and to Moloney murine leukemia virus RT Back     alignment and domain information
>cd01647 RT_LTR RT_LTR: Reverse transcriptases (RTs) from retrotransposons and retroviruses which have long terminal repeats (LTRs) in their DNA copies but not in their RNA template Back     alignment and domain information
>COG3344 Retron-type reverse transcriptase [DNA replication, recombination, and repair] Back     alignment and domain information
>cd01699 RNA_dep_RNAP RNA_dep_RNAP: RNA-dependent RNA polymerase (RdRp) is an essential protein encoded in the genomes of all RNA containing viruses with no DNA stage Back     alignment and domain information
>cd01644 RT_pepA17 RT_pepA17: Reverse transcriptase (RTs) in retrotransposons Back     alignment and domain information
>CHL00002 matK maturase K Back     alignment and domain information
>PF00680 RdRP_1: RNA dependent RNA polymerase; InterPro: IPR001205 RNA-directed RNA polymerase (RdRp) (2 Back     alignment and domain information
>KOG4364|consensus Back     alignment and domain information
>PTZ00121 MAEBL; Provisional Back     alignment and domain information
>PF03431 RNA_replicase_B: RNA replicase, beta-chain ; InterPro: IPR005093 RNA-directed RNA polymerase (RdRp) (2 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query410
3kyl_A 596 Telomerase reverse transcriptase; reverse transcri 99.64
3fsi_A255 RT, reverse transcriptase domain; transferase/DNA 98.57
1rw3_A 455 POL polyprotein; RNA and DNA dependent DNA polymer 98.25
2zd1_A 557 Reverse transcriptase/ribonuclease H; P51/P66, het 98.18
2zd1_B 428 P51 RT; P51/P66, hetero dimer, NNRTI, nonnucleosid 98.15
1mu2_A 555 HIV-2 RT; HIV-2 reverse transcriptase, AIDS, polym 98.07
1ra6_A461 P3D, genome polyprotein; nucleotidyltransferase, R 96.01
1xr5_A466 Genome polyprotein; RNA-dependent RNA polymerase, 95.96
2ckw_A515 RNA-directed RNA polymerase; hydrolase, nucleotide 94.75
3uqs_A515 RNA-dependent RNA polymerase; transferase; 2.00A { 94.21
1khv_A516 RNA-directed RNA polymerase; RNA-dependent RNA pol 92.77
3n6m_A462 RNA-dependent RNA polymerase; EV71, RDRP, GTP, tra 90.94
2ijd_1644 Picornain 3C, RNA-directed RNA polymerase; RNA-dep 84.87
1xr7_A460 Genome polyprotein; RNA-dependent RNA polymerase, 82.8
3bso_A510 RNA dependent RNA polymerase; RNA-dependent RNA po 80.77
1u09_A476 Polyprotein; protein-DNA complex, RNA-dependent RN 80.38
>3kyl_A Telomerase reverse transcriptase; reverse transcriptase; 2.70A {Tribolium castaneum} PDB: 3du5_A 3du6_A Back     alignment and structure
Probab=99.64  E-value=2.1e-16  Score=162.57  Aligned_cols=114  Identities=13%  Similarity=0.105  Sum_probs=91.1

Q ss_pred             hhhcCCCHHHHHHHHHhCCC---ChHHHHHHHHHhhcceEEEeeCCccCCccccCccccCCCcchhhhhhhhhhhhhhcc
Q psy12268        173 EEKRKNEKAVRLTKLSAFGI---SGYLLQWIRNFLSGWIQIVRVGTSTSEPIHIPSGCIQGGHMSGLLFSLFINDIAEIF  249 (410)
Q Consensus       173 ~~~~~vdH~~Ll~~L~~~G~---p~~li~lI~s~Ls~rs~~V~~~g~~S~~~~i~~GVPQGs~LSPLLFnL~l~~L~~~l  249 (410)
                      .-+|.|+|+.|+..|+..+.   +..++.||..++...-  |..+|   ..+....|+|||++|||+|.|||++.+...+
T Consensus       254 kFFDnINHdkLLk~L~~~i~~IlDk~Il~LIkk~Lka~L--V~igG---k~y~qekGTPQGGVISPLLANIYLheLDkel  328 (596)
T 3kyl_A          254 DAYGNVKIPVLCKLIQSIPTHLLDSEKKNFIVDHISNQF--VAFRR---KIYKWNHGLLQGDPLSGCLCELYMAFMDRLY  328 (596)
T ss_dssp             STTTTCCHHHHHHHHTTSCTTTSCHHHHHHHHHHHHCEE--EESSS---SEEEECSSSCBTCTTHHHHHHHHHHHHHHHH
T ss_pred             hhCCCCCHHHHHHHHHhhccccccHHHHHHHHHHHhhCe--EEECC---EEEecCCcccCCcchhHHHHHHHHHHHHHHH
Confidence            46899999999999999875   7888999999986544  45565   3466789999999999999999999999764


Q ss_pred             -----CCcccccccchhhhhhhcCChhhhhhHHHHHHHHHhhhhhccccccccceeE
Q psy12268        250 -----PGFNFWLFADDLKVALRVGGQREVDSMQSMLSRLYHWCSINKMELNIGKCMV  301 (410)
Q Consensus       250 -----~~i~~l~YADDivIis~s~s~~~~~~Lq~~Ld~L~~w~~~~GLkIN~~KTei  301 (410)
                           .+..+++||||++|++.+     ...++.++..+..|     +++|++||.+
T Consensus       329 ~~~l~kd~~LVRYADDFVIi~~S-----ke~Aerfl~~Lkg~-----leLNpEKTrI  375 (596)
T 3kyl_A          329 FSNLDKDAFIHRTVDDYFFCSPH-----PHKVYDFELLIKGV-----YQVNPTKTRT  375 (596)
T ss_dssp             STTSCTTSEEEECSSEEEEEESC-----HHHHHHHHHHHHHH-----SCEEEEEEEE
T ss_pred             HHhhccCceEEEEcCcEEEEECC-----HHHHHHHHHHhhCc-----ceECchhcee
Confidence                 356799999999999843     24455555555544     3999999986



>3fsi_A RT, reverse transcriptase domain; transferase/DNA MMLV RT, protein-DNA complex, drug-DNA complex; HET: OWL; 1.75A {Moloney murine leukemia virus} SCOP: e.8.1.2 PDB: 1d1u_A 1n4l_A* 1ztt_A 2fjv_A* 2fjw_A 2fjx_A* 2fvp_A 2fvq_A 2fvr_A 2fvs_A 2r2r_A* 2r2s_A* 2r2t_A* 2r2u_A* 1ztw_A* 1i6j_A 1qaj_A* 1d0e_A* 1nnd_A 1mml_A ... Back     alignment and structure
>1rw3_A POL polyprotein; RNA and DNA dependent DNA polymerase, reverse transcriptase, transferase, replication; 3.00A {Moloney murine leukemia virus} SCOP: e.8.1.2 Back     alignment and structure
>2zd1_A Reverse transcriptase/ribonuclease H; P51/P66, hetero dimer, NNRTI, nonnucleoside inhibitor, AIDS, HIV, rilpivirine, diarylpyrimidine, DAPY, DNA recombination; HET: T27; 1.80A {Human immunodeficiency virus 1} PDB: 3is9_A* 3irx_A* 2ze2_A* 3bgr_A* 3qlh_A* 3klf_A* 3qo9_A* 1dlo_A 1bqm_A 2be2_A* 1s6q_A* 1s6p_A* 1s9g_A* 1suq_A* 2b5j_A* 2b6a_A* 2ban_A* 1s9e_A* 1hni_A* 1hnv_A* ... Back     alignment and structure
>2zd1_B P51 RT; P51/P66, hetero dimer, NNRTI, nonnucleoside inhibitor, AIDS, HIV, rilpivirine, diarylpyrimidine, DAPY, DNA recombination; HET: T27; 1.80A {Human immunodeficiency virus 1} SCOP: e.8.1.2 PDB: 2ykm_B* 2ykn_B* 2ze2_B* 3bgr_B* 3ig1_B* 3irx_B* 3is9_B* 3qo9_B* 3v4i_B* 3v6d_B* 3v81_B* 3klf_B* 3kk1_B* 3kjv_B* 3kk2_B* 3kk3_B* 2be2_B* 1n5y_B* 1bqm_B* 1n6q_B* ... Back     alignment and structure
>1mu2_A HIV-2 RT; HIV-2 reverse transcriptase, AIDS, polymerase, drug design, transferase; 2.35A {Human immunodeficiency virus 2} SCOP: c.55.3.1 e.8.1.2 PDB: 1mu2_B Back     alignment and structure
>1ra6_A P3D, genome polyprotein; nucleotidyltransferase, RNA-dependent, polym terminus, transferase; 2.00A {Human poliovirus 1} SCOP: e.8.1.4 PDB: 1ra7_A* 2ily_A* 2ilz_A* 2im0_A* 2im1_A* 2im2_A* 2im3_A* 2ijf_A 3ol9_A* 3ol7_A 3ol8_A 3ol6_A* 3ola_A* 3olb_A* 1tql_A 1rdr_A 1raj_A 3ddk_A 3cdu_A 3cdw_A Back     alignment and structure
>1xr5_A Genome polyprotein; RNA-dependent RNA polymerase, transferase; 2.80A {Human rhinovirus 14} SCOP: e.8.1.4 Back     alignment and structure
>2ckw_A RNA-directed RNA polymerase; hydrolase, nucleotide-binding, nucleotidyltransferase, covalent protein-RNA linkage, RNA elongation; 2.3A {Sapporo virus} PDB: 2uuw_A 2wk4_A 2uut_A Back     alignment and structure
>3uqs_A RNA-dependent RNA polymerase; transferase; 2.00A {Murine norovirus} PDB: 3ur0_A* 3upf_A* 3sfg_A* 3nah_A 3nai_A 3qid_A* 3sfu_A* Back     alignment and structure
>1khv_A RNA-directed RNA polymerase; RNA-dependent RNA polymerase, transferase; 2.50A {Rabbit hemorrhagic disease virus} SCOP: e.8.1.4 PDB: 1khw_A Back     alignment and structure
>3n6m_A RNA-dependent RNA polymerase; EV71, RDRP, GTP, transferase; HET: GTP; 2.50A {Human enterovirus 71} SCOP: e.8.1.4 PDB: 3n6l_A* 3n6n_A* Back     alignment and structure
>2ijd_1 Picornain 3C, RNA-directed RNA polymerase; RNA-dependent RNA polymerase, picornavirus, protease, hydrolase, transferase; 3.40A {Human poliovirus 1} SCOP: b.47.1.4 e.8.1.4 Back     alignment and structure
>1xr7_A Genome polyprotein; RNA-dependent RNA polymerase, transferase; 2.30A {Human rhinovirus 16} SCOP: e.8.1.4 PDB: 1tp7_A* 1xr6_A Back     alignment and structure
>3bso_A RNA dependent RNA polymerase; RNA-dependent RNA polymerase, viral replication, antiviral E inhibitor, helicase, hydrolase; HET: CTP; 1.74A {Norwalk virus} PDB: 3bsn_A* 3h5x_A* 3h5y_A* 1sh0_A 1sh2_A 1sh3_A 2b43_A Back     alignment and structure
>1u09_A Polyprotein; protein-DNA complex, RNA-dependent RNA polymerase, foot and disease virus, transferase; 1.91A {Foot-and-mouth disease virus} SCOP: e.8.1.4 PDB: 1wne_A 2e9r_X* 2e9t_A* 2e9z_A* 2ec0_A 3kmq_A 3kms_A 3koa_A 3kna_A 3klv_A 3nky_A 3nma_A 2f8e_X* 2d7s_A* 3nl0_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 410
d2es4d1280 a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) 3e-05
d2es4d1280 a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) 0.003

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query410
d1ztwa1255 MMLV reverse transcriptase {Moloney murine leukemi 98.34
d1mu2a2427 HIV-1 reverse transcriptase {Human immunodeficienc 97.99
d2zd1b1 424 HIV-1 reverse transcriptase {Human immunodeficienc 97.92
d1hara_216 HIV-1 reverse transcriptase {Human immunodeficienc 95.87
d1khva_497 Viral RNA polymerase {Rabbit hemorrhagic disease v 94.41
d1sh0a_502 Viral RNA polymerase {Norwalk virus [TaxId: 11983] 89.68
d1xr7a_460 Viral RNA polymerase {Human rhinovirus 16, HRV-16 83.49
d1ra6a_461 Viral RNA polymerase {Poliovirus type 1, strain Ma 81.54
>d1ztwa1 e.8.1.2 (A:24-278) MMLV reverse transcriptase {Moloney murine leukemia virus, MoMLV [TaxId: 11801]} Back     information, alignment and structure
class: Multi-domain proteins (alpha and beta)
fold: DNA/RNA polymerases
superfamily: DNA/RNA polymerases
family: Reverse transcriptase
domain: MMLV reverse transcriptase
species: Moloney murine leukemia virus, MoMLV [TaxId: 11801]
Probab=98.34  E-value=1.2e-07  Score=88.49  Aligned_cols=86  Identities=21%  Similarity=0.149  Sum_probs=70.0

Q ss_pred             ccccCCCcchhhhhhhhhhhhhhcc----CCcccccccchhhhhhhcCChhhhhhHHHHHHHHHhhhhhcccccccccee
Q psy12268        225 SGCIQGGHMSGLLFSLFINDIAEIF----PGFNFWLFADDLKVALRVGGQREVDSMQSMLSRLYHWCSINKMELNIGKCM  300 (410)
Q Consensus       225 ~GVPQGs~LSPLLFnL~l~~L~~~l----~~i~~l~YADDivIis~s~s~~~~~~Lq~~Ld~L~~w~~~~GLkIN~~KTe  300 (410)
                      ..+|||..-||.+|.-+|+.++..+    +++.+..|.||++|++     .+...+...++.+...+..+||.+|++||+
T Consensus       163 ~~lPfGl~~spa~fq~~~~~il~~~~~~~~~~~~~~Y~DDili~s-----~t~~eh~~~l~~vl~~l~~~gl~~~~~K~~  237 (255)
T d1ztwa1         163 TRLPQGFKNSPTLFDEALHRDLADFRIQHPDLILLQYVDDLLLAA-----TSELDCQQGTRALLQTLGNLGYRASAKKAQ  237 (255)
T ss_dssp             SBCCTTCTTHHHHHHHHHHHHTHHHHHHCTTCEEEEETTEEEEEE-----SSHHHHHHHHHHHHHHHHHHTCCBCTTTCE
T ss_pred             eeeehhcccchhhhHHHHHHHHHHhhccCCceEEEEEeeeeeccC-----CCHHHHHHHHHHHHHHHHHCcCEeCHHHeE
Confidence            4589999999999999888877543    4667888999999987     344666677888888889999999999999


Q ss_pred             EEEeecCCCCccceeeeCCccccccccccccceeecC
Q psy12268        301 VMTYHRNKSPILASYDINGQALARCEQVRDLGVTFQK  337 (410)
Q Consensus       301 im~f~~~~~~~~~~~ti~g~~I~~ves~KYLGV~Ld~  337 (410)
                      ..                      ..++.|||+.|+.
T Consensus       238 ~~----------------------~~~v~fLG~~I~~  252 (255)
T d1ztwa1         238 IC----------------------QKQVKYLGYLLKE  252 (255)
T ss_dssp             EE----------------------ESEEEETTEEEET
T ss_pred             CC----------------------CCCcEEeEEEEeC
Confidence            62                      2347899999874



>d1mu2a2 e.8.1.2 (A:3-429) HIV-1 reverse transcriptase {Human immunodeficiency virus type 2 [TaxId: 11709]} Back     information, alignment and structure
>d2zd1b1 e.8.1.2 (B:5-428) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1 [TaxId: 11676]} Back     information, alignment and structure
>d1hara_ e.8.1.2 (A:) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1 [TaxId: 11676]} Back     information, alignment and structure
>d1khva_ e.8.1.4 (A:) Viral RNA polymerase {Rabbit hemorrhagic disease virus [TaxId: 11976]} Back     information, alignment and structure
>d1sh0a_ e.8.1.4 (A:) Viral RNA polymerase {Norwalk virus [TaxId: 11983]} Back     information, alignment and structure
>d1xr7a_ e.8.1.4 (A:) Viral RNA polymerase {Human rhinovirus 16, HRV-16 [TaxId: 31708]} Back     information, alignment and structure
>d1ra6a_ e.8.1.4 (A:) Viral RNA polymerase {Poliovirus type 1, strain Mahoney [TaxId: 12080]} Back     information, alignment and structure