Psyllid ID: psy12647


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410
MIRIHIGPSVILMLMIMTRYSLPCVDFIQVHLRLHSGERRFPCEYCSLLVYPVLILFRFIFVCTQGSADSHKHHLKDHVNKIHLHPKTFSCNSCGQTWLGYTSWKQHVAACREKRRKETFPCKRCDERFSTRDGLESFTFSLRLFCLYFPQELISHSSYHGGEERRYVCNHMQCTRRFHSASLLARHVSTHAIQYTCHMCGHMFTCKRRLTQHLARLHTGSLSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKGLESFTFSLRLFCLYFPQELISHSSYHGGEERRYVCNHMQCTRRFHSASLLARHVSTHAIQYTCHMCGHMFTCKRRLTQHLARLHTGSLSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKVCTTPSPQPQHLDVL
cccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccc
ccEEcccccccEccccccEEEcccccHHHEHHHHcccccccccccccccHHEEEcccccccEcccccEEccccHHHHHHHHHcccccccccccccccEccccHHHHHccccEEcccccccccccccccEEccccccccccccccccEccccHHHHHHHHccccccccEcccccccccEcccccHHHHHHHcccccEcccccccEccccHHHHHHHHHcccccccccccccccEccccHHHHHHHHcccccccccccccccEccccccccccccccccEccccHHHHHHHHccccccccEcccccccccEccccHHHHHHHHcccccEcccccccEccccHHHHHHHHHcccccccccccccccEccccHHHHHHHHcccccccccccccccEccccHHHHHHHHcccccc
MIRIHIGPSVILMLMIMTryslpcvdFIQVHLRlhsgerrfpceycsllvypVLILFRFIFVctqgsadshkhhLKDHVnkihlhpktfscnscgqtwlgYTSWKQHVAACREKRrketfpckrcderfstrdglESFTFSLRLFCLYfpqelishssyhggeerryvcnhmqctrrFHSASLLARHVSTHAIQYtchmcghmftcKRRLTQHLARLhtgslsypctqcpgkfysAYELRQHVrqhtderpfpcpvcqrtfrrkglesFTFSLRLFCLYfpqelishssyhggeerryvcnhmqctrrFHSASLLARHVSTHAIQYtchmcghmftcKRRLTQHLARLhtgslsypctqcpgkfysAYELRQHVrqhtderpfpcpvcqrtfrrkvcttpspqpqhldvl
MIRIHIGPSVILMLMIMTRYSLPCVDFIQVHLRLHSGERRFPCEYCSLLVYPVLILFRFIFVCTQGSADSHKHHLKDHVNKIHLHPKTFSCNSCGQTWLGYTSWKQHVAACRekrrketfpckrcderfstrdglESFTFSLRLFCLYFPQELISHSSYHGGEERRYVCNHMQCTRRFHSASLLARHVSTHAIQYTCHMCGHMFTCKRRLTQHLARLHTGSLSYPCTQCPGKFYSAYELRQHVrqhtderpfpcpVCQRTFRRKGLESFTFSLRLFCLYFPQELISHSSYHGGEERRYVCNHMQCTRRFHSASLLARHVSTHAIQYTCHMCGHMFTCKRRLTQHLARLHTGSLSYPCTQCPGKFYSAYELRQHVRqhtderpfpcpvCQRTfrrkvcttpspqpqhldvl
MIRIHIGPSVILMLMIMTRYSLPCVDFIQVHLRLHSGERRFPCEYCSLLVYPVLILFRFIFVCTQGSADSHKHHLKDHVNKIHLHPKTFSCNSCGQTWLGYTSWKQHVAACREKRRKETFPCKRCDERFSTRDGLESFTFSLRLFCLYFPQELISHSSYHGGEERRYVCNHMQCTRRFHSASLLARHVSTHAIQYTCHMCGHMFTCKRRLTQHLARLHTGSLSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKGLESFTFSLRLFCLYFPQELISHSSYHGGEERRYVCNHMQCTRRFHSASLLARHVSTHAIQYTCHMCGHMFTCKRRLTQHLARLHTGSLSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKVCTTPSPQPQHLDVL
**RIHIGPSVILMLMIMTRYSLPCVDFIQVHLRLHSGERRFPCEYCSLLVYPVLILFRFIFVCTQGSADSHKHHLKDHVNKIHLHPKTFSCNSCGQTWLGYTSWKQHVAACREKRRKETFPCKRCDERFSTRDGLESFTFSLRLFCLYFPQELISHSSYHGGEERRYVCNHMQCTRRFHSASLLARHVSTHAIQYTCHMCGHMFTCKRRLTQHLARLHTGSLSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKGLESFTFSLRLFCLYFPQELISHSSYHGGEERRYVCNHMQCTRRFHSASLLARHVSTHAIQYTCHMCGHMFTCKRRLTQHLARLHTGSLSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKVC*************
MIRIHIGPSVILMLMIMTRYSLPCVDFIQVHLRLHSGERRFPCEYCSLLVYPVLILFRFIFVCTQGSADSHKHHLKDHVNKIHLHPKTFSCNSCGQTWLGYTSWKQHVAACREKRRKETFPCKRCDERFSTRDGLESFTFSLRLFCLYFPQELISHSSYHGGEERRYVCNHMQCTRRFHSASLLARHVSTHAIQYTCHMCGHMFTCKRRLTQHLARLHTGSLSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKGLESFTFSLRLFCLYFPQELISHSSYHGGEERRYVCNHMQCTRRFHSASLLARHVSTHAIQYTCHMCGHMFTCKRRLTQHLARLHTGSLSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKVCTTPSPQPQHLDV*
MIRIHIGPSVILMLMIMTRYSLPCVDFIQVHLRLHSGERRFPCEYCSLLVYPVLILFRFIFVCTQGSADSHKHHLKDHVNKIHLHPKTFSCNSCGQTWLGYTSWKQHVAACREKRRKETFPCKRCDERFSTRDGLESFTFSLRLFCLYFPQELISHSSYHGGEERRYVCNHMQCTRRFHSASLLARHVSTHAIQYTCHMCGHMFTCKRRLTQHLARLHTGSLSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKGLESFTFSLRLFCLYFPQELISHSSYHGGEERRYVCNHMQCTRRFHSASLLARHVSTHAIQYTCHMCGHMFTCKRRLTQHLARLHTGSLSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKVCTTPSPQPQHLDVL
MIRIHIGPSVILMLMIMTRYSLPCVDFIQVHLRLHSGERRFPCEYCSLLVYPVLILFRFIFVCTQGSADSHKHHLKDHVNKIHLHPKTFSCNSCGQTWLGYTSWKQHVAACREKRRKETFPCKRCDERFSTRDGLESFTFSLRLFCLYFPQELISHSSYHGGEERRYVCNHMQCTRRFHSASLLARHVSTHAIQYTCHMCGHMFTCKRRLTQHLARLHTGSLSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKGLESFTFSLRLFCLYFPQELISHSSYHGGEERRYVCNHMQCTRRFHSASLLARHVSTHAIQYTCHMCGHMFTCKRRLTQHLARLHTGSLSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKVCTTPSPQPQ*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIRIHIGPSVILMLMIMTRYSLPCVDFIQVHLRLHSGERRFPCEYCSLLVYPVLILFRFIFVCTQGSADSHKHHLKDHVNKIHLHPKTFSCNSCGQTWLGYTSWKQHVAACREKRRKETFPCKRCDERFSTRDGLESFTFSLRLFCLYFPQELISHSSYHGGEERRYVCNHMQCTRRFHSASLLARHVSTHAIQYTCHMCGHMFTCKRRLTQHLARLHTGSLSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKGLESFTFSLRLFCLYFPQELISHSSYHGGEERRYVCNHMQCTRRFHSASLLARHVSTHAIQYTCHMCGHMFTCKRRLTQHLARLHTGSLSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKVCTTPSPQPQHLDVL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query410 2.2.26 [Sep-21-2011]
Q95K52654 Zinc finger protein 283 O N/A N/A 0.773 0.484 0.308 2e-34
Q3ZCX4644 Zinc finger protein 568 O yes N/A 0.780 0.496 0.305 1e-33
P10076861 Zinc finger protein 26 OS yes N/A 0.860 0.409 0.302 1e-33
Q8N7M2679 Zinc finger protein 283 O no N/A 0.773 0.466 0.306 3e-33
Q5MCW4 686 Zinc finger protein 569 O no N/A 0.814 0.486 0.288 3e-33
Q9UJW8692 Zinc finger protein 180 O no N/A 0.790 0.468 0.306 4e-33
Q86UE3 836 Zinc finger protein 546 O no N/A 0.763 0.374 0.320 6e-33
Q3SYV7487 Zinc finger protein 345 O no N/A 0.853 0.718 0.293 3e-32
Q99676751 Zinc finger protein 184 O no N/A 0.809 0.442 0.297 6e-32
Q14585488 Zinc finger protein 345 O no N/A 0.773 0.649 0.299 1e-31
>sp|Q95K52|ZN283_MACFA Zinc finger protein 283 OS=Macaca fascicularis GN=ZNF283 PE=2 SV=1 Back     alignment and function desciption
 Score =  146 bits (369), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 117/379 (30%), Positives = 160/379 (42%), Gaps = 62/379 (16%)

Query: 28  IQVHLRLHSGERRFPCEYC--------SLLVYPVLILFRFIFVCTQ-GSADSHKHHLKDH 78
           + VH R H+GE+ + C+ C        SL+ +  +      + C + G A S  +HL  H
Sbjct: 226 LNVHQRFHTGEKPYECKECGKTFSWGSSLVKHERIHTGEKPYECKECGKAFSRGYHLTQH 285

Query: 79  VNKIHLHPKTFSCNSCGQTWLGYTSWKQH-VAACREKRRKETFPCKRCDERFSTRDGLES 137
             KIH+  K++ C  CG+ +   +S  +H +    EK     + CK C + FS       
Sbjct: 286 -QKIHIGVKSYKCKECGKAFFWGSSLAKHEIIHTGEK----PYQCKECGKAFSR------ 334

Query: 138 FTFSLRLFCLYFPQELISHSSYHGGEERRYVCNHMQCTRRFHSASLLARHVSTHAIQ--Y 195
                         +L  H   H G+ + Y C    C + F     L RH   H  +  Y
Sbjct: 335 ------------GYQLTQHQKIHTGK-KPYECK--ICGKAFCWGYQLTRHQIFHTGEKPY 379

Query: 196 TCHMCGHMFTCKRRLTQHLARLHTGSLSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCP 255
            C  CG  F C   L QH AR+HTG   Y C +C   F   Y L QH + HT E+PF C 
Sbjct: 380 ECKECGKAFNCGSSLIQH-ARIHTGEKPYECKECGKAFSRGYHLSQHQKIHTGEKPFECK 438

Query: 256 VCQRTFRRKGLESFTFSLRLFCLYFPQELISHSSYHGGEERRYVCNHMQCTRRFHSASLL 315
            C + F                  +   L+ H   H G E+ + C   +C + F S   L
Sbjct: 439 ECGKAFS-----------------WGSSLVKHERVHTG-EKSHECK--ECGKNFCSGYQL 478

Query: 316 ARHVSTHAIQ--YTCHMCGHMFTCKRRLTQHLARLHTGSLSYPCTQCPGKFYSAYELRQH 373
            RH   H  +  Y C  CG  F C   L QH  R+HTG   Y C +C   F   Y L QH
Sbjct: 479 TRHQVFHTGEKPYECKECGKAFNCGSSLVQH-ERIHTGEKPYECKECGKAFSRGYHLTQH 537

Query: 374 VRQHTDERPFPCPVCQRTF 392
            + HT E+PF C  C + F
Sbjct: 538 QKIHTGEKPFKCKECGKAF 556




May be involved in transcriptional regulation.
Macaca fascicularis (taxid: 9541)
>sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 Back     alignment and function description
>sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 Back     alignment and function description
>sp|Q8N7M2|ZN283_HUMAN Zinc finger protein 283 OS=Homo sapiens GN=ZNF283 PE=2 SV=4 Back     alignment and function description
>sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=2 SV=1 Back     alignment and function description
>sp|Q9UJW8|ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens GN=ZNF180 PE=1 SV=2 Back     alignment and function description
>sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 Back     alignment and function description
>sp|Q3SYV7|ZN345_BOVIN Zinc finger protein 345 OS=Bos taurus GN=ZNF345 PE=2 SV=1 Back     alignment and function description
>sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 Back     alignment and function description
>sp|Q14585|ZN345_HUMAN Zinc finger protein 345 OS=Homo sapiens GN=ZNF345 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query410
326680667 1782 PREDICTED: zinc finger protein 729-like 0.795 0.182 0.321 2e-36
326667171 681 PREDICTED: zinc finger protein 850-like 0.880 0.530 0.304 4e-36
326680774 1307 PREDICTED: zinc finger protein 729-like 0.841 0.263 0.310 5e-36
326666730 1718 PREDICTED: zinc finger protein 729 [Dani 0.814 0.194 0.315 6e-36
326668041 1077 PREDICTED: zinc finger protein 729-like 0.882 0.336 0.305 7e-36
326666712367 PREDICTED: zinc finger protein 429-like 0.775 0.866 0.306 1e-35
326667012 539 PREDICTED: zinc finger protein 271-like 0.875 0.666 0.298 2e-35
326667061433 PREDICTED: zinc finger protein 135-like 0.782 0.741 0.301 4e-35
326667110 1395 PREDICTED: zinc finger protein 729-like, 0.880 0.258 0.292 8e-35
326666903 573 PREDICTED: zinc finger protein 252-like 0.875 0.626 0.298 9e-35
>gi|326680667|ref|XP_003201586.1| PREDICTED: zinc finger protein 729-like [Danio rerio] Back     alignment and taxonomy information
 Score =  159 bits (403), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 124/386 (32%), Positives = 176/386 (45%), Gaps = 60/386 (15%)

Query: 21   SLPCVDFIQVHLRLHSGERRFPCEYC--SLLVYPVLILFRFI------FVCTQ-GSADSH 71
            S  C   +  H+R+H+GE+ F C  C  S +    L L   I      F CTQ G + S 
Sbjct: 1135 SFSCSSHLNKHIRIHTGEKPFTCTQCGKSFIQSSQLNLHMRIHTGEKPFTCTQCGKSFSR 1194

Query: 72   KHHLKDHVNKIHLHPKTFSCNSCGQTWLGYTSWKQHVAACREKRRKETFPCKRCDERFST 131
              HL  H+ +IH   K FSC  CG++    +S KQH+   R    ++ F C +C + F  
Sbjct: 1195 SSHLNYHM-RIHTGEKPFSCTQCGKSLRRSSSLKQHM---RIHTGEKPFTCTQCGKSFRR 1250

Query: 132  RDGLESFTFSLRLFCLYFPQELISHSSYHGGEERRYVCNHMQCTRRFHSASLLARHVSTH 191
                                 L  H   H G E+ + C   QC + F  +S L  H+ +H
Sbjct: 1251 SS------------------HLNQHMRIHTG-EKPFSC--TQCGKSFSQSSSLNLHMMSH 1289

Query: 192  AIQ--YTCHMCGHMFTCKRRLTQHLARLHTGSLSYPCTQCPGKFYSAYELRQHVRQHTDE 249
              +  +TC  CG  F C   L QH+ R+HTG   + CTQC   F  +  L  H+R HT E
Sbjct: 1290 TGEKPFTCTQCGKTFNCSSHLNQHM-RIHTGEKPFTCTQCGKSFSQSSNLNLHMRIHTRE 1348

Query: 250  RPFPCPVCQRTFRRKGLESFTFSLRLFCLYFPQELISHSSYHGGEERRYVCNHMQCTRRF 309
            +PF C  C ++F                      L  H   H G E+ + C+  QC + F
Sbjct: 1349 KPFQCTQCGKSFSH-----------------SSSLNQHMRIHTG-EKPFTCS--QCGKSF 1388

Query: 310  HSASLLARHVSTHAIQ--YTCHMCGHMFTCKRRLTQHLARLHTGSLSYPCTQCPGKFYSA 367
            +  SLL +H+  H  +  +TC  CG  F+    L QH+ R+HTG   + CTQC   F  +
Sbjct: 1389 NCLSLLNKHMKIHTGEKPFTCTQCGKSFSQSTSLNQHM-RIHTGEKPFTCTQCGKSFSQS 1447

Query: 368  YELRQHVRQHTDERPFPCPVCQRTFR 393
              L QH++ HT E+PF C  C ++F 
Sbjct: 1448 SSLNQHMKIHTGEKPFTCTQCGKSFN 1473




Source: Danio rerio

Species: Danio rerio

Genus: Danio

Family: Cyprinidae

Order: Cypriniformes

Class: Actinopterygii

Phylum: Chordata

Superkingdom: Eukaryota

>gi|326667171|ref|XP_003198510.1| PREDICTED: zinc finger protein 850-like [Danio rerio] Back     alignment and taxonomy information
>gi|326680774|ref|XP_002661688.2| PREDICTED: zinc finger protein 729-like [Danio rerio] Back     alignment and taxonomy information
>gi|326666730|ref|XP_003198356.1| PREDICTED: zinc finger protein 729 [Danio rerio] Back     alignment and taxonomy information
>gi|326668041|ref|XP_003198717.1| PREDICTED: zinc finger protein 729-like [Danio rerio] Back     alignment and taxonomy information
>gi|326666712|ref|XP_003198347.1| PREDICTED: zinc finger protein 429-like [Danio rerio] Back     alignment and taxonomy information
>gi|326667012|ref|XP_003198451.1| PREDICTED: zinc finger protein 271-like [Danio rerio] Back     alignment and taxonomy information
>gi|326667061|ref|XP_003198472.1| PREDICTED: zinc finger protein 135-like [Danio rerio] Back     alignment and taxonomy information
>gi|326667110|ref|XP_003198489.1| PREDICTED: zinc finger protein 729-like, partial [Danio rerio] Back     alignment and taxonomy information
>gi|326666903|ref|XP_003198412.1| PREDICTED: zinc finger protein 252-like [Danio rerio] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query410
ZFIN|ZDB-GENE-110913-173 819 si:dkey-78k22.1 "si:dkey-78k22 0.880 0.440 0.314 1.1e-45
ZFIN|ZDB-GENE-080215-12 600 zgc:173710 "zgc:173710" [Danio 0.846 0.578 0.327 1.3e-45
ZFIN|ZDB-GENE-110913-164572 si:dkey-257e4.5 "si:dkey-257e4 0.875 0.627 0.305 1.6e-45
ZFIN|ZDB-GENE-110913-23 569 si:dkey-122c11.8 "si:dkey-122c 0.873 0.629 0.300 1.6e-45
ZFIN|ZDB-GENE-110913-176797 si:dkey-238o14.5 "si:dkey-238o 0.473 0.243 0.358 9.5e-45
ZFIN|ZDB-GENE-071004-105 1014 zgc:173573 "zgc:173573" [Danio 0.824 0.333 0.314 1.1e-44
ZFIN|ZDB-GENE-110913-1481029 si:dkey-14o6.6 "si:dkey-14o6.6 0.817 0.325 0.315 2.4e-44
ZFIN|ZDB-GENE-110913-160 846 si:dkey-29p23.3 "si:dkey-29p23 0.880 0.426 0.299 2.7e-44
ZFIN|ZDB-GENE-110913-38 987 si:ch211-208f21.5 "si:ch211-20 0.821 0.341 0.305 2e-43
ZFIN|ZDB-GENE-110913-159 733 si:ch211-197f20.2 "si:ch211-19 0.880 0.492 0.302 2e-43
ZFIN|ZDB-GENE-110913-173 si:dkey-78k22.1 "si:dkey-78k22.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 486 (176.1 bits), Expect = 1.1e-45, P = 1.1e-45
 Identities = 131/417 (31%), Positives = 194/417 (46%)

Query:     2 IRIHIGPSVILMLMIMTRYSLPCVDFIQVHLRLHSGERRFPCEYC-------SLLVYPVL 54
             +RIH G            ++  C  +++ H+R+H+GE+ F C  C       S L + + 
Sbjct:    73 MRIHTGEKPFTCTQCGISFN--CSSYLKQHMRIHTGEKPFTCTQCGKSFNRSSNLDHHMR 130

Query:    55 I-LFRFIFVCTQ-GSADSHKHHLKDHVNKIHLHPKTFSCNSCGQTWLGYTSWKQHVAACR 112
             I      F CTQ G + +   +L  H+ +IH   K  +C  CG+++   +S  +H+   R
Sbjct:   131 IHTGEKPFTCTQCGKSFNRSSNLDQHI-RIHTGEKPITCTLCGKSFRQSSSLSKHM---R 186

Query:   113 EKRRKETFPCKRCDERFSTRDGLESFTFSLRLFCLYFPQELISHSSYHGGEERRYVCNHM 172
                 ++ F C +C + FS     +S  F+L             H   H GE + + C   
Sbjct:   187 IHTGEKPFTCTQCGKSFS-----QSSNFNL-------------HMRIHTGE-KPFTCT-- 225

Query:   173 QCTRRFHSASLLARHVSTHAIQ--YTCHMCGHMFTCKRRLTQHLARLHTGSLSYPCTQCP 230
             QC + F  AS L +H+ TH  +  +TC  CG  F     L QH+ R+HTG     CTQC 
Sbjct:   226 QCGKSFRQASSLNKHMRTHTGEKPFTCTQCGKSFNRSSHLNQHI-RIHTGEKPITCTQCG 284

Query:   231 GKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKG-----LESFTFSLRLFCLY----FP 281
               F  +  L +H+R HT E+PF C  C ++F +       +   T    + C      F 
Sbjct:   285 KSFRQSSSLYKHMRIHTGEKPFTCTQCGKSFSQSSNFNLHMRIHTGEKPITCTQCGKSFH 344

Query:   282 QE--LISHSSYHGGEERRYVCNHMQCTRRFHSASLLARHVSTHAIQ--YTCHMCGHMFTC 337
             Q   L  H   H GE + + C   QC + FH AS L +H+  H  +   TC  CG  F  
Sbjct:   345 QSSSLYKHMRIHTGE-KPFTCT--QCGKSFHQASSLNKHMRIHTEEKPITCTQCGKSFRQ 401

Query:   338 KRRLTQHLARLHTGSLSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRR 394
                L +H+ R+HTG   + CTQC   F  +  L+QH+R HT E+PF C  C R+F R
Sbjct:   402 TSSLNKHM-RIHTGEKPFTCTQCGISFNCSSYLKQHMRIHTGEKPFTCTQCGRSFNR 457


GO:0005622 "intracellular" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0003677 "DNA binding" evidence=IEA
ZFIN|ZDB-GENE-080215-12 zgc:173710 "zgc:173710" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-164 si:dkey-257e4.5 "si:dkey-257e4.5" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-23 si:dkey-122c11.8 "si:dkey-122c11.8" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-176 si:dkey-238o14.5 "si:dkey-238o14.5" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-071004-105 zgc:173573 "zgc:173573" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-148 si:dkey-14o6.6 "si:dkey-14o6.6" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-160 si:dkey-29p23.3 "si:dkey-29p23.3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-38 si:ch211-208f21.5 "si:ch211-208f21.5" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-159 si:ch211-197f20.2 "si:ch211-197f20.2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 410
KOG2462|consensus279 99.94
KOG3608|consensus467 99.93
KOG1074|consensus958 99.93
KOG3608|consensus467 99.92
KOG1074|consensus958 99.91
KOG3623|consensus 1007 99.89
KOG2462|consensus279 99.88
KOG3623|consensus1007 99.79
KOG3576|consensus267 99.58
KOG3576|consensus267 99.45
PLN03086567 PRLI-interacting factor K; Provisional 99.3
PLN03086567 PRLI-interacting factor K; Provisional 99.11
PHA00733128 hypothetical protein 99.08
PHA0276855 hypothetical protein; Provisional 99.04
PHA00733128 hypothetical protein 98.89
KOG3993|consensus500 98.78
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.78
PHA0276855 hypothetical protein; Provisional 98.71
KOG3993|consensus500 98.7
PHA0061644 hypothetical protein 98.53
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.4
PHA0073279 hypothetical protein 98.3
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.22
PHA0073279 hypothetical protein 98.16
PHA0061644 hypothetical protein 98.04
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.9
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.77
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.47
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.42
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.39
COG5189423 SFP1 Putative transcriptional repressor regulating 97.27
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.27
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.06
COG5189423 SFP1 Putative transcriptional repressor regulating 97.03
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.98
smart0035526 ZnF_C2H2 zinc finger. 96.79
PRK04860160 hypothetical protein; Provisional 96.73
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 96.72
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 96.62
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 96.6
KOG2231|consensus 669 96.38
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.2
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 95.87
KOG2482|consensus423 95.65
smart0035526 ZnF_C2H2 zinc finger. 95.56
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 95.35
PRK04860160 hypothetical protein; Provisional 95.32
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 95.3
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 95.23
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 95.21
COG5236 493 Uncharacterized conserved protein, contains RING Z 94.85
KOG1146|consensus 1406 94.79
KOG2231|consensus 669 94.13
KOG2785|consensus390 93.99
KOG1146|consensus 1406 92.84
KOG2785|consensus 390 92.74
KOG2482|consensus423 92.68
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 92.24
COG5236493 Uncharacterized conserved protein, contains RING Z 92.18
KOG4124|consensus442 91.74
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 90.69
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 90.54
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 90.53
COG5048467 FOG: Zn-finger [General function prediction only] 90.23
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 90.2
COG5048467 FOG: Zn-finger [General function prediction only] 88.96
KOG2893|consensus341 88.82
KOG2893|consensus 341 87.74
KOG4173|consensus253 86.91
COG404965 Uncharacterized protein containing archaeal-type C 84.67
KOG4173|consensus253 84.61
cd0072934 rubredoxin_SM Rubredoxin, Small Modular nonheme ir 83.06
PF09986 214 DUF2225: Uncharacterized protein conserved in bact 81.93
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 81.73
>KOG2462|consensus Back     alignment and domain information
Probab=99.94  E-value=3.2e-28  Score=203.21  Aligned_cols=136  Identities=26%  Similarity=0.657  Sum_probs=128.2

Q ss_pred             CCCCCCCccchhhhhhcCCcccccccchhcccCchhhcccccccCC--CCcccccCcccccccccChhhHHHHHHcCCCC
Q psy12647        248 DERPFPCPVCQRTFRRKGLESFTFSLRLFCLYFPQELISHSSYHGG--EERRYVCNHMQCTRRFHSASLLARHVSTHAIQ  325 (410)
Q Consensus       248 ~~~~~~C~~C~~~f~~~~~~~~~~~~~~~~~~~~~~l~~H~~~~~~--~~~~~~C~~~~C~~~f~~~~~l~~H~~~~~~~  325 (410)
                      ....|.|++|++.+.+.+                 +|..|..+|-.  +.+-+.|+  .|++.|.+...|+.|+++|.-+
T Consensus       127 ~~~r~~c~eCgk~ysT~s-----------------nLsrHkQ~H~~~~s~ka~~C~--~C~K~YvSmpALkMHirTH~l~  187 (279)
T KOG2462|consen  127 KHPRYKCPECGKSYSTSS-----------------NLSRHKQTHRSLDSKKAFSCK--YCGKVYVSMPALKMHIRTHTLP  187 (279)
T ss_pred             cCCceecccccccccccc-----------------ccchhhcccccccccccccCC--CCCceeeehHHHhhHhhccCCC
Confidence            345689999999999998                 99999999864  34778899  9999999999999999999999


Q ss_pred             cccccccCccCChhhHHHHHHhhcCCCCCcccCcCcccccCcHhHHHHHHhhcCCCCccCccccccccccccCccCCC
Q psy12647        326 YTCHMCGHMFTCKRRLTQHLARLHTGSLSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKVCTTPSPQ  403 (410)
Q Consensus       326 ~~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~  403 (410)
                      .+|.+||+.|+..+.|+.|+ ++|+|||||.|+.|+++|.+.+||+.||++|.+.|.|+|..|+|+|+.++-|..|.-
T Consensus       188 c~C~iCGKaFSRPWLLQGHi-RTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl~SyLnKH~E  264 (279)
T KOG2462|consen  188 CECGICGKAFSRPWLLQGHI-RTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFALKSYLNKHSE  264 (279)
T ss_pred             cccccccccccchHHhhccc-ccccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHHHHHHHHHHhhh
Confidence            99999999999999999999 999999999999999999999999999999999999999999999999999999864



>KOG3608|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG2462|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG4124|consensus Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query410
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 8e-17
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 3e-09
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 3e-09
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 3e-08
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 3e-08
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 5e-08
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 8e-05
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 3e-07
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 3e-07
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 1e-06
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 1e-06
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 1e-06
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 1e-06
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 3e-06
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 3e-06
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 4e-06
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 4e-06
2wbu_A90 Crystal Structure Of The Zinc Finger Domain Of Klf4 4e-06
2wbu_A90 Crystal Structure Of The Zinc Finger Domain Of Klf4 4e-06
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 4e-06
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 4e-06
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 4e-06
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 4e-06
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 4e-06
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 4e-06
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 4e-06
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 4e-06
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 5e-06
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 5e-06
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 5e-06
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 5e-06
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 6e-06
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 6e-06
1tf6_A190 Co-crystal Structure Of Xenopus Tfiiia Zinc Finger 6e-06
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 1e-05
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 1e-05
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 1e-05
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 1e-05
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 2e-05
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 2e-04
2gli_A155 Five-Finger GliDNA COMPLEX Length = 155 6e-05
2adr_A60 Adr1 Dna-Binding Domain From Saccharomyces Cerevisi 3e-04
2adr_A60 Adr1 Dna-Binding Domain From Saccharomyces Cerevisi 8e-04
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure

Iteration: 1

Score = 84.7 bits (208), Expect = 8e-17, Method: Compositional matrix adjust. Identities = 59/183 (32%), Positives = 80/183 (43%), Gaps = 23/183 (12%) Query: 215 ARLHTGSLSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKGLESFTFSLR 274 A L G Y C +C F + L +H R HT E+P+ CP C ++F K Sbjct: 13 AALEPGEKPYACPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFSDK---------- 62 Query: 275 LFCLYFPQELISHSSYHGGEERRYVCNHMQCTRRFHSASLLARHVSTHAIQ--YTCHMCG 332 ++L H H GE + Y C +C + F + L H TH + Y C CG Sbjct: 63 -------KDLTRHQRTHTGE-KPYKC--PECGKSFSQRANLRAHQRTHTGEKPYACPECG 112 Query: 333 HMFTCKRRLTQHLARLHTGSLSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTF 392 F+ L H R HTG Y C +C F L H R HT E+P+ CP C ++F Sbjct: 113 KSFSQLAHLRAHQ-RTHTGEKPYKCPECGKSFSREDNLHTHQRTHTGEKPYKCPECGKSF 171 Query: 393 RRK 395 R+ Sbjct: 172 SRR 174
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 Back     alignment and structure
>pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|1TF6|A Chain A, Co-crystal Structure Of Xenopus Tfiiia Zinc Finger Domain Bound To The 5s Ribosomal Rna Gene Internal Control Region Length = 190 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 Back     alignment and structure
>pdb|2ADR|A Chain A, Adr1 Dna-Binding Domain From Saccharomyces Cerevisiae, Nmr, 25 Structures Length = 60 Back     alignment and structure
>pdb|2ADR|A Chain A, Adr1 Dna-Binding Domain From Saccharomyces Cerevisiae, Nmr, 25 Structures Length = 60 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query410
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-24
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 6e-24
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-12
1tf6_A190 Protein (transcription factor IIIA); complex (tran 4e-18
1tf6_A190 Protein (transcription factor IIIA); complex (tran 5e-17
1tf6_A190 Protein (transcription factor IIIA); complex (tran 6e-13
1tf6_A190 Protein (transcription factor IIIA); complex (tran 1e-08
1tf6_A190 Protein (transcription factor IIIA); complex (tran 2e-07
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 5e-16
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 8e-10
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 3e-08
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 7e-08
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 1e-04
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 1e-15
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 4e-13
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 5e-13
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 6e-08
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-06
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 5e-05
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 4e-14
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 6e-14
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 4e-10
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 1e-08
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 6e-14
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-13
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 3e-08
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 4e-08
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-06
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 4e-13
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 7e-13
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 1e-12
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 2e-10
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 5e-09
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 2e-11
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 2e-11
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 4e-07
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 3e-05
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 4e-11
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 1e-10
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 1e-10
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 7e-07
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 1e-04
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 4e-11
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 4e-11
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 1e-09
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 4e-06
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 7e-11
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 7e-11
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 9e-10
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 1e-10
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 8e-10
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 8e-10
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 3e-09
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 1e-04
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 2e-10
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 3e-10
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 1e-07
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 6e-06
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 8e-05
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 3e-10
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-09
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-09
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 1e-07
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-06
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 4e-06
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 3e-10
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 3e-10
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-06
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-04
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 2e-04
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 4e-10
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 6e-10
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 1e-05
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-05
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 7e-04
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 9e-10
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 9e-10
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 6e-05
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 1e-08
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 1e-08
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 3e-07
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 4e-05
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 7e-08
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 7e-08
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 2e-07
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 2e-07
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 1e-06
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 6e-04
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-07
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 4e-07
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 3e-06
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 3e-06
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 3e-05
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 1e-04
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 3e-07
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 3e-07
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 4e-05
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 4e-05
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 3e-07
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 3e-07
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 1e-05
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 1e-05
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 6e-05
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 6e-05
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 6e-07
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 6e-07
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 1e-05
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 1e-06
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 1e-06
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-04
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 5e-04
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 5e-04
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 2e-06
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 2e-06
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 8e-06
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 9e-06
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 4e-04
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 4e-04
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 8e-04
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 4e-06
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 4e-06
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 3e-04
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 3e-04
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 4e-04
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 4e-04
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 5e-06
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 5e-06
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-05
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 2e-05
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 2e-05
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-04
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 2e-05
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 2e-05
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 6e-05
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 6e-05
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 2e-05
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 2e-05
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 5e-05
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 5e-05
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 6e-04
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 6e-04
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 1e-04
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 6e-04
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 1e-04
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 1e-04
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 2e-04
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 2e-04
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 3e-04
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 3e-04
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 3e-04
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 3e-04
2epa_A72 Krueppel-like factor 10; transforming growth facto 3e-04
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 4e-04
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 4e-04
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 4e-04
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 4e-04
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-04
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-04
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-04
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-04
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 7e-04
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 7e-04
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 8e-04
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 8e-04
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
 Score = 98.3 bits (246), Expect = 2e-24
 Identities = 64/211 (30%), Positives = 89/211 (42%), Gaps = 30/211 (14%)

Query: 178 FHSASLLARHVSTHAIQ--YTCHMCGHMFTCKRRLTQHLARLHTGSLSYPCTQCPGK-FY 234
              +S      +    +  Y C  CG  F+    L +H  R HTG   Y C +C GK F 
Sbjct: 3   EFGSSSSVAQAALEPGEKPYACPECGKSFSRSDHLAEHQ-RTHTGEKPYKCPEC-GKSFS 60

Query: 235 SAYELRQHVRQHTDERPFPCPVCQRTFRRKGLESFTFSLRLFCLYFPQELISHSSYHGGE 294
              +L +H R HT E+P+ CP C ++F ++                   L +H   H G 
Sbjct: 61  DKKDLTRHQRTHTGEKPYKCPECGKSFSQRA-----------------NLRAHQRTHTG- 102

Query: 295 ERRYVCNHMQCTRRFHSASLLARHVSTHAIQ--YTCHMCGHMFTCKRRLTQHLARLHTGS 352
           E+ Y C   +C + F   + L  H  TH  +  Y C  CG  F+ +  L  H  R HTG 
Sbjct: 103 EKPYACP--ECGKSFSQLAHLRAHQRTHTGEKPYKCPECGKSFSREDNLHTHQ-RTHTGE 159

Query: 353 LSYPCTQCPGK-FYSAYELRQHVRQHTDERP 382
             Y C +C GK F     L  H R HT ++ 
Sbjct: 160 KPYKCPEC-GKSFSRRDALNVHQRTHTGKKT 189


>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query410
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 100.0
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 100.0
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.96
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.95
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.91
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.9
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.88
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.86
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.85
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.85
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.84
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.83
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.82
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.81
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.81
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.78
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.74
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.74
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.73
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.73
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.73
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.71
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.7
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.7
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.7
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.7
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.69
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.67
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.66
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.65
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.65
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.63
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.63
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.63
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.62
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.61
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.61
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.6
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.59
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.57
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.57
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.56
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.55
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.53
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.53
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.53
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.47
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.45
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.45
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.44
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.44
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.44
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.43
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.43
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.43
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.43
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.43
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.43
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.41
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.41
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.41
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.41
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.4
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.39
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.38
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.37
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.36
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.36
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.35
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.35
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.34
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.34
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.34
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.31
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.31
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.31
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.28
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.27
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.25
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.25
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.25
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.24
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.24
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.24
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.24
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.24
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.23
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.23
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.23
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.23
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.23
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.23
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.23
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.23
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.23
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.23
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.23
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.23
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.23
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.22
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.22
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.22
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.22
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.22
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.22
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.22
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.22
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.22
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.22
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.22
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.22
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.21
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.21
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.21
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.21
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.21
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.21
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.21
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.21
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.21
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.2
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.2
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.2
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.2
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.2
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.19
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.18
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.18
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.17
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.17
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.16
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.15
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.15
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.13
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.13
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.13
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.11
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.11
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.11
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.11
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.1
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.1
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.09
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.09
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.09
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.09
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.09
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.09
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.09
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.09
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.09
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.09
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.09
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.08
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.08
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.08
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.08
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.08
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.07
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.07
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.07
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.07
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.07
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.06
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.06
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.06
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.06
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.06
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.06
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.05
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.05
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.05
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.04
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.04
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.04
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.04
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.04
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.04
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.03
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.03
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.02
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.01
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 99.0
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.99
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.99
2epa_A72 Krueppel-like factor 10; transforming growth facto 98.98
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.98
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.96
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 98.94
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.82
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.82
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.82
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 98.82
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.81
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.81
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.81
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.81
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.8
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.8
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.8
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.79
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.79
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.79
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.79
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 98.79
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.79
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.79
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.79
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.79
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.79
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.79
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.79
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.79
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.79
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.78
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.78
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.78
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.78
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.78
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.78
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.78
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.78
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 98.78
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.77
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.77
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.77
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.76
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.76
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.76
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.76
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 98.75
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.75
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.75
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 98.74
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.74
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.74
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.74
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.73
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 98.72
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.72
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.71
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.71
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.71
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.71
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.7
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.68
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.66
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.65
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.65
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.64
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.64
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.64
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.64
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.64
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.64
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.64
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.63
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.63
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.63
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.63
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.63
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.62
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.62
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.62
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.62
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.62
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.61
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.61
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.61
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.6
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.6
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.59
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.59
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.59
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.58
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.58
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.58
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.58
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.58
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.57
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.57
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.57
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.57
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.57
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.56
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.56
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.55
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.55
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.54
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.54
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.54
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.54
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.53
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.53
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.53
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.53
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.53
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.53
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.52
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.5
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.5
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.49
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.47
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.47
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.46
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.45
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.45
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.44
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.44
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.41
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.39
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.34
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.34
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.31
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.3
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.3
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.28
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.25
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.25
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.24
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.24
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.22
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.21
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.2
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.19
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.19
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.17
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.16
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.15
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.13
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.41
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.11
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.11
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.1
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.38
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.07
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.07
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.04
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.01
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 97.95
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.15
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.9
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.89
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.89
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 97.88
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.87
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.84
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.82
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.79
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 97.77
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.77
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 97.76
1ard_A29 Yeast transcription factor ADR1; transcription reg 97.76
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.74
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.7
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.7
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 97.68
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.67
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 97.67
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.66
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 97.65
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.65
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 96.82
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 96.77
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 96.76
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 97.58
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.55
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 97.53
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 97.48
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 97.47
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.4
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 97.33
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 97.22
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.06
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 96.98
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 96.51
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 95.92
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 95.6
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 95.44
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 95.36
2e72_A49 POGO transposable element with ZNF domain; zinc fi 93.72
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 93.43
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 91.85
2e72_A49 POGO transposable element with ZNF domain; zinc fi 90.76
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 86.48
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 84.41
2elu_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 83.13
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 82.81
4ayb_P48 DNA-directed RNA polymerase; transferase, multi-su 80.58
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
Probab=100.00  E-value=8.6e-35  Score=246.38  Aligned_cols=178  Identities=33%  Similarity=0.709  Sum_probs=97.7

Q ss_pred             HHHHHhhCCC--CcccccccccccChhHHHHHHhhhcCCCCccccCCCCcccCCHHHHHHHHHHhcCCCCCCCccchhhh
Q psy12647        184 LARHVSTHAI--QYTCHMCGHMFTCKRRLTQHLARLHTGSLSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTF  261 (410)
Q Consensus       184 l~~H~~~~~~--~~~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f  261 (410)
                      |..|+..+.+  +|.|+.|++.|.+...|..|+ ..|.++++|.|+.|++.|.+...|..|++.|.++++|.|+.|++.|
T Consensus         9 l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~H~-~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f   87 (190)
T 2i13_A            9 SVAQAALEPGEKPYACPECGKSFSRSDHLAEHQ-RTHTGEKPYKCPECGKSFSDKKDLTRHQRTHTGEKPYKCPECGKSF   87 (190)
T ss_dssp             ----------------------CCSSHHHHHGG-GCC---CCEECTTTCCEESSHHHHHHHHHHHHCCCCEECTTTCCEE
T ss_pred             chhhhhhcCCCCCCcCCCCccccCCHHHHHHHH-HHcCCCCCccCCCcCchhCCHHHHHHHHHhcCCCCCccCcccCCcc
Confidence            4444444432  566666666666666666665 5566666666666666666666666666666666556665555555


Q ss_pred             hhcCCcccccccchhcccCchhhcccccccCCCCcccccCcccccccccChhhHHHHHHcCC--CCcccccccCccCChh
Q psy12647        262 RRKGLESFTFSLRLFCLYFPQELISHSSYHGGEERRYVCNHMQCTRRFHSASLLARHVSTHA--IQYTCHMCGHMFTCKR  339 (410)
Q Consensus       262 ~~~~~~~~~~~~~~~~~~~~~~l~~H~~~~~~~~~~~~C~~~~C~~~f~~~~~l~~H~~~~~--~~~~C~~C~~~f~~~~  339 (410)
                      ....                 .|..|++.|.++ ++|.|+  .|++.|.+...|..|++.|.  ++|.|++|++.|.+..
T Consensus        88 ~~~~-----------------~l~~H~~~h~~~-~~~~C~--~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~  147 (190)
T 2i13_A           88 SQRA-----------------NLRAHQRTHTGE-KPYACP--ECGKSFSQLAHLRAHQRTHTGEKPYKCPECGKSFSRED  147 (190)
T ss_dssp             SCHH-----------------HHHHHHHHHHTC-CCEECT--TTCCEESSHHHHHHHHHHHHCCCCEECTTTCCEESCHH
T ss_pred             CCHH-----------------HHHHHHHhcCCC-CCCcCC--CCCCccCCHHHHHHHHHHhCCCCCeECCCCCcccCCHH
Confidence            5554                 555555555554 666666  66666666666666666654  5677777777777777


Q ss_pred             hHHHHHHhhcCCCCCcccCcCcccccCcHhHHHHHHhhcCCCCc
Q psy12647        340 RLTQHLARLHTGSLSYPCTQCPGKFYSAYELRQHVRQHTDERPF  383 (410)
Q Consensus       340 ~l~~H~~~~H~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~  383 (410)
                      .|..|+ .+|.+++||.|++|++.|.....|..|+++|+|++||
T Consensus       148 ~L~~H~-~~H~~~~~~~C~~C~~~f~~~~~L~~H~~~H~~~k~~  190 (190)
T 2i13_A          148 NLHTHQ-RTHTGEKPYKCPECGKSFSRRDALNVHQRTHTGKKTS  190 (190)
T ss_dssp             HHHHHH-HHHHCCCCEECTTTCCEESSHHHHHHHHTTC------
T ss_pred             HHHHHH-HhcCCCCCeECCCCCCccCCHHHHHHHHHhcCCCCCC
Confidence            777776 6677777777777777777777777777777776664



>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>2elu_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2elw_A Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>4ayb_P DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2pmz_P 2wb1_P 2y0s_P 3hkz_P 2waq_P 4b1o_P 4b1p_X Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 410
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 0.001
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 0.001
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: PATZ1
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 34.2 bits (79), Expect = 0.001
 Identities = 10/32 (31%), Positives = 15/32 (46%)

Query: 195 YTCHMCGHMFTCKRRLTQHLARLHTGSLSYPC 226
           Y C  CG  F+    L  H+ ++HT    + C
Sbjct: 6   YICQSCGKGFSRPDHLNGHIKQVHTSERPHKC 37


>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query410
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.59
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.54
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.31
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.23
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.19
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.18
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.15
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.08
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.06
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.06
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.05
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.04
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.02
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.0
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.98
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.93
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.91
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.88
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.81
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.79
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.77
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.73
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.72
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.71
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.7
d2cota238 Zinc finger and SCAN domain-containing protein 16, 98.67
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.66
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.65
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.5
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.44
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.39
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.38
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.38
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.35
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.27
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.24
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.18
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.09
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.07
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.05
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.03
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.99
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 97.98
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.9
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.87
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.83
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.74
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.74
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.65
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.57
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.49
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.48
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.39
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.38
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.31
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.28
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.26
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.26
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.24
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.22
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.22
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.19
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.18
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.08
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.99
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 96.98
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 96.95
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 96.89
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.83
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 96.81
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.77
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 96.77
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.77
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.72
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.65
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 96.64
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.59
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.59
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 96.58
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 96.55
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.53
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.47
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.04
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.0
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.88
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 95.65
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 95.54
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 95.4
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 95.0
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 94.96
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 94.77
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 94.71
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 94.39
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 94.35
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 94.16
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 93.74
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 93.25
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 92.8
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 92.1
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 91.98
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 91.59
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 90.72
d1y0jb136 U-shaped transcription factor, different fingers { 90.54
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 90.27
d1y0jb136 U-shaped transcription factor, different fingers { 90.2
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 89.66
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 88.62
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 88.35
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 87.89
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 86.28
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 86.02
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 85.72
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 85.32
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 84.44
d2ghfa236 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 82.99
d1wjpa341 Zinc finger protein 295, ZNF295 {Human (Homo sapie 82.57
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 81.62
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 81.29
d1tf3a331 Transcription factor IIIA, TFIIIA {Xenopus laevis 80.81
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.59  E-value=9.2e-17  Score=102.08  Aligned_cols=51  Identities=27%  Similarity=0.589  Sum_probs=30.3

Q ss_pred             CCCcccCcCcccccCcHhHHHHHHhhcCCCCccCccccccccccccCccCCC
Q psy12647        352 SLSYPCTQCPGKFYSAYELRQHVRQHTDERPFPCPVCQRTFRRKVCTTPSPQ  403 (410)
Q Consensus       352 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~  403 (410)
                      |+||.|. ||+.|....+|..|+++|+|++||+|.+||++|+.++.|..|++
T Consensus         1 EK~y~C~-Cgk~F~~~~~l~~H~~~Ht~ekpy~C~~C~k~F~~~~~L~~H~r   51 (53)
T d2csha1           1 DKLYPCQ-CGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMK   51 (53)
T ss_dssp             CCCEECT-TSCEESSHHHHHHHHHHHSCCCSEECTTTSCEESSSHHHHHHHT
T ss_pred             CcCCCCC-CCCeECCHHHhHHHhhccccccCCcCCCcCCEecCHHHHHHHHh
Confidence            4556663 66666666666666666666666666666666666666666554



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjpa3 g.37.1.1 (A:67-107) Zinc finger protein 295, ZNF295 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1tf3a3 g.37.1.1 (A:71-101) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure