Psyllid ID: psy12578

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170--
GEVPVTKLSALQKVLQSDFFNCVRDVYEHVYETVDIQGSPDVRASATAKATVAAFAASEGHAHPRVVELPKTDEGLGFNVMGGKEQNSPIYISRIIPGGVADRHGGLKRGDQLLSVNGVSVEGEDHGKAVELLKQAQRSVKLVVRYTPKVLEEMEMRFDKQRTARRRQPPSQ
cccccccHHHcccccHHHHHHHHHHccccccccccccccccccccccccccHHHHcccccccccEEEEEEcccccccEEEEccccccccEEEEEEccccHHHHccccccccEEEEEccEEcccccHHHHHHHHHHcccEEEEEEEEccccHHHHHHHccccccccccccccc
ccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccHccccccccccEEEEEEcccccccEEEEEEccccccEEEEEEccccHHHHHccccccEEEEEEccEEcccccHHHHHHHHHHcccEEEEEEEEcHHHHHcccHHHHHHHHHHHcccccc
GEVPVTKLSALQKVLQSDFFNCVRDVYEHVYETvdiqgspdvrASATAKATVAAFAAseghahprvvelpktdeglgfnvmggkeqnspiyisriipggvadrhgglkrgdqllsvngvsvegedHGKAVELLKQAQRSVKLVVRYTPKVLEEMEMRFDKqrtarrrqppsq
GEVPVTKLSALQKVLQSDFFNCVRDVYEHVYETVDIQGSPDVRASATAKATVAAFAaseghahprvveLPKTDEGLGFNVMGGKEQNSPIYISRIIPGGVADRHGGLKRGDQLLSVNGVSVEGEDHGKAVELLkqaqrsvklvvrytpkvleememrfdkqrtarrrqppsq
GEVPVTKLSALQKVLQSDFFNCVRDVYEHVYETVDIQGSPDVRasatakatvaafaasEGHAHPRVVELPKTDEGLGFNVMGGKEQNSPIYISRIIPGGVADRHGGLKRGDQLLSVNGVSVEGEDHGKAVELLKQAQRSVKLVVRYTPKVLEEMEMRFDKQRTARRRQPPSQ
********SALQKVLQSDFFNCVRDVYEHVYETVDIQGSPDVRA*ATAKATVAAFAA********VVEL****EGLGFNVMGGKEQNSPIYISRIIPGGVADRHGGLKRGDQLLSVNGVSVE****GKAVELLKQAQRSVKLVVRYTPKVL*********************
***PVTKL**L*KVLQSDFFNC******************************************RVVELPKTDEGLGFNVMGGKEQNSPIYISRIIPGGVADRHGGLKRGDQLLSVNGVSVEGEDHGKAVELLKQAQRSVKLVVRYTP************************
GEVPVTKLSALQKVLQSDFFNCVRDVYEHVYETVDIQGSPDVRASATAKATVAAFAASEGHAHPRVVELPKTDEGLGFNVMGGKEQNSPIYISRIIPGGVADRHGGLKRGDQLLSVNGVSVEGEDHGKAVELLKQAQRSVKLVVRYTPKVLEEMEMRF**************
*EVPVTKLSALQKVLQSDFFNCVRDVYEHVYETVDIQ*S************VA*FAASEGHAHPRVVELPKTDEGLGFNVMGGKEQNSPIYISRIIPGGVADRHGGLKRGDQLLSVNGVSVEGEDHGKAVELLKQAQRSVKLVVRYTPKVLEEMEMRFDKQRTAR*******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
GEVPVTKLSALQKVLQSDFFNCVRDVYEHVYETVDIQGSPDVRASATAKATVAAFAASEGHAHPRVVELPKTDEGLGFNVMGGKEQNSPIYISRIIPGGVADRHGGLKRGDQLLSVNGVSVEGEDHGKAVELLKQAQRSVKLVVRYTPKVLEEMEMRFDKQRTARRRQPPSQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query172 2.2.26 [Sep-21-2011]
Q9HAP6207 Protein lin-7 homolog B O yes N/A 0.976 0.811 0.809 5e-76
Q2KIB6201 Protein lin-7 homolog B O yes N/A 0.976 0.835 0.809 6e-76
O88951207 Protein lin-7 homolog B O yes N/A 0.976 0.811 0.815 7e-76
Q9Z252207 Protein lin-7 homolog B O yes N/A 0.976 0.811 0.815 7e-76
Q792I0197 Protein lin-7 homolog C O no N/A 0.976 0.852 0.845 1e-70
Q5RAA5197 Protein lin-7 homolog C O no N/A 0.976 0.852 0.845 1e-70
O88952197 Protein lin-7 homolog C O no N/A 0.976 0.852 0.845 1e-70
Q9NUP9197 Protein lin-7 homolog C O no N/A 0.976 0.852 0.845 1e-70
Q0P5F3197 Protein lin-7 homolog C O no N/A 0.976 0.852 0.845 1e-70
Q5F425197 Protein lin-7 homolog C O yes N/A 0.976 0.852 0.845 1e-70
>sp|Q9HAP6|LIN7B_HUMAN Protein lin-7 homolog B OS=Homo sapiens GN=LIN7B PE=1 SV=1 Back     alignment and function desciption
 Score =  283 bits (723), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 136/168 (80%), Positives = 151/168 (89%)

Query: 1   GEVPVTKLSALQKVLQSDFFNCVRDVYEHVYETVDIQGSPDVRASATAKATVAAFAASEG 60
           GE+P  KL ALQ+VLQS F + +R+VYE +Y+T+DI GS ++RA ATAKATVAAF ASEG
Sbjct: 28  GELPPQKLQALQRVLQSRFCSAIREVYEQLYDTLDITGSAEIRAHATAKATVAAFTASEG 87

Query: 61  HAHPRVVELPKTDEGLGFNVMGGKEQNSPIYISRIIPGGVADRHGGLKRGDQLLSVNGVS 120
           HAHPRVVELPKTDEGLGFN+MGGKEQNSPIYISR+IPGGVADRHGGLKRGDQLLSVNGVS
Sbjct: 88  HAHPRVVELPKTDEGLGFNIMGGKEQNSPIYISRVIPGGVADRHGGLKRGDQLLSVNGVS 147

Query: 121 VEGEDHGKAVELLKQAQRSVKLVVRYTPKVLEEMEMRFDKQRTARRRQ 168
           VEGE H KAVELLK AQ SVKLVVRYTP+VLEEME RF+K R+ARRRQ
Sbjct: 148 VEGEQHEKAVELLKAAQGSVKLVVRYTPRVLEEMEARFEKMRSARRRQ 195
Plays a role in establishing and maintaining the asymmetric distribution of channels and receptors at the plasma membrane of polarized cells. Forms membrane-associated multiprotein complexes that may regulate delivery and recycling of proteins to the correct membrane domains. The tripartite complex composed of LIN7 (LIN7A, LIN7B or LIN7C), CASK and APBA1 may have the potential to couple synaptic vesicle exocytosis to cell adhesion in brain. Ensures the proper localization of GRIN2B (subunit 2B of the NMDA receptor) to neuronal postsynaptic density and may function in localizing synaptic vesicles at synapses where it is recruited by beta-catenin and cadherin. Required to localize Kir2 channels, GABA transporter (SLC6A12) and EGFR/ERBB1, ERBB2, ERBB3 and ERBB4 to the basolateral membrane of epithelial cells. May increase the amplitude of ASIC3 acid-evoked currents by stabilizing the channel at the cell surface.
Homo sapiens (taxid: 9606)
>sp|Q2KIB6|LIN7B_BOVIN Protein lin-7 homolog B OS=Bos taurus GN=LIN7B PE=2 SV=1 Back     alignment and function description
>sp|O88951|LIN7B_MOUSE Protein lin-7 homolog B OS=Mus musculus GN=Lin7b PE=1 SV=2 Back     alignment and function description
>sp|Q9Z252|LIN7B_RAT Protein lin-7 homolog B OS=Rattus norvegicus GN=Lin7b PE=1 SV=1 Back     alignment and function description
>sp|Q792I0|LIN7C_RAT Protein lin-7 homolog C OS=Rattus norvegicus GN=Lin7c PE=1 SV=1 Back     alignment and function description
>sp|Q5RAA5|LIN7C_PONAB Protein lin-7 homolog C OS=Pongo abelii GN=LIN7C PE=2 SV=1 Back     alignment and function description
>sp|O88952|LIN7C_MOUSE Protein lin-7 homolog C OS=Mus musculus GN=Lin7c PE=1 SV=2 Back     alignment and function description
>sp|Q9NUP9|LIN7C_HUMAN Protein lin-7 homolog C OS=Homo sapiens GN=LIN7C PE=1 SV=1 Back     alignment and function description
>sp|Q0P5F3|LIN7C_BOVIN Protein lin-7 homolog C OS=Bos taurus GN=LIN7C PE=2 SV=1 Back     alignment and function description
>sp|Q5F425|LIN7C_CHICK Protein lin-7 homolog C OS=Gallus gallus GN=LIN7C PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query172
156538030197 PREDICTED: protein lin-7 homolog B-like 0.976 0.852 0.910 5e-76
170044042196 veli [Culex quinquefasciatus] gi|1678672 0.976 0.857 0.922 7e-76
157107717197 hypothetical protein AaeL_AAEL004846 [Ae 0.976 0.852 0.922 9e-76
158294891197 AGAP005858-PA [Anopheles gambiae str. PE 0.976 0.852 0.922 9e-76
242003890197 conserved hypothetical protein [Pediculu 0.988 0.862 0.911 1e-75
66534675198 PREDICTED: protein lin-7 homolog B-like 0.976 0.848 0.910 5e-75
307169929198 Lin-7-like protein B [Camponotus florida 0.976 0.848 0.910 5e-75
389609839198 conserved hypothetical protein [Papilio 0.970 0.843 0.916 6e-75
332025203198 Lin-7-like protein B [Acromyrmex echinat 0.976 0.848 0.910 6e-75
383861723198 PREDICTED: protein lin-7 homolog B-like 0.976 0.848 0.904 8e-75
>gi|156538030|ref|XP_001603299.1| PREDICTED: protein lin-7 homolog B-like [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  288 bits (737), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 153/168 (91%), Positives = 162/168 (96%)

Query: 1   GEVPVTKLSALQKVLQSDFFNCVRDVYEHVYETVDIQGSPDVRASATAKATVAAFAASEG 60
           GE+PVTKL+ALQKVLQSDFF+ VR+VYEH+Y+TVDIQGS DVRASATAKATVAAFAASEG
Sbjct: 28  GEIPVTKLAALQKVLQSDFFSAVREVYEHIYDTVDIQGSQDVRASATAKATVAAFAASEG 87

Query: 61  HAHPRVVELPKTDEGLGFNVMGGKEQNSPIYISRIIPGGVADRHGGLKRGDQLLSVNGVS 120
           HAHPRVVELPKTDEGLGFNVMGGKEQNSPIYISRIIPGGVADRHGGLKRGDQLLSVNGV 
Sbjct: 88  HAHPRVVELPKTDEGLGFNVMGGKEQNSPIYISRIIPGGVADRHGGLKRGDQLLSVNGVC 147

Query: 121 VEGEDHGKAVELLKQAQRSVKLVVRYTPKVLEEMEMRFDKQRTARRRQ 168
           VEGE+H KAVELLKQAQ SVKLVVRYTP+VLEEME+RFDKQR ARRRQ
Sbjct: 148 VEGENHEKAVELLKQAQNSVKLVVRYTPRVLEEMELRFDKQRAARRRQ 195

Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|170044042|ref|XP_001849671.1| veli [Culex quinquefasciatus] gi|167867282|gb|EDS30665.1| veli [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|157107717|ref|XP_001649906.1| hypothetical protein AaeL_AAEL004846 [Aedes aegypti] gi|157107719|ref|XP_001649907.1| hypothetical protein AaeL_AAEL004846 [Aedes aegypti] gi|108879518|gb|EAT43743.1| AAEL004846-PA [Aedes aegypti] gi|108879519|gb|EAT43744.1| AAEL004846-PB [Aedes aegypti] Back     alignment and taxonomy information
>gi|158294891|ref|XP_315884.3| AGAP005858-PA [Anopheles gambiae str. PEST] gi|157015776|gb|EAA11636.3| AGAP005858-PA [Anopheles gambiae str. PEST] gi|312373723|gb|EFR21416.1| hypothetical protein AND_17082 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|242003890|ref|XP_002422900.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212505782|gb|EEB10162.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|66534675|ref|XP_624740.1| PREDICTED: protein lin-7 homolog B-like [Apis mellifera] gi|340718386|ref|XP_003397649.1| PREDICTED: protein lin-7 homolog B-like isoform 1 [Bombus terrestris] gi|340718388|ref|XP_003397650.1| PREDICTED: protein lin-7 homolog B-like isoform 2 [Bombus terrestris] gi|350401995|ref|XP_003486330.1| PREDICTED: protein lin-7 homolog B-like isoform 1 [Bombus impatiens] gi|350401998|ref|XP_003486331.1| PREDICTED: protein lin-7 homolog B-like isoform 2 [Bombus impatiens] gi|380017011|ref|XP_003692460.1| PREDICTED: protein lin-7 homolog B-like [Apis florea] Back     alignment and taxonomy information
>gi|307169929|gb|EFN62438.1| Lin-7-like protein B [Camponotus floridanus] gi|307207060|gb|EFN84869.1| Lin-7-like protein B [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|389609839|dbj|BAM18531.1| conserved hypothetical protein [Papilio xuthus] Back     alignment and taxonomy information
>gi|332025203|gb|EGI65382.1| Lin-7-like protein B [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|383861723|ref|XP_003706334.1| PREDICTED: protein lin-7 homolog B-like [Megachile rotundata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query172
FB|FBgn0039269246 veli "veli" [Drosophila melano 0.546 0.382 0.936 1.4e-66
UNIPROTKB|Q5F425197 LIN7C "Protein lin-7 homolog C 0.976 0.852 0.761 6.7e-65
UNIPROTKB|Q0P5F3197 LIN7C "Protein lin-7 homolog C 0.976 0.852 0.761 6.7e-65
UNIPROTKB|Q9NUP9197 LIN7C "Protein lin-7 homolog C 0.976 0.852 0.761 6.7e-65
UNIPROTKB|F2Z5M5197 LIN7C "Uncharacterized protein 0.976 0.852 0.761 6.7e-65
MGI|MGI:1330839197 Lin7c "lin-7 homolog C (C. ele 0.976 0.852 0.761 6.7e-65
RGD|621164197 Lin7c "lin-7 homolog C (C. ele 0.976 0.852 0.761 6.7e-65
ZFIN|ZDB-GENE-041011-2201 lin7c "lin-7 homolog C (C. ele 0.976 0.835 0.755 3.7e-64
UNIPROTKB|F1RIN6207 LIN7B "Uncharacterized protein 0.976 0.811 0.738 1.1e-62
UNIPROTKB|Q2KIB6201 LIN7B "Protein lin-7 homolog B 0.976 0.835 0.732 1.4e-62
FB|FBgn0039269 veli "veli" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 440 (159.9 bits), Expect = 1.4e-66, Sum P(2) = 1.4e-66
 Identities = 88/94 (93%), Positives = 89/94 (94%)

Query:    75 GLGFNVMGGKEQNSPIYISRIIPGGVADRHGGLKRGDQLLSVNGVSVEGEDHGKAVELLK 134
             GLGFNVMGGKEQNSPIYISRIIPGGVADRHGGLKRGDQLLSVNGVSVEGE+H KAVELLK
Sbjct:   153 GLGFNVMGGKEQNSPIYISRIIPGGVADRHGGLKRGDQLLSVNGVSVEGENHEKAVELLK 212

Query:   135 QAQRSVKLVVRYTPKVLEEMEMRFDKQRTARRRQ 168
             QA  SVKLVVRYTPKVLEEMEMRFDKQR  RRRQ
Sbjct:   213 QAVGSVKLVVRYTPKVLEEMEMRFDKQRNTRRRQ 246
GO:0007163 "establishment or maintenance of cell polarity" evidence=NAS
GO:0045211 "postsynaptic membrane" evidence=IDA
GO:0035003 "subapical complex" evidence=IDA
GO:0008582 "regulation of synaptic growth at neuromuscular junction" evidence=IMP
UNIPROTKB|Q5F425 LIN7C "Protein lin-7 homolog C" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q0P5F3 LIN7C "Protein lin-7 homolog C" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NUP9 LIN7C "Protein lin-7 homolog C" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z5M5 LIN7C "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1330839 Lin7c "lin-7 homolog C (C. elegans)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|621164 Lin7c "lin-7 homolog C (C. elegans)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041011-2 lin7c "lin-7 homolog C (C. elegans)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1RIN6 LIN7B "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q2KIB6 LIN7B "Protein lin-7 homolog B" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9NUP9LIN7C_HUMANNo assigned EC number0.84520.97670.8527noN/A
Q5F425LIN7C_CHICKNo assigned EC number0.84520.97670.8527yesN/A
O14910LIN7A_HUMANNo assigned EC number0.80830.97090.7167noN/A
Q9Z252LIN7B_RATNo assigned EC number0.81540.97670.8115yesN/A
Q9Z250LIN7A_RATNo assigned EC number0.80830.97090.7198noN/A
Q2KIB6LIN7B_BOVINNo assigned EC number0.80950.97670.8358yesN/A
Q5RAA5LIN7C_PONABNo assigned EC number0.84520.97670.8527noN/A
Q32LM6LIN7A_BOVINNo assigned EC number0.80830.97090.7167noN/A
Q0P5F3LIN7C_BOVINNo assigned EC number0.84520.97670.8527noN/A
Q792I0LIN7C_RATNo assigned EC number0.84520.97670.8527noN/A
O88951LIN7B_MOUSENo assigned EC number0.81540.97670.8115yesN/A
O88952LIN7C_MOUSENo assigned EC number0.84520.97670.8527noN/A
Q8JZS0LIN7A_MOUSENo assigned EC number0.80830.97090.7167noN/A
Q9HAP6LIN7B_HUMANNo assigned EC number0.80950.97670.8115yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query172
cd0099282 cd00992, PDZ_signaling, PDZ domain found in a vari 6e-29
smart0022885 smart00228, PDZ, Domain present in PSD-95, Dlg, an 5e-25
pfam0059580 pfam00595, PDZ, PDZ domain (Also known as DHR or G 3e-17
cd0013670 cd00136, PDZ, PDZ domain, also called DHR (Dlg hom 3e-12
cd0098885 cd00988, PDZ_CTP_protease, PDZ domain of C-termina 4e-07
smart0056953 smart00569, L27, domain in receptor targeting prot 6e-05
pfam0282851 pfam02828, L27, L27 domain 1e-04
COG0793 406 COG0793, Prc, Periplasmic protease [Cell envelope 2e-04
cd0098790 cd00987, PDZ_serine_protease, PDZ domain of tryspi 5e-04
cd0098979 cd00989, PDZ_metalloprotease, PDZ domain of bacter 0.002
>gnl|CDD|238492 cd00992, PDZ_signaling, PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information 
 Score =  101 bits (255), Expect = 6e-29
 Identities = 44/83 (53%), Positives = 56/83 (67%), Gaps = 2/83 (2%)

Query: 64  PRVVELPK-TDEGLGFNVMGGKEQNSPIYISRIIPGGVADRHGGLKRGDQLLSVNGVSVE 122
            R V L K    GLGF++ GGK+    I++SR+ PGG A+R GGL+ GD++L VNGVSVE
Sbjct: 1   VRTVTLRKDPGGGLGFSLRGGKDSGGGIFVSRVEPGGPAER-GGLRVGDRILEVNGVSVE 59

Query: 123 GEDHGKAVELLKQAQRSVKLVVR 145
           G  H +AVELLK +   V L VR
Sbjct: 60  GLTHEEAVELLKNSGDEVTLTVR 82

May be responsible for specific protein-protein interactions, as most PDZ domains bind C-terminal polypeptides, and binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of PDZ domains an N-terminal beta-strand forms the peptide-binding groove base, a circular permutation with respect to PDZ domains found in proteases. Length = 82
>gnl|CDD|214570 smart00228, PDZ, Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>gnl|CDD|201332 pfam00595, PDZ, PDZ domain (Also known as DHR or GLGF) Back     alignment and domain information
>gnl|CDD|238080 cd00136, PDZ, PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>gnl|CDD|238488 cd00988, PDZ_CTP_protease, PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>gnl|CDD|197794 smart00569, L27, domain in receptor targeting proteins Lin-2 and Lin-7 Back     alignment and domain information
>gnl|CDD|217245 pfam02828, L27, L27 domain Back     alignment and domain information
>gnl|CDD|223864 COG0793, Prc, Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|238487 cd00987, PDZ_serine_protease, PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>gnl|CDD|238489 cd00989, PDZ_metalloprotease, PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 172
KOG3550|consensus207 100.0
PF0059581 PDZ: PDZ domain (Also known as DHR or GLGF) Coordi 99.68
KOG3209|consensus984 99.52
KOG3549|consensus 505 99.5
cd0099282 PDZ_signaling PDZ domain found in a variety of Eum 99.43
KOG3209|consensus 984 99.39
smart0022885 PDZ Domain present in PSD-95, Dlg, and ZO-1/2. Als 99.38
KOG3551|consensus 506 99.32
cd0013670 PDZ PDZ domain, also called DHR (Dlg homologous re 99.3
KOG0609|consensus 542 99.16
PF1318082 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_ 99.15
KOG3651|consensus 429 99.12
KOG3542|consensus 1283 99.07
cd0098885 PDZ_CTP_protease PDZ domain of C-terminal processi 99.06
KOG3606|consensus358 98.99
KOG1892|consensus 1629 98.99
KOG3571|consensus 626 98.98
KOG3553|consensus124 98.95
KOG3580|consensus 1027 98.93
KOG3552|consensus 1298 98.88
cd0099179 PDZ_archaeal_metalloprotease PDZ domain of archaea 98.84
COG0793 406 Prc Periplasmic protease [Cell envelope biogenesis 98.81
cd0099080 PDZ_glycyl_aminopeptidase PDZ domain associated wi 98.77
PLN00049 389 carboxyl-terminal processing protease; Provisional 98.75
PRK11186 667 carboxy-terminal protease; Provisional 98.75
cd0098979 PDZ_metalloprotease PDZ domain of bacterial and pl 98.74
cd0098790 PDZ_serine_protease PDZ domain of tryspin-like ser 98.63
TIGR00225 334 prc C-terminal peptidase (prc). A C-terminal pepti 98.62
KOG3605|consensus829 98.6
cd0098679 PDZ_LON_protease PDZ domain of ATP-dependent LON s 98.59
KOG3580|consensus 1027 98.54
KOG3938|consensus334 98.5
TIGR01713259 typeII_sec_gspC general secretion pathway protein 98.4
TIGR02037428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 98.3
KOG3605|consensus829 98.28
PRK10139455 serine endoprotease; Provisional 98.25
PRK10942473 serine endoprotease; Provisional 98.23
PRK10139455 serine endoprotease; Provisional 98.21
TIGR00054 420 RIP metalloprotease RseP. A model that detects fra 98.17
TIGR02037428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 98.17
TIGR02038351 protease_degS periplasmic serine pepetdase DegS. T 98.14
PRK10898353 serine endoprotease; Provisional 98.1
PRK10942473 serine endoprotease; Provisional 98.07
PRK10779 449 zinc metallopeptidase RseP; Provisional 98.06
PRK10779 449 zinc metallopeptidase RseP; Provisional 98.06
PF04495138 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: 97.85
TIGR02860 402 spore_IV_B stage IV sporulation protein B. SpoIVB, 97.84
KOG0606|consensus 1205 97.78
TIGR03279 433 cyano_FeS_chp putative FeS-containing Cyanobacteri 97.65
TIGR00054 420 RIP metalloprotease RseP. A model that detects fra 97.65
PF1468588 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6 97.54
KOG3129|consensus231 97.39
COG0265347 DegQ Trypsin-like serine proteases, typically peri 97.18
KOG3532|consensus 1051 97.11
PRK09681276 putative type II secretion protein GspC; Provision 97.06
KOG1738|consensus 638 97.02
COG3975558 Predicted protease with the C-terminal PDZ domain 97.02
PF0282856 L27: L27 domain; InterPro: IPR014775 The L27 domai 96.7
KOG4407|consensus 1973 96.39
COG3480 342 SdrC Predicted secreted protein containing a PDZ d 96.32
KOG1320|consensus473 96.26
COG3031275 PulC Type II secretory pathway, component PulC [In 96.07
KOG1421|consensus 955 95.99
PF1281278 PDZ_1: PDZ-like domain 95.21
KOG3834|consensus 462 93.58
KOG4371|consensus1332 93.24
smart0056955 L27 domain in receptor targeting proteins Lin-2 an 92.86
KOG4371|consensus1332 89.65
PF0904558 L27_2: L27_2; InterPro: IPR015132 The L27_2 domain 88.98
COG0750 375 Predicted membrane-associated Zn-dependent proteas 86.09
KOG3834|consensus 462 84.35
PF0905864 L27_1: L27_1; InterPro: IPR015143 The L27 domain i 82.02
KOG1421|consensus955 81.09
KOG0792|consensus 1144 80.92
>KOG3550|consensus Back     alignment and domain information 
Probab=100.00  E-value=4.6e-36  Score=208.63  Aligned_cols=170  Identities=86%  Similarity=1.247  Sum_probs=165.3

Q ss_pred             CCCChhcHHHHHHhhhhhHHHHHHHHHHHHHhhhccCCCcccccccchhhhhhhhhhccCCCCCEEEEEecCCCCCCeEE
Q psy12578          1 GEVPVTKLSALQKVLQSDFFNCVRDVYEHVYETVDIQGSPDVRASATAKATVAAFAASEGHAHPRVVELPKTDEGLGFNV   80 (172)
Q Consensus         1 ~~~~~~~~~~l~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~l~~~~~g~G~~l   80 (172)
                      |++|+++|..|+++|+|.||.++.|+|+++|++++..+++...+.+..+++++.|.+++....||.|.|.|...|+||.+
T Consensus        28 gevp~~kl~alq~vlqsef~~avrevye~vyetidi~~s~eira~atakatvaafaaseghahprvvelpktdeglgfnv  107 (207)
T KOG3550|consen   28 GEVPPQKLQALQKVLQSEFCTAVREVYEHVYETIDIDGSPEIRAAATAKATVAAFAASEGHAHPRVVELPKTDEGLGFNV  107 (207)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcccCCChHHhhhhhhHHHHHHHHHhccCCCCceeecCccccccceee
Confidence            89999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eccCCCCCCeEEEeecCCChhhhcCCCCCCCEEEEECCeeCCCCCHHHHHHHHHhCCCeEEEEEEECCchhHHHHHHhhh
Q psy12578         81 MGGKEQNSPIYISRIIPGGVADRHGGLKRGDQLLSVNGVSVEGEDHGKAVELLKQAQRSVKLVVRYTPKVLEEMEMRFDK  160 (172)
Q Consensus        81 ~~~~~~~~~~~V~~v~~g~~A~~~G~L~~GD~I~~Vng~~v~~~~~~~~~~~l~~~~~~v~l~v~r~~~~~~~~~~~~~~  160 (172)
                      .||++.+.++||++++|||.|++.|.|+.||++++|||.++.+-.|+.++.+++.+.++|.|.|++.|+.+++++.+|.+
T Consensus       108 mggkeqnspiyisriipggvadrhgglkrgdqllsvngvsvege~hekavellkaa~gsvklvvrytpkvleeme~rfek  187 (207)
T KOG3550|consen  108 MGGKEQNSPIYISRIIPGGVADRHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAVGSVKLVVRYTPKVLEEMEARFEK  187 (207)
T ss_pred             ccCcccCCceEEEeecCCccccccCcccccceeEeecceeecchhhHHHHHHHHHhcCcEEEEEecChHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccccccCCC
Q psy12578        161 QRTARRRQPP  170 (172)
Q Consensus       161 ~~~~~~~~~~  170 (172)
                      .|...|||+.
T Consensus       188 ~r~~rrrqq~  197 (207)
T KOG3550|consen  188 QRSARRRQQS  197 (207)
T ss_pred             HHHHHHhhcC
Confidence            9988877653

>PF00595 PDZ: PDZ domain (Also known as DHR or GLGF) Coordinates are not yet available; InterPro: IPR001478 PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [, ] Back     alignment and domain information
>KOG3209|consensus Back     alignment and domain information
>KOG3549|consensus Back     alignment and domain information
>cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>KOG3209|consensus Back     alignment and domain information
>smart00228 PDZ Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>KOG3551|consensus Back     alignment and domain information
>cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>KOG0609|consensus Back     alignment and domain information
>PF13180 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_A 2PZD_B 2P3W_A 1VCW_C 1TE0_B 1SOZ_C 1SOT_C Back     alignment and domain information
>KOG3651|consensus Back     alignment and domain information
>KOG3542|consensus Back     alignment and domain information
>cd00988 PDZ_CTP_protease PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>KOG3606|consensus Back     alignment and domain information
>KOG1892|consensus Back     alignment and domain information
>KOG3571|consensus Back     alignment and domain information
>KOG3553|consensus Back     alignment and domain information
>KOG3580|consensus Back     alignment and domain information
>KOG3552|consensus Back     alignment and domain information
>cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>COG0793 Prc Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd00990 PDZ_glycyl_aminopeptidase PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases Back     alignment and domain information
>PLN00049 carboxyl-terminal processing protease; Provisional Back     alignment and domain information
>PRK11186 carboxy-terminal protease; Provisional Back     alignment and domain information
>cd00989 PDZ_metalloprotease PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>TIGR00225 prc C-terminal peptidase (prc) Back     alignment and domain information
>KOG3605|consensus Back     alignment and domain information
>cd00986 PDZ_LON_protease PDZ domain of ATP-dependent LON serine proteases Back     alignment and domain information
>KOG3580|consensus Back     alignment and domain information
>KOG3938|consensus Back     alignment and domain information
>TIGR01713 typeII_sec_gspC general secretion pathway protein C Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>KOG3605|consensus Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>TIGR00054 RIP metalloprotease RseP Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>TIGR02038 protease_degS periplasmic serine pepetdase DegS Back     alignment and domain information
>PRK10898 serine endoprotease; Provisional Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>PRK10779 zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>PRK10779 zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>PF04495 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: IPR007583 GRASP55 (Golgi reassembly stacking protein of 55 kDa) and GRASP65 (a 65 kDa) protein are highly homologous Back     alignment and domain information
>TIGR02860 spore_IV_B stage IV sporulation protein B Back     alignment and domain information
>KOG0606|consensus Back     alignment and domain information
>TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase Back     alignment and domain information
>TIGR00054 RIP metalloprotease RseP Back     alignment and domain information
>PF14685 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6F_D 1N6D_C 1N6E_C 1K32_A Back     alignment and domain information
>KOG3129|consensus Back     alignment and domain information
>COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3532|consensus Back     alignment and domain information
>PRK09681 putative type II secretion protein GspC; Provisional Back     alignment and domain information
>KOG1738|consensus Back     alignment and domain information
>COG3975 Predicted protease with the C-terminal PDZ domain [General function prediction only] Back     alignment and domain information
>PF02828 L27: L27 domain; InterPro: IPR014775 The L27 domain is found in receptor targeting proteins Lin-2 and Lin-7, as well as some protein kinases and human MPP2 protein Back     alignment and domain information
>KOG4407|consensus Back     alignment and domain information
>COG3480 SdrC Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG1320|consensus Back     alignment and domain information
>COG3031 PulC Type II secretory pathway, component PulC [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1421|consensus Back     alignment and domain information
>PF12812 PDZ_1: PDZ-like domain Back     alignment and domain information
>KOG3834|consensus Back     alignment and domain information
>KOG4371|consensus Back     alignment and domain information
>smart00569 L27 domain in receptor targeting proteins Lin-2 and Lin-7 Back     alignment and domain information
>KOG4371|consensus Back     alignment and domain information
>PF09045 L27_2: L27_2; InterPro: IPR015132 The L27_2 domain is a protein-protein interaction domain capable of organising scaffold proteins into supramolecular assemblies by formation of heteromeric L27_2 domain complexes Back     alignment and domain information
>COG0750 Predicted membrane-associated Zn-dependent proteases 1 [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG3834|consensus Back     alignment and domain information
>PF09058 L27_1: L27_1; InterPro: IPR015143 The L27 domain is a protein interaction module that exists in a large family of scaffold proteins, functioning as an organisation centre of large protein assemblies required for the establishment and maintenance of cell polarity Back     alignment and domain information
>KOG1421|consensus Back     alignment and domain information
>KOG0792|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query172
2dkr_A93 Solution Structure Of The Pdz Domain From Human Lin 3e-37
2he2_A102 Crystal Structure Of The 3rd Pdz Domain Of Human Di 2e-15
3jxt_A104 Crystal Structure Of The Third Pdz Domain Of Sap-10 7e-15
1um7_A113 Solution Structure Of The Third Pdz Domain Of Synap 9e-15
2xkx_A 721 Single Particle Analysis Of Psd-95 In Negative Stai 3e-14
1be9_A119 The Third Pdz Domain From The Synaptic Protein Psd- 9e-14
3i4w_A104 Crystal Structure Of The Third Pdz Domain Of Psd-95 1e-13
1tp3_A119 Pdz3 Domain Of Psd-95 Protein Complexed With Kketpv 1e-13
3k82_A98 Crystal Structure Of The Third Pdz Domain Of Psd-95 1e-13
2q9v_A90 Crystal Structure Of The C890s Mutant Of The 4th Pd 8e-13
2dc2_A103 Solution Structure Of Pdz Domain Length = 103 2e-12
4e34_A87 Crystal Structure Of Cftr Associated Ligand (Cal) P 2e-12
2lob_A112 Pdz Domain Of Cal (Cystic Fibrosis Transmembrane Re 2e-12
2r4h_B112 Crystal Structure Of A C1190s Mutant Of The 6th Pdz 2e-11
2vrf_A95 Crystal Structure Of The Human Beta-2-Syntrophin Pd 2e-11
1wi2_A104 Solution Structure Of The Pdz Domain From Riken Cdn 2e-11
1vj6_A102 Pdz2 From Ptp-Bl In Complex With The C-Terminal Lig 2e-11
1gm1_A94 Second Pdz Domain (Pdz2) Of Ptp-Bl Length = 94 3e-11
3qe1_A107 Crystal Structure Of Pdz Domain Of Sorting Nexin 27 4e-11
3qgl_A101 Crystal Structure Of Pdz Domain Of Sorting Nexin 27 5e-11
2fne_A117 The Crystal Structure Of The 13th Pdz Domain Of Mpd 6e-11
3qdo_A109 Crystal Structure Of Pdz Domain Of Sorting Nexin 27 6e-11
1d5g_A96 Solution Structure Of The Pdz2 Domain From Human Ph 1e-10
2jil_A97 Crystal Structure Of 2nd Pdz Domain Of Glutamate Re 1e-10
3zrt_A199 Crystal Structure Of Human Psd-95 Pdz1-2 Length = 1 1e-10
1pdr_A99 Crystal Structure Of The Third Pdz Domain From The 1e-10
3pdz_A96 Solution Structure Of The Pdz2 Domain From Human Ph 1e-10
2qt5_A200 Crystal Structure Of Grip1 Pdz12 In Complex With Th 1e-10
1wha_A105 Solution Structure Of The Second Pdz Domain Of Huma 2e-10
2dlu_A111 Solution Structure Of The Second Pdz Domain Of Huma 3e-10
3rl7_B107 Crytal Structure Of Hdlg1-Pdz1 Complexed With Apc L 4e-10
3gsl_A196 Crystal Structure Of Psd-95 Tandem Pdz Domains 1 An 4e-10
2ka9_A189 Solution Structure Of Psd-95 Pdz12 Complexed With C 4e-10
1wfv_A103 Solution Structure Of The Fifth Pdz Domain Of Human 4e-10
1uep_A103 Solution Structure Of The Third Pdz Domain Of Human 6e-10
1qav_A90 Unexpected Modes Of Pdz Domain Scaffolding Revealed 6e-10
2wl7_A102 Crystal Structure Of The Psd93 Pdz1 Domain Length = 6e-10
3lra_A254 Structural Basis For Assembling A Human Tripartite 8e-10
2jin_A102 Crystal Structure Of Pdz Domain Of Synaptojanin-2 B 1e-09
2jik_A101 Crystal Structure Of Pdz Domain Of Synaptojanin-2 B 1e-09
1z86_A87 Solution Structure Of The Pdz Domain Of Alpha-Syntr 1e-09
1z87_A263 Solution Structure Of The Split Ph-Pdz Supramodule 1e-09
2pdz_A86 Solution Structure Of The Syntrophin Pdz Domain In 1e-09
2eno_A120 Solution Structure Of The Pdz Domain From Human Syn 1e-09
1zok_A93 Pdz1 Domain Of Synapse Associated Protein 97 Length 1e-09
1ozi_A99 The Alternatively Spliced Pdz2 Domain Of Ptp-Bl Len 2e-09
1x6d_A119 Solution Structures Of The Pdz Domain Of Human Inte 2e-09
1iu0_A91 The First Pdz Domain Of Psd-95 Length = 91 3e-09
1rgr_A99 Cyclic Peptides Targeting Pdz Domains Of Psd-95: St 3e-09
1kef_A93 Pdz1 Of Sap90 Length = 93 3e-09
4amh_A106 Influence Of Circular Permutation On The Folding Pa 3e-09
2awx_A105 Synapse Associated Protein 97 Pdz2 Domain Variant C 5e-09
3b76_A118 Crystal Structure Of The Third Pdz Domain Of Human 7e-09
1q7x_A108 Solution Structure Of The Alternatively Spliced Pdz 8e-09
2i0i_A85 X-Ray Crystal Structure Of Sap97 Pdz3 Bound To The 8e-09
2x7z_A99 Crystal Structure Of The Sap97 Pdz2 I342w C378a Mut 1e-08
2g2l_A105 Crystal Structure Of The Second Pdz Domain Of Sap97 1e-08
2dm8_A116 Solution Structure Of The Eighth Pdz Domain Of Huma 2e-08
3rl8_A105 Crytal Structure Of Hdlg1-Pdz2 Complexed With Apc L 2e-08
2awu_A105 Synapse Associated Protein 97 Pdz2 Domain Variant C 2e-08
4g69_A100 Structure Of The Human Discs Large 1 Pdz2 - Adenoma 2e-08
2oqs_A97 Structure Of The HdlgSAP97 PDZ2 IN COMPLEX WITH HPV 2e-08
2byg_A117 2nd Pdz Domain Of Discs Large Homologue 2 Length = 3e-08
2i0l_A84 X-Ray Crystal Structure Of Sap97 Pdz2 Bound To The 3e-08
1uez_A101 Solution Structure Of The First Pdz Domain Of Human 3e-08
2koj_A111 Solution Structure Of Mouse Par-3 Pdz2 (Residues 45 3e-08
1n7e_A97 Crystal Structure Of The Sixth Pdz Domain Of Grip1 3e-08
2ogp_A97 Solution Structure Of The Second Pdz Domain Of Par- 3e-08
2kom_A121 Solution Structure Of Humar Par-3b Pdz2 (Residues 4 7e-08
2aww_A105 Synapse Associated Protein 97 Pdz2 Domain Variant C 8e-08
2db5_A128 Solution Structure Of The First Pdz Domain Of Inad- 8e-08
3uit_A265 Overall Structure Of PatjPALS1MALS COMPLEX Length = 1e-07
2ocs_A88 The Crystal Structure Of The First Pdz Domain Of Hu 1e-07
2o2t_A117 The Crystal Structure Of The 1st Pdz Domain Of Mpdz 2e-07
2fe5_A94 The Crystal Structure Of The Second Pdz Domain Of H 2e-07
1qlc_A95 Solution Structure Of The Second Pdz Domain Of Post 2e-07
2iwo_A120 12th Pdz Domain Of Multiple Pdz Domain Protein Mpdz 2e-07
3k1r_A192 Structure Of Harmonin Npdz1 In Complex With The Sam 6e-07
2w4f_A97 Crystal Structure Of The First Pdz Domain Of Human 7e-07
3axa_A106 Crystal Structure Of Afadin Pdz Domain In Complex W 7e-07
2d92_A108 Solution Structure Of The Fifth Pdz Domain Of Inad- 8e-07
1uew_A114 Solution Structure Of The Forth Pdz Domain Of Human 8e-07
1x5q_A110 Solution Structure Of The First Pdz Domain Of Scrib 1e-06
3r68_A95 Molecular Analysis Of The Pdz3 Domain Of Pdzk1 Leng 1e-06
1y74_A57 Solution Structure Of Mlin-2MLIN-7 L27 Domain Compl 1e-06
2i1n_A102 Crystal Structure Of The 1st Pdz Domain Of Human Dl 1e-06
2eeh_A100 Solution Structure Of First Pdz Domain Of Pdz Domai 1e-06
1uit_A117 Solution Structure Of Rsgi Ruh-006, The Third Pdz D 2e-06
2qg1_A92 Crystal Structure Of The 11th Pdz Domain Of Mpdz (M 2e-06
3r69_A89 Molecular Analysis Of The Interaction Of The Hdl-Re 2e-06
2opg_A98 The Crystal Structure Of The 10th Pdz Domain Of Mpd 2e-06
1ueq_A123 Solution Structure Of The First Pdz Domain Of Human 3e-06
2ain_A93 Solution Structure Of The Af-6 Pdz Domain Complexed 4e-06
1t2m_A101 Solution Structure Of The Pdz Domain Of Af-6 Length 4e-06
2daz_A124 Solution Structure Of The 7th Pdz Domain Of Inad-Li 4e-06
2edz_A114 Solution Structures Of The Pdz Domain Of Mus Muscul 4e-06
2ehr_A117 Solution Structure Of The Sixth Pdz Domain Of Human 4e-06
3o46_A93 Crystal Structure Of The Pdz Domain Of Mpp7 Length 6e-06
1xz9_A101 Structure Of Af-6 Pdz Domain Length = 101 6e-06
1nf3_C128 Structure Of Cdc42 In A Complex With The Gtpase-Bin 6e-06
1p1d_A196 Structural Insights Into The Inter-Domain Chaperoni 7e-06
1v62_A117 Solution Structure Of The 3rd Pdz Domain Of Grip2 L 8e-06
2he4_A90 The Crystal Structure Of The Second Pdz Domain Of H 8e-06
1g9o_A91 First Pdz Domain Of The Human Na+H+ EXCHANGER REGUL 8e-06
1wi4_A109 Solution Structure Of The Pdz Domain Of Syntaxin Bi 9e-06
2qbw_A195 The Crystal Structure Of Pdz-Fibronectin Fusion Pro 9e-06
1gq4_A90 Structural Determinants Of The Nherf Interaction Wi 1e-05
1i92_A91 Structural Basis Of The Nherf Pdz1-Cftr Interaction 1e-05
3ch8_A195 The Crystal Structure Of Pdz-Fibronectin Fusion Pro 1e-05
1gq5_A91 Structural Determinants Of The Nherf Interaction Wi 1e-05
1mfg_A95 The Structure Of Erbin Pdz Domain Bound To The Carb 1e-05
2vph_A100 Crystal Structure Of The Human Protein Tyrosine Pho 1e-05
2h3l_A103 Crystal Structure Of Erbin Pdz Length = 103 1e-05
1rgw_A85 Solution Structure Of Zasp's Pdz Domain Length = 85 1e-05
1wjl_A90 Solution Structure Of Pdz Domain Of Mouse Cypher Pr 2e-05
4f8k_A109 Molecular Analysis Of The Interaction Between The P 2e-05
2djt_A104 Solution Structures Of The Pdz Domain Of Human Unna 2e-05
3ngh_A106 Molecular Analysis Of The Interaction Of The Hdl Re 2e-05
2d90_A102 Solution Structure Of The Third Pdz Domain Of Pdz D 2e-05
1uhp_A107 Solution Structure Of Rsgi Ruh-005, A Pdz Domain In 2e-05
2edp_A100 Solution Structure Of The Pdz Domain From Human Shr 3e-05
2cs5_A119 Solution Structure Of Pdz Domain Of Protein Tyrosin 3e-05
2fn5_A94 Nmr Structure Of The Neurabin Pdz Domain (502-594) 3e-05
3hvq_C170 Crystal Structure Of A Complex Between Protein Phos 3e-05
2kbs_A92 Solution Structure Of Harmonin Pdz2 In Complex With 3e-05
1uf1_A128 Solution Structure Of The Second Pdz Domain Of Huma 3e-05
1x5n_A114 Solution Structure Of The Second Pdz Domain Of Harm 4e-05
2lc6_A128 Solution Structure Of Par-6 Q144cL164C Length = 128 4e-05
2koh_A111 Nmr Structure Of Mouse Par3-Pdz3 In Complex With Ve 4e-05
1ry4_A128 Nmr Structure Of The Crib-Pdz Module Of Par-6 Lengt 4e-05
2k1z_A104 Solution Structure Of Par-3 Pdz3 Length = 104 4e-05
2krg_A216 Solution Structure Of Human Sodium HYDROGEN EXCHANG 4e-05
3nfk_A107 Crystal Structure Of The Ptpn4 Pdz Domain Complexed 4e-05
1um1_A110 Solution Structure Of Rsgi Ruh-007, Pdz Domain In H 5e-05
1wg6_A127 Solution Structure Of Pdz Domain In Protein Xp_1108 5e-05
1va8_A113 Solution Structure Of The Pdz Domain Of Pals1 Prote 5e-05
2iwn_A97 3rd Pdz Domain Of Multiple Pdz Domain Protein Mpdz 5e-05
2i04_A85 X-Ray Crystal Structure Of Magi-1 Pdz1 Bound To The 6e-05
1rzx_A98 Crystal Structure Of A Par-6 Pdz-Peptide Complex Le 7e-05
2kjd_A128 Solution Structure Of Extended Pdz2 Domain From Nhe 7e-05
2jxo_A98 Structure Of The Second Pdz Domain Of Nherf-1 Lengt 7e-05
2kpk_A129 Magi-1 Pdz1 Length = 129 8e-05
1x8s_A102 Structure Of The Par-6 Pdz Domain With A Pals1 Inte 9e-05
2ozf_A92 The Crystal Structure Of The 2nd Pdz Domain Of The 9e-05
1uju_A111 Solution Structure Of The Fourth Pdz Domain Of Huma 1e-04
1ujd_A117 Solution Structure Of Rsgi Ruh-003, A Pdz Domain Of 2e-04
2dmz_A129 Solution Structure Of The Third Pdz Domain Of Human 2e-04
3pdv_A89 Structure Of The Pdlim2 Pdz Domain In Complex With 2e-04
1wf7_A103 Solution Structure Of The Pdz Domain Of Enigma Homo 2e-04
2pa1_A87 Structure Of The Pdz Domain Of Human Pdlim2 Bound T 2e-04
1zl8_A53 Nmr Structure Of L27 Heterodimer From C. Elegans Li 2e-04
1wf8_A107 Solution Structure Of The Pdz Domain Of Spinophilin 2e-04
1i16_A130 Structure Of Interleukin 16: Implications For Funct 3e-04
2yt8_A94 Solution Structure Of The Pdz Domain Of Amyloid Bet 3e-04
1ihj_A98 Crystal Structure Of The N-Terminal Pdz Domain Of I 4e-04
2q3g_A89 Structure Of The Pdz Domain Of Human Pdlim7 Bound T 4e-04
2g5m_B113 Spinophilin Pdz Domain Length = 113 5e-04
1x5r_A112 Solution Structure Of The Fourth Pdz Domain Of Glut 5e-04
1v5l_A103 Solution Structure Of Pdz Domain Of Mouse Alpha-Act 5e-04
2fcf_A103 The Crystal Structure Of The 7th Pdz Domain Of Mpdz 6e-04
2uzc_A88 Structure Of Human Pdlim5 In Complex With The C-Ter 6e-04
2iwq_A123 7th Pdz Domain Of Multiple Pdz Domain Protein Mpdz 6e-04
2omj_A89 Solution Structure Of Larg Pdz Domain Length = 89 7e-04
3egh_C170 Crystal Structure Of A Complex Between Protein Phos 8e-04
3egg_C170 Crystal Structure Of A Complex Between Protein Phos 8e-04
2kv8_A83 Solution Structure Ofrgs12 Pdz Domain Length = 83 8e-04
>pdb|2DKR|A Chain A, Solution Structure Of The Pdz Domain From Human Lin-7 Homolog B Length = 93 Back     alignment and structure 
Iteration: 1

 Score =  150 bits (379), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 75/83 (90%), Positives = 77/83 (92%)
Query: 66  VVELPKTDEGLGFNVMGGKEQNSPIYISRIIPGGVADRHGGLKRGDQLLSVNGVSVEGED 125
           VVELPKTDEGLGFN+MGGKEQNSPIYISR+IPGGVADRHGGLKRGDQLLSVNGVSVEGE 
Sbjct: 8   VVELPKTDEGLGFNIMGGKEQNSPIYISRVIPGGVADRHGGLKRGDQLLSVNGVSVEGEQ 67
Query: 126 HGKAVELLKQAQRSVKLVVRYTP 148
           H KAVELLK AQ SVKLVVR  P
Sbjct: 68  HEKAVELLKAAQGSVKLVVRSGP 90
>pdb|2HE2|A Chain A, Crystal Structure Of The 3rd Pdz Domain Of Human Discs Large Homologue 2, Dlg2 Length = 102 Back     alignment and structure
>pdb|3JXT|A Chain A, Crystal Structure Of The Third Pdz Domain Of Sap-102 In Complex With A Fluorogenic Peptide-Based Ligand Length = 104 Back     alignment and structure
>pdb|1UM7|A Chain A, Solution Structure Of The Third Pdz Domain Of Synapse- Associated Protein 102 Length = 113 Back     alignment and structure
>pdb|2XKX|A Chain A, Single Particle Analysis Of Psd-95 In Negative Stain Length = 721 Back     alignment and structure
>pdb|1BE9|A Chain A, The Third Pdz Domain From The Synaptic Protein Psd-95 In Complex With A C-Terminal Peptide Derived From Cript. Length = 119 Back     alignment and structure
>pdb|3I4W|A Chain A, Crystal Structure Of The Third Pdz Domain Of Psd-95 Length = 104 Back     alignment and structure
>pdb|1TP3|A Chain A, Pdz3 Domain Of Psd-95 Protein Complexed With Kketpv Peptide Ligand Length = 119 Back     alignment and structure
>pdb|3K82|A Chain A, Crystal Structure Of The Third Pdz Domain Of Psd-95 Length = 98 Back     alignment and structure
>pdb|2Q9V|A Chain A, Crystal Structure Of The C890s Mutant Of The 4th Pdz Domain Of Human Membrane Associated Guanylate Kinase Length = 90 Back     alignment and structure
>pdb|2DC2|A Chain A, Solution Structure Of Pdz Domain Length = 103 Back     alignment and structure
>pdb|4E34|A Chain A, Crystal Structure Of Cftr Associated Ligand (Cal) Pdz Domain Bound To Ical36 (Ansrwptsii) Peptide Length = 87 Back     alignment and structure
>pdb|2LOB|A Chain A, Pdz Domain Of Cal (Cystic Fibrosis Transmembrane Regulator-Associated Ligand) Length = 112 Back     alignment and structure
>pdb|2R4H|B Chain B, Crystal Structure Of A C1190s Mutant Of The 6th Pdz Domain Of Human Membrane Associated Guanylate Kinase Length = 112 Back     alignment and structure
>pdb|2VRF|A Chain A, Crystal Structure Of The Human Beta-2-Syntrophin Pdz Domain Length = 95 Back     alignment and structure
>pdb|1WI2|A Chain A, Solution Structure Of The Pdz Domain From Riken Cdna 2700099c19 Length = 104 Back     alignment and structure
>pdb|1VJ6|A Chain A, Pdz2 From Ptp-Bl In Complex With The C-Terminal Ligand From The Apc Protein Length = 102 Back     alignment and structure
>pdb|1GM1|A Chain A, Second Pdz Domain (Pdz2) Of Ptp-Bl Length = 94 Back     alignment and structure
>pdb|3QGL|A Chain A, Crystal Structure Of Pdz Domain Of Sorting Nexin 27 (Snx27) In Complex With The Eseskv Peptide Corresponding To The C-Terminal Tail Of Girk3 Length = 101 Back     alignment and structure
>pdb|2FNE|A Chain A, The Crystal Structure Of The 13th Pdz Domain Of Mpdz Length = 117 Back     alignment and structure
>pdb|3QDO|A Chain A, Crystal Structure Of Pdz Domain Of Sorting Nexin 27 (Snx27) Fused To The Gly-Gly Linker Followed By C-Terminal (Eseskv) Of Girk3 Length = 109 Back     alignment and structure
>pdb|1D5G|A Chain A, Solution Structure Of The Pdz2 Domain From Human Phosphatase Hptp1e Complexed With A Peptide Length = 96 Back     alignment and structure
>pdb|2JIL|A Chain A, Crystal Structure Of 2nd Pdz Domain Of Glutamate Receptor Interacting Protein-1 (Grip1) Length = 97 Back     alignment and structure
>pdb|3ZRT|A Chain A, Crystal Structure Of Human Psd-95 Pdz1-2 Length = 199 Back     alignment and structure
>pdb|1PDR|A Chain A, Crystal Structure Of The Third Pdz Domain From The Human Homolog Of Discs Large Protein Length = 99 Back     alignment and structure
>pdb|3PDZ|A Chain A, Solution Structure Of The Pdz2 Domain From Human Phosphatase Hptp1e Length = 96 Back     alignment and structure
>pdb|2QT5|A Chain A, Crystal Structure Of Grip1 Pdz12 In Complex With The Fras1 Peptide Length = 200 Back     alignment and structure
>pdb|1WHA|A Chain A, Solution Structure Of The Second Pdz Domain Of Human Scribble (Kiaa0147 Protein) Length = 105 Back     alignment and structure
>pdb|2DLU|A Chain A, Solution Structure Of The Second Pdz Domain Of Human Inad- Like Protein Length = 111 Back     alignment and structure
>pdb|3RL7|B Chain B, Crytal Structure Of Hdlg1-Pdz1 Complexed With Apc Length = 107 Back     alignment and structure
>pdb|3GSL|A Chain A, Crystal Structure Of Psd-95 Tandem Pdz Domains 1 And 2 Length = 196 Back     alignment and structure
>pdb|2KA9|A Chain A, Solution Structure Of Psd-95 Pdz12 Complexed With Cypin Peptide Length = 189 Back     alignment and structure
>pdb|1WFV|A Chain A, Solution Structure Of The Fifth Pdz Domain Of Human Membrane Associated Guanylate Kinase Inverted-2 (Kiaa0705 Protein) Length = 103 Back     alignment and structure
>pdb|1UEP|A Chain A, Solution Structure Of The Third Pdz Domain Of Human Atrophin-1 Interacting Protein 1 (Kiaa0705 Protein) Length = 103 Back     alignment and structure
>pdb|1QAV|A Chain A, Unexpected Modes Of Pdz Domain Scaffolding Revealed By Structure Of Nnos-Syntrophin Complex Length = 90 Back     alignment and structure
>pdb|2WL7|A Chain A, Crystal Structure Of The Psd93 Pdz1 Domain Length = 102 Back     alignment and structure
>pdb|3LRA|A Chain A, Structural Basis For Assembling A Human Tripartite Complex Dlg1-Mpp7- Mals3 Length = 254 Back     alignment and structure
>pdb|2JIN|A Chain A, Crystal Structure Of Pdz Domain Of Synaptojanin-2 Binding Protein Length = 102 Back     alignment and structure
>pdb|2JIK|A Chain A, Crystal Structure Of Pdz Domain Of Synaptojanin-2 Binding Protein Length = 101 Back     alignment and structure
>pdb|1Z86|A Chain A, Solution Structure Of The Pdz Domain Of Alpha-Syntrophin Length = 87 Back     alignment and structure
>pdb|1Z87|A Chain A, Solution Structure Of The Split Ph-Pdz Supramodule Of Alpha- Syntrophin Length = 263 Back     alignment and structure
>pdb|2PDZ|A Chain A, Solution Structure Of The Syntrophin Pdz Domain In Complex With The Peptide Gvkeslv, Nmr, 15 Structures Length = 86 Back     alignment and structure
>pdb|2ENO|A Chain A, Solution Structure Of The Pdz Domain From Human Synaptojanin 2 Binding Protein Length = 120 Back     alignment and structure
>pdb|1ZOK|A Chain A, Pdz1 Domain Of Synapse Associated Protein 97 Length = 93 Back     alignment and structure
>pdb|1OZI|A Chain A, The Alternatively Spliced Pdz2 Domain Of Ptp-Bl Length = 99 Back     alignment and structure
>pdb|1X6D|A Chain A, Solution Structures Of The Pdz Domain Of Human Interleukin- 16 Length = 119 Back     alignment and structure
>pdb|1IU0|A Chain A, The First Pdz Domain Of Psd-95 Length = 91 Back     alignment and structure
>pdb|1RGR|A Chain A, Cyclic Peptides Targeting Pdz Domains Of Psd-95: Structural Basis For Enhanced Affinity And Enzymatic Stability Length = 99 Back     alignment and structure
>pdb|1KEF|A Chain A, Pdz1 Of Sap90 Length = 93 Back     alignment and structure
>pdb|4AMH|A Chain A, Influence Of Circular Permutation On The Folding Pathway Of A Pdz Domain Length = 106 Back     alignment and structure
>pdb|2AWX|A Chain A, Synapse Associated Protein 97 Pdz2 Domain Variant C378s Length = 105 Back     alignment and structure
>pdb|3B76|A Chain A, Crystal Structure Of The Third Pdz Domain Of Human Ligand-of-numb Protein-x (lnx1) In Complex With The C-terminal Peptide From The Coxsackievirus And Adenovirus Receptor Length = 118 Back     alignment and structure
>pdb|1Q7X|A Chain A, Solution Structure Of The Alternatively Spliced Pdz2 Domain (Pdz2b) Of Ptp-Bas (Hptp1e) Length = 108 Back     alignment and structure
>pdb|2I0I|A Chain A, X-Ray Crystal Structure Of Sap97 Pdz3 Bound To The C- Terminal Peptide Of Hpv18 E6 Length = 85 Back     alignment and structure
>pdb|2X7Z|A Chain A, Crystal Structure Of The Sap97 Pdz2 I342w C378a Mutant Protein Domain Length = 99 Back     alignment and structure
>pdb|2G2L|A Chain A, Crystal Structure Of The Second Pdz Domain Of Sap97 In Complex With A Glur-A C-Terminal Peptide Length = 105 Back     alignment and structure
>pdb|2DM8|A Chain A, Solution Structure Of The Eighth Pdz Domain Of Human Inad- Like Protein Length = 116 Back     alignment and structure
>pdb|3RL8|A Chain A, Crytal Structure Of Hdlg1-Pdz2 Complexed With Apc Length = 105 Back     alignment and structure
>pdb|2AWU|A Chain A, Synapse Associated Protein 97 Pdz2 Domain Variant C378g Length = 105 Back     alignment and structure
>pdb|4G69|A Chain A, Structure Of The Human Discs Large 1 Pdz2 - Adenomatous Polyposis Coli Cytoskeletal Polarity Complex Length = 100 Back     alignment and structure
>pdb|2OQS|A Chain A, Structure Of The HdlgSAP97 PDZ2 IN COMPLEX WITH HPV-18 Papillomavirus E6 Peptide Length = 97 Back     alignment and structure
>pdb|2BYG|A Chain A, 2nd Pdz Domain Of Discs Large Homologue 2 Length = 117 Back     alignment and structure
>pdb|2I0L|A Chain A, X-Ray Crystal Structure Of Sap97 Pdz2 Bound To The C- Terminal Peptide Of Hpv18 E6. Length = 84 Back     alignment and structure
>pdb|1UEZ|A Chain A, Solution Structure Of The First Pdz Domain Of Human Kiaa1526 Protein Length = 101 Back     alignment and structure
>pdb|2KOJ|A Chain A, Solution Structure Of Mouse Par-3 Pdz2 (Residues 450-558) Length = 111 Back     alignment and structure
>pdb|1N7E|A Chain A, Crystal Structure Of The Sixth Pdz Domain Of Grip1 Length = 97 Back     alignment and structure
>pdb|2OGP|A Chain A, Solution Structure Of The Second Pdz Domain Of Par-3 Length = 97 Back     alignment and structure
>pdb|2KOM|A Chain A, Solution Structure Of Humar Par-3b Pdz2 (Residues 451-549) Length = 121 Back     alignment and structure
>pdb|2AWW|A Chain A, Synapse Associated Protein 97 Pdz2 Domain Variant C378g With C-Terminal Glur-A Peptide Length = 105 Back     alignment and structure
>pdb|2DB5|A Chain A, Solution Structure Of The First Pdz Domain Of Inad-Like Protein Length = 128 Back     alignment and structure
>pdb|3UIT|A Chain A, Overall Structure Of PatjPALS1MALS COMPLEX Length = 265 Back     alignment and structure
>pdb|2OCS|A Chain A, The Crystal Structure Of The First Pdz Domain Of Human Nherf-2 (slc9a3r2) Length = 88 Back     alignment and structure
>pdb|2O2T|A Chain A, The Crystal Structure Of The 1st Pdz Domain Of Mpdz Length = 117 Back     alignment and structure
>pdb|2FE5|A Chain A, The Crystal Structure Of The Second Pdz Domain Of Human Dlg3 Length = 94 Back     alignment and structure
>pdb|1QLC|A Chain A, Solution Structure Of The Second Pdz Domain Of Postsynaptic Density-95 Length = 95 Back     alignment and structure
>pdb|2IWO|A Chain A, 12th Pdz Domain Of Multiple Pdz Domain Protein Mpdz (Casp Target) Length = 120 Back     alignment and structure
>pdb|3K1R|A Chain A, Structure Of Harmonin Npdz1 In Complex With The Sam-Pbm Of Sans Length = 192 Back     alignment and structure
>pdb|2W4F|A Chain A, Crystal Structure Of The First Pdz Domain Of Human Scrib1 Length = 97 Back     alignment and structure
>pdb|3AXA|A Chain A, Crystal Structure Of Afadin Pdz Domain In Complex With The C-Terminal Peptide From Nectin-3 Length = 106 Back     alignment and structure
>pdb|2D92|A Chain A, Solution Structure Of The Fifth Pdz Domain Of Inad-Like Protein Length = 108 Back     alignment and structure
>pdb|1UEW|A Chain A, Solution Structure Of The Forth Pdz Domain Of Human Atrophin-1 Interacting Protein 1 (Kiaa0705 Protein) Length = 114 Back     alignment and structure
>pdb|1X5Q|A Chain A, Solution Structure Of The First Pdz Domain Of Scribble Homolog Protein (Hscrib) Length = 110 Back     alignment and structure
>pdb|3R68|A Chain A, Molecular Analysis Of The Pdz3 Domain Of Pdzk1 Length = 95 Back     alignment and structure
>pdb|1Y74|A Chain A, Solution Structure Of Mlin-2MLIN-7 L27 Domain Complex Length = 57 Back     alignment and structure
>pdb|2I1N|A Chain A, Crystal Structure Of The 1st Pdz Domain Of Human Dlg3 Length = 102 Back     alignment and structure
>pdb|2EEH|A Chain A, Solution Structure Of First Pdz Domain Of Pdz Domain Containing Protein 7 Length = 100 Back     alignment and structure
>pdb|1UIT|A Chain A, Solution Structure Of Rsgi Ruh-006, The Third Pdz Domain Of Hdlg5 (Kiaa0583) Protein [homo Sapiens] Length = 117 Back     alignment and structure
>pdb|2QG1|A Chain A, Crystal Structure Of The 11th Pdz Domain Of Mpdz (Mupp1) Length = 92 Back     alignment and structure
>pdb|3R69|A Chain A, Molecular Analysis Of The Interaction Of The Hdl-Receptor Sr-Bi With The Pdz3 Domain Of Its Adaptor Protein Pdzk1 Length = 89 Back     alignment and structure
>pdb|2OPG|A Chain A, The Crystal Structure Of The 10th Pdz Domain Of Mpdz Length = 98 Back     alignment and structure
>pdb|1UEQ|A Chain A, Solution Structure Of The First Pdz Domain Of Human Atrophin-1 Interacting Protein 1 (Kiaa0705 Protein) Length = 123 Back     alignment and structure
>pdb|2AIN|A Chain A, Solution Structure Of The Af-6 Pdz Domain Complexed With The C-Terminal Peptide From The Bcr Protein Length = 93 Back     alignment and structure
>pdb|1T2M|A Chain A, Solution Structure Of The Pdz Domain Of Af-6 Length = 101 Back     alignment and structure
>pdb|2DAZ|A Chain A, Solution Structure Of The 7th Pdz Domain Of Inad-Like Protein Length = 124 Back     alignment and structure
>pdb|2EDZ|A Chain A, Solution Structures Of The Pdz Domain Of Mus Musculus Pdz Domain-Containing Protein 1 Length = 114 Back     alignment and structure
>pdb|2EHR|A Chain A, Solution Structure Of The Sixth Pdz Domain Of Human Inad- Like Protein Length = 117 Back     alignment and structure
>pdb|3O46|A Chain A, Crystal Structure Of The Pdz Domain Of Mpp7 Length = 93 Back     alignment and structure
>pdb|1XZ9|A Chain A, Structure Of Af-6 Pdz Domain Length = 101 Back     alignment and structure
>pdb|1NF3|C Chain C, Structure Of Cdc42 In A Complex With The Gtpase-Binding Domain Of The Cell Polarity Protein, Par6 Length = 128 Back     alignment and structure
>pdb|1P1D|A Chain A, Structural Insights Into The Inter-Domain Chaperoning Of Tandem Pdz Domains In Glutamate Receptor Interacting Proteins Length = 196 Back     alignment and structure
>pdb|1V62|A Chain A, Solution Structure Of The 3rd Pdz Domain Of Grip2 Length = 117 Back     alignment and structure
>pdb|2HE4|A Chain A, The Crystal Structure Of The Second Pdz Domain Of Human Nherf-2 (Slc9a3r2) Interacting With A Mode 1 Pdz Binding Motif Length = 90 Back     alignment and structure
>pdb|1G9O|A Chain A, First Pdz Domain Of The Human Na+H+ EXCHANGER REGULATORY Factor Length = 91 Back     alignment and structure
>pdb|1WI4|A Chain A, Solution Structure Of The Pdz Domain Of Syntaxin Binding Protein 4 Length = 109 Back     alignment and structure
>pdb|2QBW|A Chain A, The Crystal Structure Of Pdz-Fibronectin Fusion Protein Length = 195 Back     alignment and structure
>pdb|1GQ4|A Chain A, Structural Determinants Of The Nherf Interaction With Beta2ar And Pdgfr Length = 90 Back     alignment and structure
>pdb|1I92|A Chain A, Structural Basis Of The Nherf Pdz1-Cftr Interaction Length = 91 Back     alignment and structure
>pdb|3CH8|A Chain A, The Crystal Structure Of Pdz-Fibronectin Fusion Protein Length = 195 Back     alignment and structure
>pdb|1GQ5|A Chain A, Structural Determinants Of The Nherf Interaction With Beta2- Ar And Pdgfr Length = 91 Back     alignment and structure
>pdb|1MFG|A Chain A, The Structure Of Erbin Pdz Domain Bound To The Carboxy- Terminal Tail Of The Erbb2 Receptor Length = 95 Back     alignment and structure
>pdb|2VPH|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase, Non-Receptor Type 4, Pdz Domain Length = 100 Back     alignment and structure
>pdb|2H3L|A Chain A, Crystal Structure Of Erbin Pdz Length = 103 Back     alignment and structure
>pdb|1RGW|A Chain A, Solution Structure Of Zasp's Pdz Domain Length = 85 Back     alignment and structure
>pdb|1WJL|A Chain A, Solution Structure Of Pdz Domain Of Mouse Cypher Protein Length = 90 Back     alignment and structure
>pdb|4F8K|A Chain A, Molecular Analysis Of The Interaction Between The Prostacyclin Receptor And The First Pdz Domain Of Pdzk1 Length = 109 Back     alignment and structure
>pdb|2DJT|A Chain A, Solution Structures Of The Pdz Domain Of Human Unnamed Protein Product Length = 104 Back     alignment and structure
>pdb|3NGH|A Chain A, Molecular Analysis Of The Interaction Of The Hdl Receptor Sr-Bi With The Adaptor Protein Pdzk1 Length = 106 Back     alignment and structure
>pdb|2D90|A Chain A, Solution Structure Of The Third Pdz Domain Of Pdz Domain Containing Protein 1 Length = 102 Back     alignment and structure
>pdb|1UHP|A Chain A, Solution Structure Of Rsgi Ruh-005, A Pdz Domain In Human Cdna, Kiaa1095 Length = 107 Back     alignment and structure
>pdb|2EDP|A Chain A, Solution Structure Of The Pdz Domain From Human Shroom Family Member 4 Length = 100 Back     alignment and structure
>pdb|2CS5|A Chain A, Solution Structure Of Pdz Domain Of Protein Tyrosine Phosphatase, Non-Receptor Type 4 Length = 119 Back     alignment and structure
>pdb|2FN5|A Chain A, Nmr Structure Of The Neurabin Pdz Domain (502-594) Length = 94 Back     alignment and structure
>pdb|3HVQ|C Chain C, Crystal Structure Of A Complex Between Protein Phosphatase 1 Alpha (Pp1) And The Pp1 Binding And Pdz Domains Of Neurabin Length = 170 Back     alignment and structure
>pdb|2KBS|A Chain A, Solution Structure Of Harmonin Pdz2 In Complex With The Carboxyl Tail Peptide Of Cadherin23 Length = 92 Back     alignment and structure
>pdb|1UF1|A Chain A, Solution Structure Of The Second Pdz Domain Of Human Kiaa1526 Protein Length = 128 Back     alignment and structure
>pdb|1X5N|A Chain A, Solution Structure Of The Second Pdz Domain Of Harmonin Protein Length = 114 Back     alignment and structure
>pdb|2LC6|A Chain A, Solution Structure Of Par-6 Q144cL164C Length = 128 Back     alignment and structure
>pdb|2KOH|A Chain A, Nmr Structure Of Mouse Par3-Pdz3 In Complex With Ve-Cadherin C-Terminus Length = 111 Back     alignment and structure
>pdb|1RY4|A Chain A, Nmr Structure Of The Crib-Pdz Module Of Par-6 Length = 128 Back     alignment and structure
>pdb|2K1Z|A Chain A, Solution Structure Of Par-3 Pdz3 Length = 104 Back     alignment and structure
>pdb|2KRG|A Chain A, Solution Structure Of Human Sodium HYDROGEN EXCHANGE Regulatory Factor 1(150-358) Length = 216 Back     alignment and structure
>pdb|3NFK|A Chain A, Crystal Structure Of The Ptpn4 Pdz Domain Complexed With The C- Terminus Of A Rabies Virus G Protein Length = 107 Back     alignment and structure
>pdb|1UM1|A Chain A, Solution Structure Of Rsgi Ruh-007, Pdz Domain In Human Cdna Length = 110 Back     alignment and structure
>pdb|1WG6|A Chain A, Solution Structure Of Pdz Domain In Protein Xp_110852 Length = 127 Back     alignment and structure
>pdb|1VA8|A Chain A, Solution Structure Of The Pdz Domain Of Pals1 Protein Length = 113 Back     alignment and structure
>pdb|2IWN|A Chain A, 3rd Pdz Domain Of Multiple Pdz Domain Protein Mpdz (Casp Target) Length = 97 Back     alignment and structure
>pdb|2I04|A Chain A, X-Ray Crystal Structure Of Magi-1 Pdz1 Bound To The C- Terminal Peptide Of Hpv18 E6 Length = 85 Back     alignment and structure
>pdb|1RZX|A Chain A, Crystal Structure Of A Par-6 Pdz-Peptide Complex Length = 98 Back     alignment and structure
>pdb|2KJD|A Chain A, Solution Structure Of Extended Pdz2 Domain From Nherf1 (150- 270) Length = 128 Back     alignment and structure
>pdb|2JXO|A Chain A, Structure Of The Second Pdz Domain Of Nherf-1 Length = 98 Back     alignment and structure
>pdb|2KPK|A Chain A, Magi-1 Pdz1 Length = 129 Back     alignment and structure
>pdb|1X8S|A Chain A, Structure Of The Par-6 Pdz Domain With A Pals1 Internal Ligand Length = 102 Back     alignment and structure
>pdb|2OZF|A Chain A, The Crystal Structure Of The 2nd Pdz Domain Of The Human Nherf-1 (Slc9a3r1) Length = 92 Back     alignment and structure
>pdb|1UJU|A Chain A, Solution Structure Of The Fourth Pdz Domain Of Human Scribble (Kiaa0147 Protein) Length = 111 Back     alignment and structure
>pdb|1UJD|A Chain A, Solution Structure Of Rsgi Ruh-003, A Pdz Domain Of Hypothetical Kiaa0559 Protein From Human Cdna Length = 117 Back     alignment and structure
>pdb|2DMZ|A Chain A, Solution Structure Of The Third Pdz Domain Of Human Inad- Like Protein Length = 129 Back     alignment and structure
>pdb|3PDV|A Chain A, Structure Of The Pdlim2 Pdz Domain In Complex With The C-Terminal 6- Peptide Extension Of Ns1 Length = 89 Back     alignment and structure
>pdb|1WF7|A Chain A, Solution Structure Of The Pdz Domain Of Enigma Homologue Protein Length = 103 Back     alignment and structure
>pdb|2PA1|A Chain A, Structure Of The Pdz Domain Of Human Pdlim2 Bound To A C-Terminal Extension From Human Beta-Tropomyosin Length = 87 Back     alignment and structure
>pdb|1ZL8|A Chain A, Nmr Structure Of L27 Heterodimer From C. Elegans Lin-7 And H. Sapiens Lin-2 Scaffold Proteins Length = 53 Back     alignment and structure
>pdb|1WF8|A Chain A, Solution Structure Of The Pdz Domain Of SpinophilinNEURABINII PROTEIN Length = 107 Back     alignment and structure
>pdb|1I16|A Chain A, Structure Of Interleukin 16: Implications For Function, Nmr, 20 Structures Length = 130 Back     alignment and structure
>pdb|2YT8|A Chain A, Solution Structure Of The Pdz Domain Of Amyloid Beta A4 Precursor Protein-Binding Family A Member 3 (Neuron- Specific X11l2 Protein) (Neuronal Munc18-1-Interacting Protein 3) (Mint-3) (Adapter Protein X11gamma) Length = 94 Back     alignment and structure
>pdb|1IHJ|A Chain A, Crystal Structure Of The N-Terminal Pdz Domain Of Inad In Complex With A Norpa C-Terminal Peptide Length = 98 Back     alignment and structure
>pdb|2Q3G|A Chain A, Structure Of The Pdz Domain Of Human Pdlim7 Bound To A C- Terminal Extension From Human Beta-Tropomyosin Length = 89 Back     alignment and structure
>pdb|2G5M|B Chain B, Spinophilin Pdz Domain Length = 113 Back     alignment and structure
>pdb|1X5R|A Chain A, Solution Structure Of The Fourth Pdz Domain Of Glutamate Receptor Interacting Protein 2 Length = 112 Back     alignment and structure
>pdb|1V5L|A Chain A, Solution Structure Of Pdz Domain Of Mouse Alpha-Actinin-2 Associated Lim Protein Length = 103 Back     alignment and structure
>pdb|2FCF|A Chain A, The Crystal Structure Of The 7th Pdz Domain Of Mpdz (Mupp-1) Length = 103 Back     alignment and structure
>pdb|2UZC|A Chain A, Structure Of Human Pdlim5 In Complex With The C-Terminal Peptide Of Human Alpha-Actinin-1 Length = 88 Back     alignment and structure
>pdb|2IWQ|A Chain A, 7th Pdz Domain Of Multiple Pdz Domain Protein Mpdz Length = 123 Back     alignment and structure
>pdb|2OMJ|A Chain A, Solution Structure Of Larg Pdz Domain Length = 89 Back     alignment and structure
>pdb|3EGH|C Chain C, Crystal Structure Of A Complex Between Protein Phosphatase 1 Alpha (Pp1), The Pp1 Binding And Pdz Domains Of Spinophilin And The Small Natural Molecular Toxin Nodularin-R Length = 170 Back     alignment and structure
>pdb|3EGG|C Chain C, Crystal Structure Of A Complex Between Protein Phosphatase 1 Alpha (Pp1) And The Pp1 Binding And Pdz Domains Of Spinophilin Length = 170 Back     alignment and structure
>pdb|2KV8|A Chain A, Solution Structure Ofrgs12 Pdz Domain Length = 83 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query172
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 2e-39
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 1e-37
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 1e-36
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 3e-36
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 3e-36
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 4e-36
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 5e-36
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 6e-36
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 1e-35
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 3e-35
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 3e-34
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 4e-34
2djt_A104 Unnamed protein product; PDZ domain, structural ge 4e-34
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 4e-34
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 5e-34
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 5e-33
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 9e-34
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 2e-33
2opg_A98 Multiple PDZ domain protein; structural protein, s 2e-33
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 2e-33
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 2e-33
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 3e-33
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 3e-33
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 3e-33
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 4e-33
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 5e-33
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 6e-33
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 8e-33
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 9e-33
2eeh_A100 PDZ domain-containing protein 7; structural genomi 1e-32
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 1e-32
2fne_A117 Multiple PDZ domain protein; structural protein, s 1e-32
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 1e-32
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 1e-32
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 2e-32
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 2e-32
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 2e-32
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 3e-32
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 3e-32
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 3e-32
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 4e-32
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 4e-32
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 4e-32
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 5e-32
2byg_A117 Channel associated protein of synapse-110; DLG2, P 7e-32
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 8e-32
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 1e-31
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 1e-31
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 2e-31
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 2e-31
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 3e-31
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 3e-31
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 3e-31
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 9e-27
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 3e-31
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 4e-31
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 4e-31
2awx_A105 Synapse associated protein 97; membrane protein, s 4e-31
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 4e-31
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 5e-31
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 7e-31
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 7e-31
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 1e-30
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 1e-30
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 1e-30
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 3e-27
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 1e-30
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 2e-30
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 2e-30
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 3e-30
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 3e-30
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 4e-30
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 4e-30
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 5e-30
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 8e-30
2o2t_A117 Multiple PDZ domain protein; structural protein, s 9e-30
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 9e-30
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 1e-29
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 2e-29
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 2e-29
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 2e-29
3k1r_A192 Harmonin; protein-protein complex, alternative spl 3e-29
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 3e-29
2eei_A106 PDZ domain-containing protein 1; regulatory factor 4e-29
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 4e-29
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 5e-29
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 7e-29
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 9e-29
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 1e-28
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 2e-28
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 2e-28
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 2e-28
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 2e-28
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 3e-28
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 3e-28
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 3e-28
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 4e-28
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 4e-28
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 5e-28
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 5e-28
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 6e-28
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 9e-28
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 1e-27
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 1e-27
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 2e-27
2d90_A102 PDZ domain containing protein 1; structural genomi 2e-27
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 2e-27
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 3e-27
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 5e-27
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 5e-27
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 5e-27
2v90_A96 PDZ domain-containing protein 3; membrane, protein 5e-27
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 5e-27
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 1e-26
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 2e-26
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 3e-26
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 3e-26
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 3e-26
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 4e-26
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 4e-26
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 1e-25
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 1e-25
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 1e-25
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 6e-24
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 4e-12
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 1e-25
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 2e-25
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 3e-25
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 4e-25
2krg_A 216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 4e-25
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 5e-25
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 5e-25
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 1e-24
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 2e-24
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 6e-21
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 3e-24
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 3e-24
2ego_A96 General receptor for phosphoinositides 1- associat 3e-24
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 4e-24
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 5e-24
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 6e-24
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 6e-24
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 9e-24
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 1e-23
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 2e-23
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 5e-23
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 6e-23
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 2e-22
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 8e-11
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 4e-22
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 6e-22
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 9e-22
3khf_A99 Microtubule-associated serine/threonine-protein ki 9e-22
2eaq_A90 LIM domain only protein 7; conserved hypothetical 1e-21
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 2e-21
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 2e-21
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 2e-20
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 4e-19
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 4e-18
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 4e-18
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 2e-17
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 3e-17
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 4e-16
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 5e-17
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 7e-16
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 8e-04
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 2e-15
3uit_A265 INAD-like protein, maguk P55 subfamily member 5, L 2e-14
3lra_A254 Disks large homolog 1, maguk P55 subfamily member 4e-13
1zl8_A53 LIN-7; heterodimer, alpha helix, scaffold, assembl 2e-12
2yub_A118 LIMK-2, LIM domain kinase 2; PDZ domain, structura 3e-10
3k50_A 403 Putative S41 protease; structural genomics, joint 5e-05
1fc6_A 388 Photosystem II D1 protease; D1 C-terminal processi 3e-04
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 93 Back     alignment and structure
 Score =  128 bits (323), Expect = 2e-39
 Identities = 75/85 (88%), Positives = 77/85 (90%)

Query: 64  PRVVELPKTDEGLGFNVMGGKEQNSPIYISRIIPGGVADRHGGLKRGDQLLSVNGVSVEG 123
             VVELPKTDEGLGFN+MGGKEQNSPIYISR+IPGGVADRHGGLKRGDQLLSVNGVSVEG
Sbjct: 6   SGVVELPKTDEGLGFNIMGGKEQNSPIYISRVIPGGVADRHGGLKRGDQLLSVNGVSVEG 65

Query: 124 EDHGKAVELLKQAQRSVKLVVRYTP 148
           E H KAVELLK AQ SVKLVVR  P
Sbjct: 66  EQHEKAVELLKAAQGSVKLVVRSGP 90
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Length = 104 Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Length = 90 Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Length = 112 Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Length = 119 Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Length = 97 Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 105 Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Length = 90 Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Length = 97 Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 98 Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Length = 96 Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Length = 102 Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Length = 101 Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Length = 125 Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 101 Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Length = 120 Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} Length = 93 Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Length = 85 Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 130 Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Length = 118 Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Length = 114 Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Length = 113 Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Length = 97 Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Length = 111 Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Length = 97 Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Length = 94 Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 114 Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 119 Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 128 Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Length = 106 Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Length = 123 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 123 Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Length = 118 Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 104 Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Length = 105 Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Length = 85 Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Length = 129 Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Length = 108 Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Length = 112 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Length = 98 Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Length = 92 Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Length = 114 Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Length = 117 Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Length = 95 Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 127 Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 108 Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} PDB: 3nfl_A 2vph_A Length = 107 Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 119 Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A Length = 192 Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 122 Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Length = 107 Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Length = 91 Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} PDB: 3r69_A* Length = 95 Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 129 Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Length = 88 Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Length = 90 Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Length = 128 Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Length = 109 Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Length = 96 Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Length = 87 Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Length = 124 Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Length = 106 Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Length = 89 Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 102 Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Length = 91 Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Length = 170 Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Length = 98 Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 94 Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Length = 96 Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Length = 88 Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Length = 127 Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Length = 92 Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Length = 263 Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 124 Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Length = 97 Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Length = 91 Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Length = 131 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Length = 103 Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Length = 108 Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Length = 93 Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Length = 216 Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Length = 88 Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Length = 95 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Length = 82 Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 126 Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Length = 96 Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Length = 95 Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Length = 81 Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Length = 114 Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} Length = 106 Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Length = 109 Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Length = 132 Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Length = 100 Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Length = 104 Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Length = 109 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Length = 166 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Length = 166 Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Length = 139 Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Length = 99 Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Length = 90 Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 90 Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Length = 88 Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 126 Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Length = 391 Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 96 Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Length = 94 Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388 Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388 Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Length = 468 Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Length = 195 Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Length = 195 Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Length = 113 Back     alignment and structure
>3uit_A INAD-like protein, maguk P55 subfamily member 5, LIN-7 homolog B; L27 domain, cell polarization, cell adhesion; 2.05A {Mus musculus} PDB: 1y76_A 1y76_B 1y74_A Length = 265 Back     alignment and structure
>3lra_A Disks large homolog 1, maguk P55 subfamily member protein LIN-7 homolog C; tripartite complex, L27 tetramer, cell junction; 2.95A {Homo sapiens} PDB: 1rso_A Length = 254 Back     alignment and structure
>1zl8_A LIN-7; heterodimer, alpha helix, scaffold, assembly, specifici signaling, protein binding; NMR {Caenorhabditis elegans} SCOP: a.194.1.1 Length = 53 Back     alignment and structure
>2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Length = 403 Back     alignment and structure
>1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A Length = 388 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query172
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 99.77
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 99.75
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 99.74
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 99.73
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 99.72
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 99.72
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 99.72
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 99.72
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 99.72
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 99.72
2fne_A117 Multiple PDZ domain protein; structural protein, s 99.72
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.71
2v90_A96 PDZ domain-containing protein 3; membrane, protein 99.71
2byg_A117 Channel associated protein of synapse-110; DLG2, P 99.71
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 99.71
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 99.71
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 99.71
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 99.71
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 99.71
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 99.71
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 99.7
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 99.7
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 99.7
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 99.7
2awx_A105 Synapse associated protein 97; membrane protein, s 99.7
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 99.7
4e34_A87 Golgi-associated PDZ and coiled-coil motif-contai 99.7
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 99.7
2ego_A96 General receptor for phosphoinositides 1- associat 99.7
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 99.7
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 99.7
2opg_A98 Multiple PDZ domain protein; structural protein, s 99.7
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 99.7
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 99.7
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 99.7
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 99.7
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 99.69
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 99.69
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 99.69
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 99.69
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 99.69
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 99.68
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 99.68
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 99.68
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 99.68
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 99.68
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 99.68
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 99.68
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 99.68
2djt_A104 Unnamed protein product; PDZ domain, structural ge 99.68
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 99.68
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 99.68
2d90_A102 PDZ domain containing protein 1; structural genomi 99.68
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 99.67
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 99.67
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 99.67
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 99.67
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 99.67
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 99.67
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 99.66
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 99.66
4amh_A106 Disks large homolog 1; permutation, protein foldin 99.66
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 99.66
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 99.66
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 99.66
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 99.66
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 99.66
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 99.66
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 99.66
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 99.66
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 99.66
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 99.65
2o2t_A117 Multiple PDZ domain protein; structural protein, s 99.65
2eei_A106 PDZ domain-containing protein 1; regulatory factor 99.65
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 99.65
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 99.65
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 99.65
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 99.64
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 99.64
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 99.64
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 99.64
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 99.64
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 99.64
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 99.64
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 99.64
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 99.64
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 99.64
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 99.63
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 99.63
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 99.63
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 99.63
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 99.63
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 99.63
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 99.63
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 99.63
2eeh_A100 PDZ domain-containing protein 7; structural genomi 99.63
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 99.62
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 99.62
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 99.62
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 99.62
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 99.62
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 99.61
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 99.61
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 99.61
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 99.61
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 99.61
3k1r_A192 Harmonin; protein-protein complex, alternative spl 99.6
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 99.6
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.6
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 99.6
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 99.6
3khf_A99 Microtubule-associated serine/threonine-protein ki 99.59
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 99.59
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 99.59
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 99.59
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 99.59
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 99.59
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 99.58
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 99.58
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 99.58
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 99.58
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.58
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 99.58
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 99.57
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 99.57
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 99.57
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 99.57
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 99.57
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 99.56
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 99.56
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 99.56
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 99.55
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 99.55
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 99.55
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 99.55
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 99.55
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 99.54
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 99.54
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 99.53
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 99.52
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 99.52
3sfj_A104 TAX1-binding protein 3; PDZ:peptide complex, signa 99.51
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 99.51
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 99.51
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 99.26
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 99.5
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 99.5
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 99.5
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 99.49
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 99.48
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 99.48
3qik_A101 Phosphatidylinositol 3,4,5-trisphosphate-dependen 99.46
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 99.44
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 99.44
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 99.43
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 99.43
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 99.43
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 99.42
2eaq_A90 LIM domain only protein 7; conserved hypothetical 99.4
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 99.4
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 99.37
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 99.36
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 99.36
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 99.34
2yub_A118 LIMK-2, LIM domain kinase 2; PDZ domain, structura 99.33
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 99.27
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 99.27
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 99.19
2l97_A134 HTRA, putative serine protease; HTRA-PDZ, protein 98.92
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mito 98.88
2kjp_A91 Uncharacterized protein YLBL; mixed alpha-beta pro 98.84
3i18_A100 LMO2051 protein; alpha-beta protein, structural ge 98.84
2kl1_A94 YLBL protein; structure genomics, structural genom 98.83
1fc6_A 388 Photosystem II D1 protease; D1 C-terminal processi 98.82
3rle_A 209 Golgi reassembly-stacking protein 2; PDZ, tether, 98.81
2i6v_A87 General secretion pathway protein C; EPSC, GSPC, P 98.78
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 98.76
3id1_A95 Regulator of sigma E protease; hydrolase, cell inn 98.75
2p3w_A112 Probable serine protease HTRA3; PDZ domain, phage 98.74
2zpm_A91 Regulator of sigma E protease; metalloproteinase, 98.72
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 98.7
3stj_A345 Protease DEGQ; serine protease, PDZ domain, protea 98.66
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 98.64
3k50_A 403 Putative S41 protease; structural genomics, joint 98.64
2i4s_A105 General secretion pathway protein C; EPSC, GSPC, P 98.62
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 98.62
4fgm_A597 Aminopeptidase N family protein; structural genomi 98.55
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 98.53
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 98.48
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 98.45
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 98.44
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 98.44
3qo6_A348 Protease DO-like 1, chloroplastic; protease, HTRA, 98.43
2hga_A125 Conserved protein MTH1368; GFT structural genomics 98.43
1zl8_A53 LIN-7; heterodimer, alpha helix, scaffold, assembl 98.41
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 98.38
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 98.27
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 98.1
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 98.05
1k32_A 1045 Tricorn protease; protein degradation, substrate g 97.94
4fln_A 539 Protease DO-like 2, chloroplastic; protease, DEG, 97.67
4fln_A539 Protease DO-like 2, chloroplastic; protease, DEG, 97.05
1vf6_A83 PALS-1, PALS1-associated tight junction protein; L 91.01
1rso_B56 MLIN-2/CASK, peripheral plasma membrane protein CA 84.02
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Back     alignment and structure
Probab=99.77  E-value=6.3e-18  Score=108.26  Aligned_cols=77  Identities=23%  Similarity=0.418  Sum_probs=70.5

Q ss_pred             CCCEEEEEecCC-CCCCeEEeccCCCCCCeEEEeecCCChhhhcCCCCCCCEEEEECCeeCCCCCHHHHHHHHHhCCCeE
Q psy12578         62 AHPRVVELPKTD-EGLGFNVMGGKEQNSPIYISRIIPGGVADRHGGLKRGDQLLSVNGVSVEGEDHGKAVELLKQAQRSV  140 (172)
Q Consensus        62 ~~~~~v~l~~~~-~g~G~~l~~~~~~~~~~~V~~v~~g~~A~~~G~L~~GD~I~~Vng~~v~~~~~~~~~~~l~~~~~~v  140 (172)
                      ..+|+|+|+|+. ++|||+++++       .|..+.+++||+++| |+.||+|++|||+++.+++|++++++|+..+..|
T Consensus         3 ~~~r~v~l~k~~~g~~Gf~i~~g-------~I~~v~~gspA~~aG-l~~GD~Il~VNG~~v~~~~~~evv~llr~~g~~V   74 (82)
T 1r6j_A            3 MDPRTITMHKDSTGHVGFIFKNG-------KITSIVKDSSAARNG-LLTEHNICEINGQNVIGLKDSQIADILSTSGTVV   74 (82)
T ss_dssp             TCCEEEEEECCTTSCCCEEEETT-------EEEEECTTSHHHHHT-CCSSEEEEEETTEECTTCCHHHHHHHHHHSCSEE
T ss_pred             CceEEEEEEECCCCCeEEEEECC-------EEEEecCCCHHHHcC-CCCCCEEEEECCEEcCCCCHHHHHHHHhcCCCEE
Confidence            468999999987 5799999864       478999999999999 9999999999999999999999999999888899


Q ss_pred             EEEEEE
Q psy12578        141 KLVVRY  146 (172)
Q Consensus       141 ~l~v~r  146 (172)
                      +|+|..
T Consensus        75 ~L~v~p   80 (82)
T 1r6j_A           75 TITIMP   80 (82)
T ss_dssp             EEEEEE
T ss_pred             EEEEEe
Confidence            999864
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.36.1.1 PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} SCOP: b.36.1.0 Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Back     alignment and structure
>4e34_A Golgi-associated PDZ and coiled-coil motif-contai protein; PDZ-peptide complex, protein transport-inhibitor complex; 1.40A {Homo sapiens} PDB: 4e35_A Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} SCOP: b.36.1.0 PDB: 3r69_A* Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>4amh_A Disks large homolog 1; permutation, protein folding, structural protein; 2.30A {Homo sapiens} Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} SCOP: b.36.1.1 PDB: 3nfl_A 2vph_A Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} SCOP: b.36.1.0 Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A 2lsr_A Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>3sfj_A TAX1-binding protein 3; PDZ:peptide complex, signaling protein-inhibitor complex; 1.24A {Homo sapiens} PDB: 3dj3_A Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3qik_A Phosphatidylinositol 3,4,5-trisphosphate-dependen exchanger 1 protein; PDZ domain, structural genomics consortium, SGC, hydrolase R; 2.29A {Homo sapiens} Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Back     alignment and structure
>2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} Back     alignment and structure
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Back     alignment and structure
>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Back     alignment and structure
>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Back     alignment and structure
>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Back     alignment and structure
>1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A Back     alignment and structure
>2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A Back     alignment and structure
>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Back     alignment and structure
>2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Back     alignment and structure
>3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Back     alignment and structure
>4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Back     alignment and structure
>1zl8_A LIN-7; heterodimer, alpha helix, scaffold, assembly, specifici signaling, protein binding; NMR {Caenorhabditis elegans} SCOP: a.194.1.1 Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure
>1vf6_A PALS-1, PALS1-associated tight junction protein; L27 domain, heterodimer, four-helical bundle, coiled-coil, hydrophobic packing interactions; 2.10A {Homo sapiens} SCOP: a.194.1.1 Back     alignment and structure
>1rso_B MLIN-2/CASK, peripheral plasma membrane protein CASK; L27 domain, scaffold protein, protein assembly, cell polarity; NMR {Rattus norvegicus} SCOP: a.194.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 172
d1qava_90 b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [Ta 2e-27
d1n7ea_95 b.36.1.1 (A:) Glutamate receptor-interacting prote 1e-26
d1tp5a1102 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat 2e-25
d1wfva_103 b.36.1.1 (A:) Membrane associated guanylate kinase 4e-25
d1ueqa_123 b.36.1.1 (A:) Membrane associated guanylate kinase 6e-25
d1whaa_105 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 7e-25
d2fnea188 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein 1e-24
d1i16a_130 b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) 2e-24
d1x6da1107 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sap 2e-23
d1wf8a194 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens 2e-23
d1uepa_103 b.36.1.1 (A:) Membrane associated guanylate kinase 3e-23
d2fcfa196 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein 3e-23
d1uita_117 b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Huma 5e-23
d1um1a_110 b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human 5e-23
d1g9oa_91 b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, 6e-23
d1rgra_93 b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus 8e-23
d1ujda_117 b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human 1e-22
d2fe5a192 b.36.1.1 (A:223-314) Synapse-associated protein 10 1e-22
d1ufxa_103 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 2e-22
d1v62a_117 b.36.1.1 (A:) Glutamate receptor interacting prote 2e-22
d1ihja_94 b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanoga 3e-22
d1ueza_101 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 3e-22
d1rgwa_85 b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo 5e-22
d2cssa1108 b.36.1.1 (A:8-115) Regulating synaptic membrane ex 9e-22
d1wi2a_104 b.36.1.1 (A:) PDZ domain containing protein 11, Pd 1e-21
d1uhpa_107 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 2e-21
d2csja1104 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tj 2e-21
d1kwaa_88 b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [Ta 2e-21
d1uf1a_128 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 2e-21
d2cs5a1106 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase no 3e-21
d1t2ma192 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [Ta 3e-21
d1v6ba_118 b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxI 4e-21
d1ozia_99 b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus muscu 6e-21
d1x5ra199 b.36.1.1 (A:8-106) Glutamate receptor interacting 1e-20
d1p1da299 b.36.1.1 (A:115-213) Glutamate receptor interactin 1e-20
d1wi4a196 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mou 2e-20
d1v5qa_122 b.36.1.1 (A:) Glutamate receptor interacting prote 3e-20
d1rzxa_98 b.36.1.1 (A:) GTPase-binding domain of the cell po 3e-20
d1uewa_114 b.36.1.1 (A:) Membrane associated guanylate kinase 7e-20
d1x5qa197 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Hom 8e-20
d2f5ya177 b.36.1.1 (A:19-95) Regulator of G-protein signalin 9e-20
d1va8a1100 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {M 1e-19
d1ujua_111 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 2e-19
d1vb7a_94 b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus 2e-19
d1x5na1101 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) 3e-19
d2h3la1103 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) 4e-19
d1x45a185 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protei 5e-19
d2f0aa192 b.36.1.1 (A:251-342) Segment polarity protein dish 1e-18
d1m5za_91 b.36.1.1 (A:) Glutamate receptor interacting prote 1e-18
d1wh1a_124 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 2e-18
d1wg6a_127 b.36.1.1 (A:) Partitioning-defective 3-like protei 3e-18
d1v5la_103 b.36.1.1 (A:) Alpha-actinin-2 associated LIM prote 5e-18
d1wf7a_103 b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus muscu 5e-18
d1y7na179 b.36.1.1 (A:12-90) Amyloid beta A4 precursor prote 9e-18
d1ujva_96 b.36.1.1 (A:) Membrane associated guanylate kinase 1e-17
d1y74a157 a.194.1.1 (A:17-73) Lin-7 {Mouse (Mus musculus) [T 1e-17
d1q3oa_104 b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norv 2e-17
d1qaua_112 b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS 2e-17
d1w9ea185 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapie 5e-17
d1vaea_111 b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [T 9e-17
d1wifa_126 b.36.1.1 (A:) hypothetical PDZ domain containing p 2e-16
d1zl8a150 a.194.1.1 (A:4-53) Lin-7 {Caenorhabditis elegans [ 1e-13
d1r6ja_82 b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [Ta 2e-13
d1fc6a392 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal 1e-08
d2z9ia188 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium 5e-06
d1ky9b288 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-t 1e-04
d1lcya1100 b.36.1.4 (A:226-325) Mitochondrial serine protease 0.002
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 Back     information, alignment and structure

class: All beta proteins
fold: PDZ domain-like
superfamily: PDZ domain-like
family: PDZ domain
domain: Syntrophin
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 96.5 bits (240), Expect = 2e-27
 Identities = 36/88 (40%), Positives = 49/88 (55%), Gaps = 1/88 (1%)

Query: 60  GHAHPRVVELPKTD-EGLGFNVMGGKEQNSPIYISRIIPGGVADRHGGLKRGDQLLSVNG 118
           G    R V + K D  GLG ++ GG+E   PI IS+I  G  AD+   L  GD +LSVNG
Sbjct: 1   GSLQRRRVTVRKADAGGLGISIKGGRENKMPILISKIFKGLAADQTEALFVGDAILSVNG 60

Query: 119 VSVEGEDHGKAVELLKQAQRSVKLVVRY 146
             +    H +AV+ LK+  + V L V+Y
Sbjct: 61  EDLSSATHDEAVQALKKTGKEVVLEVKY 88
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 95 Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 102 Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 123 Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 94 Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Length = 118 Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 99 Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 122 Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 98 Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 100 Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 92 Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 91 Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1y74a1 a.194.1.1 (A:17-73) Lin-7 {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 104 Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 112 Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 Back     information, alignment and structure
>d1zl8a1 a.194.1.1 (A:4-53) Lin-7 {Caenorhabditis elegans [TaxId: 6239]} Length = 50 Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Length = 92 Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 88 Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Length = 88 Back     information, alignment and structure
>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query172
d1tp5a1102 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 99.85
d1rgwa_85 Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [Tax 99.83
d2fe5a192 Synapse-associated protein 102 {Human (Homo sapien 99.83
d1rgra_93 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 99.83
d1qava_90 Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} 99.83
d1g9oa_91 Na+/H+ exchanger regulatory factor, NHERF {Human ( 99.82
d1n7ea_95 Glutamate receptor-interacting protein 1, GRIP1 {R 99.82
d2fcfa196 Multiple PDZ domain protein {Human (Homo sapiens) 99.82
d1ozia_99 Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 1 99.82
d1whaa_105 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.81
d1uhpa_107 Hypothetical protein KIAA1095 {Human (Homo sapiens 99.81
d1m5za_91 Glutamate receptor interacting protein {Rat (Rattu 99.81
d1um1a_110 Hypothetical protein KIAA1849 {Human (Homo sapiens 99.81
d1wi2a_104 PDZ domain containing protein 11, Pdzk11 {Mouse (M 99.8
d2f5ya177 Regulator of G-protein signaling 3, RGS3 {Human (H 99.8
d1wf8a194 Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} 99.79
d1ihja_94 Inad {Fruit fly (Drosophila melanogaster) [TaxId: 99.79
d1uepa_103 Membrane associated guanylate kinase inverted-2 (M 99.79
d2fnea188 Multiple PDZ domain protein {Human (Homo sapiens) 99.79
d1wfva_103 Membrane associated guanylate kinase inverted-2 (M 99.79
d1r6ja_82 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.78
d1uita_117 Discs large 5 protein KIAA0583 {Human (Homo sapien 99.78
d1x5qa197 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.78
d1kwaa_88 Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} 99.78
d1t2ma192 Afadin {Human (Homo sapiens) [TaxId: 9606]} 99.78
d1vb7a_94 PDZ-LIM protein mystique {Mouse (Mus musculus) [Ta 99.78
d1i16a_130 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 99.78
d1uf1a_128 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.77
d1ueqa_123 Membrane associated guanylate kinase inverted-2 (M 99.77
d1w9ea185 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.76
d1q3oa_104 Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId 99.76
d1ujua_111 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.76
d1uewa_114 Membrane associated guanylate kinase inverted-2 (M 99.75
d1rzxa_98 GTPase-binding domain of the cell polarity protein 99.75
d1vaea_111 Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} 99.75
d2f0aa192 Segment polarity protein dishevelled homolog Dvl-2 99.75
d1p1da299 Glutamate receptor interacting protein {Rat (Rattu 99.75
d1x6da1107 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 99.75
d1x5na1101 Harmonin {Human (Homo sapiens) [TaxId: 9606]} 99.74
d1ueza_101 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.73
d1v62a_117 Glutamate receptor interacting protein 2, GRIP2 (K 99.73
d1wi4a196 Syntaxin binding protein 4 {Mouse (Mus musculus) [ 99.73
d1wf7a_103 Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 1 99.73
d1v5la_103 Alpha-actinin-2 associated LIM protein {Mouse (Mus 99.73
d1qaua_112 Neuronal nitric oxide synthase, NNOS {Rat (Rattus 99.72
d2cs5a1106 Tyrosine-protein phosphatase non-receptor type 4, 99.72
d1va8a1100 Maguk p55 subfamily member 5 {Mouse (Mus musculus) 99.71
d2csja1104 Tight junction protein ZO-2, Tjp2 {Mouse (Mus musc 99.7
d1y7na179 Amyloid beta A4 precursor protein-binding family A 99.7
d2h3la1103 Erbin {Human (Homo sapiens) [TaxId: 9606]} 99.7
d1ujda_117 Hypothetical protein KIAA0559 {Human (Homo sapiens 99.7
d1v6ba_118 Harmonin {Mouse (Mus musculus) [TaxId: 10090]} 99.69
d1v5qa_122 Glutamate receptor interacting protein {Mouse (Mus 99.68
d1x45a185 Amyloid beta A4 precursor protein-binding family A 99.68
d1x5ra199 Glutamate receptor interacting protein 2, GRIP2 (K 99.68
d1ufxa_103 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.67
d2cssa1108 Regulating synaptic membrane exocytosis protein 1, 99.67
d1wifa_126 hypothetical PDZ domain containing protein Uqcrc2 99.65
d1wg6a_127 Partitioning-defective 3-like protein, PAR3-L (RIK 99.65
d1ujva_96 Membrane associated guanylate kinase inverted-2 (M 99.6
d1fc6a392 Photosystem II D1 C-terminal processing protease { 99.6
d1wh1a_124 Hypothetical protein KIAA1095 {Human (Homo sapiens 99.53
d2z9ia188 Protease PepD {Mycobacterium tuberculosis [TaxId: 99.27
d1ky9b288 Protease Do (DegP, HtrA), C-terminal domains {Esch 99.22
d1k32a191 Tricorn protease {Archaeon Thermoplasma acidophilu 99.06
d1lcya1100 Mitochondrial serine protease HtrA2 {Human (Homo s 99.04
d1ky9a194 Protease Do (DegP, HtrA), C-terminal domains {Esch 98.85
d1sota199 Stress sensor protease DegS, C-terminal domain {Es 98.82
d2hgaa1103 Uncharacterized protein MTH1368 {Methanobacterium 98.74
d2i6va187 General secretion pathway protein C, EpsC {Vibrio 98.74
d1y74a157 Lin-7 {Mouse (Mus musculus) [TaxId: 10090]} 98.7
d1zl8a150 Lin-7 {Caenorhabditis elegans [TaxId: 6239]} 98.41
d1vf6a_58 Associated tight junction protein Pals-1 {Human (H 94.51
d1rsoa_60 Presynaptic protein sap97 {Rat (Rattus norvegicus) 85.41
d1y74b150 Peripheral plasma membrane protein cask {Human (Ho 85.41
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: All beta proteins
fold: PDZ domain-like
superfamily: PDZ domain-like
family: PDZ domain
domain: Synaptic protein PSD-95
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=99.85  E-value=4.6e-21  Score=126.42  Aligned_cols=93  Identities=39%  Similarity=0.726  Sum_probs=84.5

Q ss_pred             CCCCEEEEEecCCCCCCeEEeccCCCCCCeEEEeecCCChhhhcCCCCCCCEEEEECCeeCCCCCHHHHHHHHHhCCCeE
Q psy12578         61 HAHPRVVELPKTDEGLGFNVMGGKEQNSPIYISRIIPGGVADRHGGLKRGDQLLSVNGVSVEGEDHGKAVELLKQAQRSV  140 (172)
Q Consensus        61 ~~~~~~v~l~~~~~g~G~~l~~~~~~~~~~~V~~v~~g~~A~~~G~L~~GD~I~~Vng~~v~~~~~~~~~~~l~~~~~~v  140 (172)
                      +..+|.|+|.|++.||||+|.++.+ ..++||..|.++|+|+++|.|++||+|++|||.++.+++|++++.+|+.+++.+
T Consensus         7 ~~~~r~V~l~k~~~glG~~i~~~~~-~~gv~V~~v~~gs~A~~~G~l~~GD~Il~INg~~v~~~~~~ev~~~l~~~~~~v   85 (102)
T d1tp5a1           7 PREPRRIVIHRGSTGLGFNIVGGED-GEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTV   85 (102)
T ss_dssp             CCSCEEEEEECTTSCCCEEEEECGG-GCCEEEEEECTTSHHHHHSCCCTTEEEEEETTEECTTCCHHHHHHHHHTSCSEE
T ss_pred             CCCCEEEEEEeCCCcccEEEEeccC-CCCEEEEEecCCchHHHcCCCcccCEEEEECCeEcCCCCHHHHHHHHHcCCCeE
Confidence            4578999999999999999998755 457999999999999999999999999999999999999999999999999899


Q ss_pred             EEEEEECCchhHHH
Q psy12578        141 KLVVRYTPKVLEEM  154 (172)
Q Consensus       141 ~l~v~r~~~~~~~~  154 (172)
                      +|+|.+.+..+..+
T Consensus        86 ~L~v~~~~~~~~~~   99 (102)
T d1tp5a1          86 TIIAQYKPEEYSRF   99 (102)
T ss_dssp             EEEEEECHHHHHTT
T ss_pred             EEEEEECCcccccc
Confidence            99999988666543
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky9a1 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1y74a1 a.194.1.1 (A:17-73) Lin-7 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zl8a1 a.194.1.1 (A:4-53) Lin-7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1vf6a_ a.194.1.1 (A:) Associated tight junction protein Pals-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rsoa_ a.194.1.1 (A:) Presynaptic protein sap97 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1y74b1 a.194.1.1 (B:83-132) Peripheral plasma membrane protein cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure