Psyllid ID: psy12659

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050-
MFDFVFQLLEMLKFYARFEISDETGDPLTDHDMTQIHYQNITSLQKAAFAKFPDLRSFSLANVASVDTRETLTKHFEPLTPLCVLKKRTEEEENEDEDVEMENKDANVLTTTPPRQAIIIGFLLIQVLKKRTEEEENEDEDVEMENKDGKPIITVEPHVIPSRGPYLFNEPRKNTIPFTPTQIEAIRAGMQPGLTLVVGPPGTGKTDVAVQIISNLYHNFPHQRTLIVTHSNQALNQLFEKIISLDVDERHLLRLGHGEEALETEKDFSRYGRVNYVLAKRLDLLQEVERLQKSLDVSGDVAYTCETAGHFFLYQVLARWEKFLATVRPSDGKTVPVKTIKTEFPFHGFFENAPKPLFKEKSYETDMEIAEGCFRYIEKMFTQLEEFRAFELLRSGLDRSKYLLVKEAKIIAMTCTHAALKRKELVDMGFSFSISPIWVSFNTVSDLCSQISRHEKRSSQLEALNSMPLYPTQEIIWNENIVPTEYFSGEGCLALPKLNLQFLTLHDYLLRNFNLFRLESTCRVNYVLAKRLDLLQEVERLQKSLDVSGDVAYTCETAGHFFLYQVLARWEKFLATVRQRKQDRRKPAVSRTNIIREKQPSRVRADVIVNLNVKREIKGEWESLRKHDVCFLITLKPPLPIGTKISYKGPFLEQTGLTYVRGCEIEGMLDVNGRIIEDGPEPRPVLPGDTRTFRVMLDCNQYKEDLDNVAQGNEDVYETFNVLMRRKPKENNFKAVLETIRDLMNTECVVPDWLHDIILGYGDPGAAHYTEMPNEIATMDFNDTFLNMDHLRSSFPQAEIRVKTDNPTKLVPPFKLTFHEIEAIRAGMQPGLTLVVGPPGTGKTDVAVQIISNLYHNFPHQRTLIVTHSNQALNQLFEKIISLDVDERHLLHKKYRITPRYLLLAIKNDVELSQLLSDVTIAQGGVMPNIQSMKFDKTLKTLLSPWKSEDGSPFFGGWARMAQPIVNFAVVEVAKPNIEEALETEKDFSRYGRVNYVLAKRLDLLQEVERLQKSLDVSGDVAYTCETAGHFFLYQVLARWEKFLATVRQTA
cHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHcccccccccccccccccccccccHHHccccccccccccccccHHHHHHHHHHHHHHHHHHccccHHHHHccccccccEEEccccccccccccccccccccccccHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHcccccccEEEEccccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHccccccEEccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHccEEEEEEcHHHHHcHHHHHHcccccccccccccccccccccccccccccccHHHHHHccccccccHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHcHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccccccccccccccccEEEEEEEEEEcccccHHHHHcccccccEEEEEEEEcccccccccccccccccccccEEEEEcEEEEEEcccccccccccccccccccccEEEEEEccHHHHHHHHHHHHccccccccccEEEEEcccccccHHHHHHHHHHHHccccccccHHHHHHHcccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccHHHHHHHHHccccccccEEcccccccHHHHHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHccccHHHHccccccccHHHHHHHHHcHHHHHHHHHHHHHccccccccccccHHHHHHHccccccccccccccccccccccccccccHHHHcccccHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHc
ccHHHHHHHHHHHHHHcccEcccccccccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHcccccHHHHHHHHccccHHHHHHHHHHccccccccccccccccEEEEcccccccccccccHHHHHHHHHHcccccHHHccccccccccEEEEEcccccccccccccccccccEEccHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHHHHHcccccEEEEEEccHHHHHHHHHHHHHccccHHHHHEccccHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHccHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHcccccccHHHHcccccccccccccccccccccccHHHEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEccccccHHHHHHHccHHHHccccccccEEEEccccccccccccccccEEEEEEEEEEccHHHHHHHHHHHccccEEEEEEEccccccccccccccccHHHccEEEEEEEEEEEEEcccccEEcccccccccccccEEEEEEEEcHHHHHHHHHHHHcccccHHccEEEEEEcccccccHHHHHHHHHHHHcccccccHHHHHHHHccccccHcHHHcccccccEEccccccccHHHHHHHccccEEEEcccccccccccEEEcHHHHHHHHcccccccEEEEccccccHHHHHHHHHHHHHHcccccEEEEEEccHHHHHHHHHHHHHccccHHHHHccccEEcHHHHHHHHHccHHHHHHcccEEEccccccccccHHHcccHHHHccccccccccccccccHHHHcccHHHEEEEEEccccHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcc
MFDFVFQLLEMLKFYARFEisdetgdpltdhdmtqIHYQNITSLQKAafakfpdlrsfslanvasvdtretltkhfepltplcvlkkrteeeenededvemenkdanvltttpprqAIIIGFLLIQVLKKrteeeenededvemenkdgkpiitvephvipsrgpylfneprkntipftpTQIEAIRAgmqpgltlvvgppgtgktDVAVQIISNLyhnfphqrTLIVTHSNQALNQLFEKIISldvderhllrlghgeealetekdfsrygrvNYVLAKRLDLLQEVERLQKSLDVSGDVAYTCETAGHFFLYQVLARWEKFLAtvrpsdgktvpvktiktefpfhgffenapkplfkeksyETDMEIAEGCFRYIEKMFTQLEEFRAFELLRSGLDRSKYLLVKEAKIIAMTCTHAALKRKELVDMgfsfsispiwvsfnTVSDLCSQISRHEKRSSQlealnsmplyptqeiiwnenivpteyfsgegclalpklNLQFLTLHDYLLRNFNLFRLESTCRVNYVLAKRLDLLQEVERLQKSLDVSGDVAYTCETAGHFFLYQVLARWEKFLATVRQRKqdrrkpavsrtniirekqpsrvRADVIVNLNVKREIKGEWESLRKHDVCFlitlkpplpigtkisykgpfleqtgltyvrgceiegmldvngriiedgpeprpvlpgdtrtFRVMLDCnqykedldnvaqgnEDVYETFNVLMRRKPKENNFKAVLETIRDLMNtecvvpdwlhdiilgygdpgaahytempneiatmdfndtflnmdhlrssfpqaeirvktdnptklvppfkltFHEIEAIRagmqpgltlvvgppgtgktDVAVQIISNLyhnfphqrTLIVTHSNQALNQLFEKIISLDvderhllhkkyriTPRYLLLAIKNDVELSQLLSDvtiaqggvmpniqsmkFDKTLKTLlspwksedgspffggwarmAQPIVNFAVVEVAKPNIEEALETEkdfsrygrvNYVLAKRLDLLQEVERLQKSLDVSGDVAYTCETAGHFFLYQVLARWEKFLATVRQTA
MFDFVFQLLEMLKFYARFEISDETGDPLTDHDMTQIHYQNITSLQKAAFAKFPDLRSFSLANVASVDTretltkhfepltplcvlkkrteeeenededvemenkdanvltttpprqaiIIGFLLIQVLKKRteeeenededvemenkdgkpiitvephvipsRGPYLFNEPRKNTIPFTPTQIEAIRAGMQPGLTLVVGPPGTGKTDVAVQIISNLYHNFPHQRTLIVTHSNQALNQLFEKIISLDVDERHLLRLGhgeealetekdfsrygrVNYVLAKRLDLLQEVERLQKSLDVSGDVAYTCETAGHFFLYQVLARWEKFLAtvrpsdgktvpvKTIKtefpfhgffenapkplFKEKSYETDMEIAEGCFRYIEKMFTQLEEFRAFELLRSGLDRSKYLLVKEAKIIAMTCTHAALKRKELVDMGFSFSISPIWVSFNTVSDLCSQISRHEKRSSQLEALNSMPLYPTQEIIWNENIVPTEYFSGEGCLALPKLNLQFLTLHDYLLRNFNLFRLESTCRVNYVLAKRLDLLQEVERLQKSLDVSGDVAYTCETAGHFFLYQVLARWEKFLATVRqrkqdrrkpavsrtniirekqpsrvradvivnlnvkreikgeweslrkhDVCFLITlkpplpigTKISYKGPFLEQTGLTYVRGCEIEGMLDVNgriiedgpeprpvlpgdtRTFRVMLDCNQYKEdldnvaqgnEDVYETFNvlmrrkpkenNFKAVLETIRDLMNTECVVPDWLHDIILGYGDPGAAHYTEMPNEIATMDFNDTFLNMDHLRSSFPQaeirvktdnptklvppfKLTFHEIEAIRAGMQPGLTLVVGPPGTGKTDVAVQIISNLYHNFPHQRTLIVTHSNQALNQLFEKIISLDVDERHLLHKKYRITPRYLLLAIKNDVELSQLLSDVTIAQGGVMPNIQSMKFDKTLKTLLSPWKSEDGSPFFGGWARMAQPIVNFAVVEVAKPNIEEAletekdfsrygrVNYVLAKRLDLLQEVERLQKSLDVSGDVAYTCETAGHFFLYQVLARWEKFLATVRQTA
MFDFVFQLLEMLKFYARFEISDETGDPLTDHDMTQIHYQNITSLQKAAFAKFPDLRSFSLANVASVDTRETLTKHFEPLTPLCVLKKRTeeeenededvemenKDANVLTTTPPRQAIIIGFLLIQVLKKRTeeeenededvemenKDGKPIITVEPHVIPSRGPYLFNEPRKNTIPFTPTQIEAIRAGMQPGLTLVVGPPGTGKTDVAVQIISNLYHNFPHQRTLIVTHSNQALNQLFEKIISLDVDERHLLRLGHGEEALETEKDFSRYGRVNYVLAKRLDLLQEVERLQKSLDVSGDVAYTCETAGHFFLYQVLARWEKFLATVRPSDGKTVPVKTIKTEFPFHGFFENAPKPLFKEKSYETDMEIAEGCFRYIEKMFTQLEEFRAFELLRSGLDRSKYLLVKEAKIIAMTCTHAALKRKELVDMGFSFSISPIWVSFNTVSDLCSQISRHEKRSSQLEALNSMPLYPTQEIIWNENIVPTEYFSGEGCLALPKLNLQFLTLHDYLLRNFNLFRLESTCRVNYVLAKRLDLLQEVERLQKSLDVSGDVAYTCETAGHFFLYQVLARWEKFLATVRQRKQDRRKPAVSRTNIIREKQPSRVRADVIVNLNVKREIKGEWESLRKHDVCFLITLKPPLPIGTKISYKGPFLEQTGLTYVRGCEIEGMLDVNGRIIEDGPEPRPVLPGDTRTFRVMLDCNQYKEDLDNVAQGNEDVYETFNVLMRRKPKENNFKAVLETIRDLMNTECVVPDWLHDIILGYGDPGAAHYTEMPNEIATMDFNDTFLNMDHLRSSFPQAEIRVKTDNPTKLVPPFKLTFHEIEAIRAGMQPGLTLVVGPPGTGKTDVAVQIISNLYHNFPHQRTLIVTHSNQALNQLFEKIISLDVDERHLLHKKYRITPRYLLLAIKNDVELSQLLSDVTIAQGGVMPNIQSMKFDKTLKTLLSPWKSEDGSPFFGGWARMAQPIVNFAVVEVAKPNIEEALETEKDFSRYGRVNYVLAKRLDLLQEVERLQKSLDVSGDVAYTCETAGHFFLYQVLARWEKFLATVRQTA
*FDFVFQLLEMLKFYARFEISDETGDPLTDHDMTQIHYQNITSLQKAAFAKFPDLRSFSLANVASVDTRETLTKHFEPLTPLCVL****************************PRQAIIIGFLLIQVLK**********************IITVEPHVIPSRGPYLFNEPRKNTIPFTPTQIEAIRAGMQPGLTLVVGPPGTGKTDVAVQIISNLYHNFPHQRTLIVTHSNQALNQLFEKIISLDVDERHLLRLGHGEEALETEKDFSRYGRVNYVLAKRLDLLQEVERLQKSLDVSGDVAYTCETAGHFFLYQVLARWEKFLATVRPSDGKTVPVKTIKTEFPFHGFFENAPKPLFKEKSYETDMEIAEGCFRYIEKMFTQLEEFRAFELLRSGLDRSKYLLVKEAKIIAMTCTHAALKRKELVDMGFSFSISPIWVSFNTVSDLCSQI*************NSMPLYPTQEIIWNENIVPTEYFSGEGCLALPKLNLQFLTLHDYLLRNFNLFRLESTCRVNYVLAKRLDLLQEVERLQKSLDVSGDVAYTCETAGHFFLYQVLARWEKFLATVR************************VRADVIVNLNVKREIKGEWESLRKHDVCFLITLKPPLPIGTKISYKGPFLEQTGLTYVRGCEIEGMLDVNGRIIEDG*****VLPGDTRTFRVMLDCNQYKEDLDNVAQGNEDVYETFNVLMRRKPKENNFKAVLETIRDLMNTECVVPDWLHDIILGYGDPGAAHYTEMPNEIATMDFNDTFLNMDHLRSSFPQAEIRVKTDNPTKLVPPFKLTFHEIEAIRAGMQPGLTLVVGPPGTGKTDVAVQIISNLYHNFPHQRTLIVTHSNQALNQLFEKIISLDVDERHLLHKKYRITPRYLLLAIKNDVELSQLLSDVTIAQGGVMPNIQSMKFDKTLKTLLSPWKSEDGSPFFGGWARMAQPIVNFAVVEVAKPNIEEALETEKDFSRYGRVNYVLAKRLDLLQEVERLQKSLDVSGDVAYTCETAGHFFLYQVLARWEKFLATV****
MFDFVFQLLEMLKFYARFEISDETGDPLTDHDMTQIHYQNITSLQKAAFAKFPDLRSFSLANVASVDTRETLTKHFEPLTPLCVLKKRTEEEENEDEDVEMENKDANVLTTTPPRQAIIIGFLLIQ********************************************PRKNTIPFTPTQIEAIRAGMQPGLTLVVGPPGTGKTDVAVQIISNLYHNFPHQRTLIVTHSNQALNQLFEKIISLDVDERHLLRL*****************RVNYVLAKRLDLLQEVERLQKSLDVSGDVAYTCETAGHFFLYQVLARWEKFLATVRPSDGKTVPVKTIKTEFPFHGFFENAPKPLFKEKSYETDMEIAEGCFRYIEKMFTQLEEFRAFELLRSGLDRSKYLLVKEAKIIAMTCTHAALKRKELVDMGFSFSISPIWVSFNTVSDLCSQISRHEKRSSQLEALNSMPLYPTQEIIWNENIVPTEYFSGEGCLALPKLNLQFLTLHDYLLRNFNLFRLESTCRVNYVLAKRLDLLQEVERLQK**********TCETAGHFFLYQVLARWEKFLATVRQRKQDRRKPAVSRTNIIREKQPSRVRADVIVNLNVKREIKGEWESLRKHDVCFLITLK*******************GLTYVRGCEIEGMLDV*******************RTFRVMLDCNQYKEDLDNVAQGNEDVYETFNVLMRRKPKENNFKAVLETIRDLMNTECVVPDWLHDIILGYGDPGAAHYTEMPNEIATMDFNDTFLNMDHLRSSFPQAEIRVKTDNPTKLVPPFKLTF*E*****************PPGTGKTDVAVQIISNLYHNFPHQRTLIVTHSNQALNQLFEKIISLDVDERHL*************************LSD**IAQGGVMPNIQSMKFDKTLKTL***********FFGGWARMAQPIVNFAVVEVAKPNIEEALETEKDFSRYGRVNYVLAKRLDLLQEVERLQKSLDVSGDVAYTCETAGHFFLYQVLARWEKFLATVRQ**
MFDFVFQLLEMLKFYARFEISDETGDPLTDHDMTQIHYQNITSLQKAAFAKFPDLRSFSLANVASVDTRETLTKHFEPLTPLCVLKKR***************KDANVLTTTPPRQAIIIGFLLIQVLKKR***************KDGKPIITVEPHVIPSRGPYLFNEPRKNTIPFTPTQIEAIRAGMQPGLTLVVGPPGTGKTDVAVQIISNLYHNFPHQRTLIVTHSNQALNQLFEKIISLDVDERHLLRLGHGEEALETEKDFSRYGRVNYVLAKRLDLLQEVERLQKSLDVSGDVAYTCETAGHFFLYQVLARWEKFLATVRPSDGKTVPVKTIKTEFPFHGFFENAPKPLFKEKSYETDMEIAEGCFRYIEKMFTQLEEFRAFELLRSGLDRSKYLLVKEAKIIAMTCTHAALKRKELVDMGFSFSISPIWVSFNTVSDLCSQISRHEKRSSQLEALNSMPLYPTQEIIWNENIVPTEYFSGEGCLALPKLNLQFLTLHDYLLRNFNLFRLESTCRVNYVLAKRLDLLQEVERLQKSLDVSGDVAYTCETAGHFFLYQVLARWEKFLATVR************RTNIIREKQPSRVRADVIVNLNVKREIKGEWESLRKHDVCFLITLKPPLPIGTKISYKGPFLEQTGLTYVRGCEIEGMLDVNGRIIEDGPEPRPVLPGDTRTFRVMLDCNQYKEDLDNVAQGNEDVYETFNVLMRRKPKENNFKAVLETIRDLMNTECVVPDWLHDIILGYGDPGAAHYTEMPNEIATMDFNDTFLNMDHLRSSFPQAEIRVKTDNPTKLVPPFKLTFHEIEAIRAGMQPGLTLVVGPPGTGKTDVAVQIISNLYHNFPHQRTLIVTHSNQALNQLFEKIISLDVDERHLLHKKYRITPRYLLLAIKNDVELSQLLSDVTIAQGGVMPNIQSMKFDKTLKTLLSPWKSEDGSPFFGGWARMAQPIVNFAVVEVAKPNIEEALETEKDFSRYGRVNYVLAKRLDLLQEVERLQKSLDVSGDVAYTCETAGHFFLYQVLARWEKFLATVRQTA
MFDFVFQLLEMLKFYARFEISDETGDPLTDHDMTQIHYQNITSLQKAAFAKFPDLRSFSLANVASVDTRETLTKHFEPLTPLCVLKKRTEEEENEDEDVEMENKDANVLTTTPPRQAIIIGFLLIQVLKKRTEEEENED**VEMENKDGKPIITVEPHVIPSRGPYLFNEPRKNTIPFTPTQIEAIRAGMQPGLTLVVGPPGTGKTDVAVQIISNLYHNFPHQRTLIVTHSNQALNQLFEKIISLDVDERHLLRLGHGEEALETEKDFSRYGRVNYVLAKRLDLLQEVERLQKSLDVSGDVAYTCETAGHFFLYQVLARWEKFLATVRPSDGKTVPVKTIKTEFPFHGFFENAPKPLFKEKSYETDMEIAEGCFRYIEKMFTQLEEFRAFELLRSGLDRSKYLLVKEAKIIAMTCTHAALKRKELVDMGFSFSISPIWVSFNTVSDLCSQISRHEKRSSQLEALNSMPLYPTQEIIWNENIVPTEYFSGEGCLALPKLNLQFLTLHDYLLRNFNLFRLESTCRVNYVLAKRLDLLQEVERLQKSLDVSGDVAYTCETAGHFFLYQVLARWEKFLATVRQRKQDRRKPAVSRTNIIREKQPSRVRADVIVNLNVKREIKGEWESLRKHDVCFLITLKPPLPIGTKISYKGPFLEQTGLTYVRGCEIEGMLDVNGRIIEDGPEPRPVLPGDTRTFRVMLDCNQYKEDLDNVAQGNEDVYETFNVLMRRKPKENNFKAVLETIRDLMNTECVVPDWLHDIILGYGDPGAAHYTEMPNEIATMDFNDTFLNMDHLRSSFPQAEIRVKTDNPTKLVPPFKLTFHEIEAIRAGMQPGLTLVVGPPGTGKTDVAVQIISNLYHNFPHQRTLIVTHSNQALNQLFEKIISLDVDERHLLHKKYRITPRYLLLAIKNDVELSQLLSDVTIAQGGVMPNIQSMKFDKTLKTLLSPWKSEDGSPFFGGWARMAQPIVNFAVVEVAKPNIEEALETEKDFSRYGRVNYVLAKRLDLLQEVERLQKSLDVSGDVAYTCETAGHFFLYQVLARWEKFLATVRQ**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFDFVFQLLEMLKFYARFEISDETGDPLTDHDMTQIHYQNITSLQKAAFAKFPDLRSFSLANVASVDTRETLTKHFEPLTPLCVLKxxxxxxxxxxxxxxxxxxxxxVLTTTPPRQAIIIGFLLxxxxxxxxxxxxxxxxxxxxxNKDGKPIITVEPHVIPSRGPYLFNEPRKNTIPFTPTQIEAIRAGMQPGLTLVVGPPGTGKTDVAVQIISNLYHNFPHQRTLIVTHSNQALNQLFEKIISLDVDERHLLRLGHGEEALETEKDFSRYGRVNYVLAKRLDLLQEVERLQKSLDVSGDVAYTCETAGHFFLYQVLARWEKFLATVRPSDGKTVPVKTIKTEFPFHGFFENAPKPLFKEKSYETDMEIAEGCFRYIEKMFTQLEEFRAFELLRSGLDRSKYLLVKEAKIIAMTCTHAALKRKELVDMGFSFSISPIWVSFNTVSDLCSQISRHEKRSSQLEALNSMPLYPTQEIIWNENIVPTEYFSGEGCLALPKLNLQFLTLHDYLLRNFNLFRLESTCRVNYVLAKRLDLLQEVERLQKSLDVSGDVAYTCETAGHFFLYQVLARWEKFLATVRQRKQDRRKPAVSRTNIIREKQPSRVRADVIVNLNVKREIKGEWESLRKHDVCFLITLKPPLPIGTKISYKGPFLEQTGLTYVRGCEIEGMLDVNGRIIEDGPEPRPVLPGDTRTFRVMLDCNQYKEDLDNVAQGNEDVYETFNVLMRRKPKENNFKAVLETIRDLMNTECVVPDWLHDIILGYGDPGAAHYTEMPNEIATMDFNDTFLNMDHLRSSFPQAEIRVKTDNPTKLVPPFKLTFHEIEAIRAGMQPGLTLVVGPPGTGKTDVAVQIISNLYHNFPHQRTLIVTHSNQALNQLFEKIISLDVDERHLLHKKYRITPRYLLLAIKNDVELSQLLSDVTIAQGGVMPNIQSMKFDKTLKTLLSPWKSEDGSPFFGGWARMAQPIVNFAVVEVAKPNIEEALETEKDFSRYGRVNYVLAKRLDLLQEVERLQKSLDVSGDVAYTCETAGHFFLYQVLARWEKFLATVRQTA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1051 2.2.26 [Sep-21-2011]
O60306 1485 Intron-binding protein aq yes N/A 0.386 0.273 0.550 1e-153
Q8CFQ3 1481 Intron-binding protein aq yes N/A 0.386 0.274 0.550 1e-152
O945081284 Pre-mRNA-splicing factor yes N/A 0.254 0.208 0.300 1e-24
P02269125 Histone H2A OS=Asterias r N/A N/A 0.043 0.368 0.652 7e-09
Q9LHQ5132 Probable histone H2A.2 OS no N/A 0.043 0.348 0.630 7e-09
P16104143 Histone H2A.x OS=Homo sap no N/A 0.051 0.377 0.555 8e-09
Q9C681132 Probable histone H2A.1 OS no N/A 0.054 0.431 0.559 8e-09
Q6WV67125 Histone H2A OS=Mytilus tr N/A N/A 0.043 0.368 0.652 1e-08
P27661143 Histone H2A.x OS=Mus musc no N/A 0.051 0.377 0.555 1e-08
P40279136 Histone H2A OS=Euglena gr N/A N/A 0.046 0.360 0.612 1e-08
>sp|O60306|AQR_HUMAN Intron-binding protein aquarius OS=Homo sapiens GN=AQR PE=1 SV=4 Back     alignment and function desciption
 Score =  541 bits (1395), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 278/505 (55%), Positives = 337/505 (66%), Gaps = 99/505 (19%)

Query: 451 ISRHEKRSSQLEALNSMPLYPTQEIIWNENIVPTEYFSGEGCLALPKLNLQFLTLHDYLL 510
           +SRHE+R SQ++ LN MPLYPT++IIW+ENIVPTEY+SGEGCLALPKLNLQFLTLHDYLL
Sbjct: 408 VSRHERRISQIQQLNQMPLYPTEKIIWDENIVPTEYYSGEGCLALPKLNLQFLTLHDYLL 467

Query: 511 RNFNLFRLESTCRVNYVLAKRLDLLQEVERLQKSLDVSGDVAYTCETAGHFFLYQVLARW 570
           RNFNLFRLEST  +      R D+   V R++      G V              V   W
Sbjct: 468 RNFNLFRLESTYEI------RQDIEDSVSRMKPWQSEYGGV--------------VFGGW 507

Query: 571 EKFLATVRQRKQDRRKPAVSRTNI------IREKQPSRVRADVIVNLNVKREIKGEWESL 624
            +             +P V+ T +      I E  P+RVRADV +NLNV+  IK EWE L
Sbjct: 508 ARMA-----------QPIVAFTVVEVAKPNIGENWPTRVRADVTINLNVRDHIKDEWEGL 556

Query: 625 RKHDVCFLITLKPPLPIGTKISYKGPFLEQTGLTYVRGCEIEGMLDVNGRIIEDGPEPRP 684
           RKHDVCFLIT++P  P GTK   + PF+EQ GL YVRGCEI+GMLD  GR+IEDGPEPRP
Sbjct: 557 RKHDVCFLITVRPTKPYGTKFDRRRPFIEQVGLVYVRGCEIQGMLDDKGRVIEDGPEPRP 616

Query: 685 VLPGDTRTFRVMLDCNQYKEDLDNVAQ-GNEDVYETFNVLMRRKPKENNFKAVLETIRDL 743
            L G++RTFRV LD NQY++D+ N  Q G EDVYETFN++MRRKPKENNFKAVLETIR+L
Sbjct: 617 NLRGESRTFRVFLDPNQYQQDMTNTIQNGAEDVYETFNIIMRRKPKENNFKAVLETIRNL 676

Query: 744 MNTECVVPDWLHDIILGYGDPGAAHYTEMPNEIATMDFNDTFLNMDHLRSSFPQAEIRVK 803
           MNT+CVVPDWLHDIILGYGDP +AHY++MPN+IAT+DFNDTFL+++HL++SFP   ++V 
Sbjct: 677 MNTDCVVPDWLHDIILGYGDPSSAHYSKMPNQIATLDFNDTFLSIEHLKASFPGHNVKVT 736

Query: 804 TDNPTKLVPPFKLTFHEIEAIRAG--------------MQPGLTLVVGP----------- 838
            ++P   +PPF++TF     +R+G               +   TL+V P           
Sbjct: 737 VEDPALQIPPFRITF----PVRSGKGKKRKDADVEDEDTEEAKTLIVEPHVIPNRGPYPY 792

Query: 839 --------------------------------PGTGKTDVAVQIISNLYHNFPHQRTLIV 866
                                           PGTGKTDVAVQIISN+YHNFP QRTLIV
Sbjct: 793 NQPKRNTIQFTHTQIEAIRAGMQPGLTMVVGPPGTGKTDVAVQIISNIYHNFPEQRTLIV 852

Query: 867 THSNQALNQLFEKIISLDVDERHLL 891
           THSNQALNQLFEKI++LD+DERHLL
Sbjct: 853 THSNQALNQLFEKIMALDIDERHLL 877
Intron-binding spliceosomal protein required to link pre-mRNA splicing and snoRNP (small nucleolar ribonucleoprotein) biogenesis. Plays a key role in position-dependent assembly of intron-encoded box C/D small snoRNP, splicing being required for snoRNP assembly. May act by helping the folding of the snoRNA sequence. Binds to intron of pre-mRNAs in a sequence-independent manner, contacting the region between snoRNA and the branchpoint of introns (40 nucleotides upstream of the branchpoint) during the late stages of splicing.
Homo sapiens (taxid: 9606)
>sp|Q8CFQ3|AQR_MOUSE Intron-binding protein aquarius OS=Mus musculus GN=Aqr PE=2 SV=2 Back     alignment and function description
>sp|O94508|CWF11_SCHPO Pre-mRNA-splicing factor cwf11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf11 PE=1 SV=1 Back     alignment and function description
>sp|P02269|H2A_ASTRU Histone H2A OS=Asterias rubens PE=1 SV=2 Back     alignment and function description
>sp|Q9LHQ5|H2A2_ARATH Probable histone H2A.2 OS=Arabidopsis thaliana GN=At3g20670 PE=1 SV=1 Back     alignment and function description
>sp|P16104|H2AX_HUMAN Histone H2A.x OS=Homo sapiens GN=H2AFX PE=1 SV=2 Back     alignment and function description
>sp|Q9C681|H2A1_ARATH Probable histone H2A.1 OS=Arabidopsis thaliana GN=At1g51060 PE=1 SV=1 Back     alignment and function description
>sp|Q6WV67|H2A_MYTTR Histone H2A OS=Mytilus trossulus PE=3 SV=3 Back     alignment and function description
>sp|P27661|H2AX_MOUSE Histone H2A.x OS=Mus musculus GN=H2afx PE=1 SV=2 Back     alignment and function description
>sp|P40279|H2A_EUGGR Histone H2A OS=Euglena gracilis PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1051
328784311 1442 PREDICTED: intron-binding protein aquari 0.395 0.288 0.648 1e-177
380024866 1442 PREDICTED: intron-binding protein aquari 0.395 0.288 0.648 1e-177
350422268 1448 PREDICTED: intron-binding protein aquari 0.395 0.287 0.644 1e-176
340714490 1448 PREDICTED: intron-binding protein aquari 0.395 0.287 0.644 1e-176
383859427 1445 PREDICTED: intron-binding protein aquari 0.395 0.287 0.648 1e-176
156543431 1480 PREDICTED: intron-binding protein aquari 0.395 0.281 0.638 1e-174
3320271021151 Intron-binding protein aquarius [Acromyr 0.394 0.360 0.637 1e-174
3071767721145 Intron-binding protein aquarius [Campono 0.394 0.362 0.639 1e-173
3227958601110 hypothetical protein SINV_80060 [Solenop 0.394 0.373 0.632 1e-172
307210786 1153 Intron-binding protein aquarius [Harpegn 0.394 0.359 0.630 1e-172
>gi|328784311|ref|XP_396990.3| PREDICTED: intron-binding protein aquarius [Apis mellifera] Back     alignment and taxonomy information
 Score =  628 bits (1620), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 314/484 (64%), Positives = 361/484 (74%), Gaps = 68/484 (14%)

Query: 451 ISRHEKRSSQLEALNSMPLYPTQEIIWNENIVPTEYFSGEGCLALPKLNLQFLTLHDYLL 510
           ISRHE+R+SQLE LN MPLYPT+EIIWNE+IVPTEYFSGEGCLALPKLNLQFLTLHDYLL
Sbjct: 409 ISRHERRASQLEELNEMPLYPTEEIIWNESIVPTEYFSGEGCLALPKLNLQFLTLHDYLL 468

Query: 511 RNFNLFRLESTCRVNYVLAKRLDLLQEVERLQKSLDVSGDVAYTCETAGHFFLYQVLARW 570
           RNFNLFRLEST  +      R D+   V RL           +  E  G +F       W
Sbjct: 469 RNFNLFRLESTYEI------RQDIEDAVSRLS---------PWRAEDGGVYF-----GGW 508

Query: 571 EKFLATVRQRKQDRRKPAVSRTNIIREKQPSRVRADVIVNLNVKREIKGEWESLRKHDVC 630
            +    + Q         V++ NI  EK+PSRVRADV +NL+V++EIK EWE+LRKHDVC
Sbjct: 509 ARMAQPITQFA----VVEVAKPNI-GEKRPSRVRADVTINLSVRKEIKSEWENLRKHDVC 563

Query: 631 FLITLKPPLPIGTKISYKGPFLEQTGLTYVRGCEIEGMLDVNGRIIEDGPEPRPVLPGDT 690
           FLIT+KP   IGTK S+K PF+ Q GLT VRGCE+EGMLD NGR+IEDGPEPRP+LPGDT
Sbjct: 564 FLITVKPQNLIGTKYSHKLPFVPQVGLTTVRGCEVEGMLDSNGRVIEDGPEPRPILPGDT 623

Query: 691 RTFRVMLDCNQYKEDLDNVAQGNEDVYETFNVLMRRKPKENNFKAVLETIRDLMNTECVV 750
           RT+RV LDCNQY+ D+DN + G EDVYE+FNV+MRRKPKENNFKAVLETIR+LMNTECVV
Sbjct: 624 RTYRVWLDCNQYRIDMDNASHGGEDVYESFNVIMRRKPKENNFKAVLETIRELMNTECVV 683

Query: 751 PDWLHDIILGYGDPGAAHYTEMPNEIATMDFNDTFLNMDHLRSSFPQAEIRVKTDNPTKL 810
           PDWLHDIILGYGDPGAA Y+ MPNEIATMDFNDTFL+++HL++SFPQ EI++ TD  +KL
Sbjct: 684 PDWLHDIILGYGDPGAARYSRMPNEIATMDFNDTFLDINHLKNSFPQYEIKISTDEESKL 743

Query: 811 VPPFKLTFH-------------------------------------------EIEAIRAG 827
           V PF+LTF                                            ++EAIRAG
Sbjct: 744 VRPFRLTFEDVLAKHNNESIKKVIKVEPHVPPSRGPYKANEPKKNQIPFTPTQVEAIRAG 803

Query: 828 MQPGLTLVVGPPGTGKTDVAVQIISNLYHNFPHQRTLIVTHSNQALNQLFEKIISLDVDE 887
           MQPGLTLVVGPPGTGKTDVAVQIISNLYHNFP+QRTLIVTHSNQALNQLFEKI++LD+DE
Sbjct: 804 MQPGLTLVVGPPGTGKTDVAVQIISNLYHNFPNQRTLIVTHSNQALNQLFEKIMALDIDE 863

Query: 888 RHLL 891
           RHLL
Sbjct: 864 RHLL 867

Source: Apis mellifera

Species: Apis mellifera

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|380024866|ref|XP_003696210.1| PREDICTED: intron-binding protein aquarius [Apis florea] Back     alignment and taxonomy information
>gi|350422268|ref|XP_003493110.1| PREDICTED: intron-binding protein aquarius-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340714490|ref|XP_003395761.1| PREDICTED: intron-binding protein aquarius-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|383859427|ref|XP_003705196.1| PREDICTED: intron-binding protein aquarius [Megachile rotundata] Back     alignment and taxonomy information
>gi|156543431|ref|XP_001600886.1| PREDICTED: intron-binding protein aquarius [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|332027102|gb|EGI67198.1| Intron-binding protein aquarius [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307176772|gb|EFN66172.1| Intron-binding protein aquarius [Camponotus floridanus] Back     alignment and taxonomy information
>gi|322795860|gb|EFZ18539.1| hypothetical protein SINV_80060 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|307210786|gb|EFN87169.1| Intron-binding protein aquarius [Harpegnathos saltator] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1051
UNIPROTKB|F1NPB81416 AQR "Uncharacterized protein" 0.271 0.201 0.762 4.3e-143
RGD|13062231353 Aqr "aquarius homolog (mouse)" 0.271 0.210 0.751 1.5e-140
UNIPROTKB|O603061485 AQR "Intron-binding protein aq 0.270 0.191 0.763 1.4e-142
MGI|MGI:12761021481 Aqr "aquarius" [Mus musculus ( 0.270 0.191 0.749 1e-139
ZFIN|ZDB-GENE-040426-11891525 aqr "aquarius homolog (mouse)" 0.267 0.184 0.761 4.7e-146
UNIPROTKB|F1PA161483 AQR "Uncharacterized protein" 0.269 0.190 0.745 2.4e-138
FB|FBgn00513681486 CG31368 [Drosophila melanogast 0.266 0.188 0.713 2.1e-131
UNIPROTKB|F1MUW21466 F1MUW2 "Uncharacterized protei 0.269 0.193 0.749 1.5e-140
UNIPROTKB|F1SRZ71206 F1SRZ7 "Uncharacterized protei 0.270 0.235 0.742 2.4e-138
WB|WBGene000012581467 emb-4 [Caenorhabditis elegans 0.263 0.188 0.653 1.6e-109
UNIPROTKB|F1NPB8 AQR "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 1174 (418.3 bits), Expect = 4.3e-143, Sum P(2) = 4.3e-143
 Identities = 218/286 (76%), Positives = 258/286 (90%)

Query:   147 KDGKPIITVEPHVIPSRGPYLFNEPRKNTIPFTPTQIEAIRAGMQPGLTLVVGPPGTGKT 206
             ++ K +I VEPH+IP+RGPY +N+P++NTI FT TQIEAIRAGMQPGLT+VVGPPGTGKT
Sbjct:   781 EEAKTLI-VEPHIIPNRGPYPYNQPKRNTIQFTHTQIEAIRAGMQPGLTMVVGPPGTGKT 839

Query:   207 DVAVQIISNLYHNFPHQRTLIVTHSNQALNQLFEKIISLDVDERHLLRLGHGEEALETEK 266
             DVAVQIISNLYHNFP QRTLIVTHSNQALNQLFEKI++LD+DERHLLRLGHGEE LETEK
Sbjct:   840 DVAVQIISNLYHNFPEQRTLIVTHSNQALNQLFEKIMALDIDERHLLRLGHGEEELETEK 899

Query:   267 DFSRYGRVNYVLAKRLDLLQEVERLQKSLDVSGDVAYTCETAGHFFLYQVLARWEKFLAT 326
             DFSRYGRVNYVLA+RL+LL+EV RLQ+SL V GDV+YTCETAGHFFLYQV++RWE++++ 
Sbjct:   900 DFSRYGRVNYVLARRLELLREVGRLQESLGVPGDVSYTCETAGHFFLYQVMSRWEEYISK 959

Query:   327 VRPSDGKTVPVKTIKTEFPFHGFFENAPKPLFKEKSYETDMEIAEGCFRYIEKMFTQLEE 386
             V+   GK   V  + + FPFH +F NAP+P+F+ +SYE DMEIAEGCFR+++K+FTQLEE
Sbjct:   960 VKVKGGKLPDVTDVSSFFPFHQYFANAPQPIFRGRSYEEDMEIAEGCFRHLKKIFTQLEE 1019

Query:   387 FRAFELLRSGLDRSKYLLVKEAKIIAMTCTHAALKRKELVDMGFSF 432
             FRAFELLRSGLDRSKYLLVKEAKIIAMTCTHAALKR +LV++GF +
Sbjct:  1020 FRAFELLRSGLDRSKYLLVKEAKIIAMTCTHAALKRHDLVELGFKY 1065
GO:0000398 "mRNA splicing, via spliceosome" evidence=IEA
GO:0097157 "pre-mRNA intronic binding" evidence=IEA
GO:0071013 "catalytic step 2 spliceosome" evidence=IEA
RGD|1306223 Aqr "aquarius homolog (mouse)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|O60306 AQR "Intron-binding protein aquarius" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1276102 Aqr "aquarius" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1189 aqr "aquarius homolog (mouse)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1PA16 AQR "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
FB|FBgn0051368 CG31368 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1MUW2 F1MUW2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1SRZ7 F1SRZ7 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
WB|WBGene00001258 emb-4 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1051
PTZ00017134 PTZ00017, PTZ00017, histone H2A; Provisional 6e-16
cd00074115 cd00074, H2A, Histone 2A; H2A is a subunit of the 7e-16
pfam13086220 pfam13086, AAA_11, AAA domain 4e-15
smart00414106 smart00414, H2A, Histone 2A 6e-14
PLN00157132 PLN00157, PLN00157, histone H2A; Provisional 7e-14
PLN00156139 PLN00156, PLN00156, histone H2AX; Provisional 3e-11
COG5262132 COG5262, HTA1, Histone H2A [Chromatin structure an 7e-11
pfam13086220 pfam13086, AAA_11, AAA domain 1e-10
PLN00153129 PLN00153, PLN00153, histone H2A; Provisional 3e-10
pfam1324573 pfam13245, AAA_19, Part of AAA domain 1e-09
pfam1324573 pfam13245, AAA_19, Part of AAA domain 9e-09
TIGR00376637 TIGR00376, TIGR00376, DNA helicase, putative 5e-08
PTZ00252134 PTZ00252, PTZ00252, histone H2A; Provisional 3e-07
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 1e-06
PLN00154136 PLN00154, PLN00154, histone H2A; Provisional 3e-06
pfam04851100 pfam04851, ResIII, Type III restriction enzyme, re 6e-06
pfam04851100 pfam04851, ResIII, Type III restriction enzyme, re 4e-05
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 2e-04
COG1061442 COG1061, SSL2, DNA or RNA helicases of superfamily 0.002
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 0.002
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 0.002
COG1061 442 COG1061, SSL2, DNA or RNA helicases of superfamily 0.004
>gnl|CDD|185399 PTZ00017, PTZ00017, histone H2A; Provisional Back     alignment and domain information 
 Score = 75.2 bits (185), Expect = 6e-16
 Identities = 28/50 (56%), Positives = 37/50 (74%)

Query: 892 HKKYRITPRYLLLAIKNDVELSQLLSDVTIAQGGVMPNIQSMKFDKTLKT 941
           +KK RITPR++ LAI+ND EL++LL+ VTIA GGV+PNI  +   K  K 
Sbjct: 76  NKKKRITPRHIQLAIRNDEELNKLLAGVTIASGGVLPNIHKVLLPKKSKP 125

Length = 134
>gnl|CDD|238029 cd00074, H2A, Histone 2A; H2A is a subunit of the nucleosome Back     alignment and domain information
>gnl|CDD|221912 pfam13086, AAA_11, AAA domain Back     alignment and domain information
>gnl|CDD|197711 smart00414, H2A, Histone 2A Back     alignment and domain information
>gnl|CDD|177758 PLN00157, PLN00157, histone H2A; Provisional Back     alignment and domain information
>gnl|CDD|215080 PLN00156, PLN00156, histone H2AX; Provisional Back     alignment and domain information
>gnl|CDD|227587 COG5262, HTA1, Histone H2A [Chromatin structure and dynamics] Back     alignment and domain information
>gnl|CDD|221912 pfam13086, AAA_11, AAA domain Back     alignment and domain information
>gnl|CDD|165721 PLN00153, PLN00153, histone H2A; Provisional Back     alignment and domain information
>gnl|CDD|222005 pfam13245, AAA_19, Part of AAA domain Back     alignment and domain information
>gnl|CDD|222005 pfam13245, AAA_19, Part of AAA domain Back     alignment and domain information
>gnl|CDD|232945 TIGR00376, TIGR00376, DNA helicase, putative Back     alignment and domain information
>gnl|CDD|240330 PTZ00252, PTZ00252, histone H2A; Provisional Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|177756 PLN00154, PLN00154, histone H2A; Provisional Back     alignment and domain information
>gnl|CDD|218292 pfam04851, ResIII, Type III restriction enzyme, res subunit Back     alignment and domain information
>gnl|CDD|218292 pfam04851, ResIII, Type III restriction enzyme, res subunit Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|223989 COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|223989 COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1051
KOG1806|consensus 1320 100.0
KOG1806|consensus1320 100.0
KOG1802|consensus935 99.9
TIGR00376637 DNA helicase, putative. The gene product may repre 99.87
KOG1803|consensus649 99.86
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 99.85
KOG1805|consensus1100 99.8
TIGR00376 637 DNA helicase, putative. The gene product may repre 99.66
KOG1803|consensus 649 99.62
KOG1802|consensus 935 99.57
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 99.55
KOG1807|consensus1025 99.45
KOG1805|consensus 1100 99.32
PF1324576 AAA_19: Part of AAA domain 99.27
PF1324576 AAA_19: Part of AAA domain 99.25
KOG1807|consensus 1025 98.98
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 98.95
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 98.89
PF00580315 UvrD-helicase: UvrD/REP helicase N-terminal domain 98.77
PF00580315 UvrD-helicase: UvrD/REP helicase N-terminal domain 98.72
TIGR01447586 recD exodeoxyribonuclease V, alpha subunit. This f 98.66
PRK10875615 recD exonuclease V subunit alpha; Provisional 98.63
TIGR01447 586 recD exodeoxyribonuclease V, alpha subunit. This f 98.57
PRK10875 615 recD exonuclease V subunit alpha; Provisional 98.54
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 98.49
PRK10919672 ATP-dependent DNA helicase Rep; Provisional 98.42
TIGR01448 720 recD_rel helicase, putative, RecD/TraA family. Thi 98.39
PRK10919 672 ATP-dependent DNA helicase Rep; Provisional 98.35
PRK11773721 uvrD DNA-dependent helicase II; Provisional 98.34
TIGR01075715 uvrD DNA helicase II. Designed to identify uvrD me 98.34
TIGR02768744 TraA_Ti Ti-type conjugative transfer relaxase TraA 98.33
PRK11773 721 uvrD DNA-dependent helicase II; Provisional 98.3
TIGR01075 715 uvrD DNA helicase II. Designed to identify uvrD me 98.29
smart00487201 DEXDc DEAD-like helicases superfamily. 98.27
PRK11054 684 helD DNA helicase IV; Provisional 98.25
PRK11054684 helD DNA helicase IV; Provisional 98.24
TIGR01074664 rep ATP-dependent DNA helicase Rep. Designed to id 98.23
smart00487201 DEXDc DEAD-like helicases superfamily. 98.22
TIGR02768 744 TraA_Ti Ti-type conjugative transfer relaxase TraA 98.22
PRK13889988 conjugal transfer relaxase TraA; Provisional 98.2
TIGR01073726 pcrA ATP-dependent DNA helicase PcrA. Designed to 98.18
TIGR01074 664 rep ATP-dependent DNA helicase Rep. Designed to id 98.17
TIGR01073 726 pcrA ATP-dependent DNA helicase PcrA. Designed to 98.13
PRK13889 988 conjugal transfer relaxase TraA; Provisional 98.07
PRK138261102 Dtr system oriT relaxase; Provisional 98.03
PRK147121623 conjugal transfer nickase/helicase TraI; Provision 97.96
PF04851184 ResIII: Type III restriction enzyme, res subunit; 97.93
PRK13826 1102 Dtr system oriT relaxase; Provisional 97.93
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 97.93
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 97.91
PF04851184 ResIII: Type III restriction enzyme, res subunit; 97.9
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 97.88
PF05970 364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 97.86
PRK137091747 conjugal transfer nickase/helicase TraI; Provision 97.85
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 97.81
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 97.81
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 97.81
COG0210655 UvrD Superfamily I DNA and RNA helicases [DNA repl 97.76
PRK14712 1623 conjugal transfer nickase/helicase TraI; Provision 97.76
COG0210 655 UvrD Superfamily I DNA and RNA helicases [DNA repl 97.7
PRK13709 1747 conjugal transfer nickase/helicase TraI; Provision 97.67
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 97.65
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 97.5
PTZ00252134 histone H2A; Provisional 97.45
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 97.42
cd01124187 KaiC KaiC is a circadian clock protein primarily f 97.42
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 97.41
PLN00153129 histone H2A; Provisional 97.39
TIGR02785 1232 addA_Gpos recombination helicase AddA, Firmicutes 97.39
PLN00156139 histone H2AX; Provisional 97.38
cd01124187 KaiC KaiC is a circadian clock protein primarily f 97.38
PTZ00017134 histone H2A; Provisional 97.37
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 97.33
PLN00157132 histone H2A; Provisional 97.32
TIGR02785 1232 addA_Gpos recombination helicase AddA, Firmicutes 97.26
smart00414106 H2A Histone 2A. 97.23
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 97.18
PHA02558501 uvsW UvsW helicase; Provisional 97.17
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 97.14
cd00074115 H2A Histone 2A; H2A is a subunit of the nucleosome 97.13
PLN00154136 histone H2A; Provisional 97.12
PRK10536262 hypothetical protein; Provisional 97.08
PHA02558 501 uvsW UvsW helicase; Provisional 97.07
PRK05580 679 primosome assembly protein PriA; Validated 97.03
PRK10536262 hypothetical protein; Provisional 97.02
TIGR00643 630 recG ATP-dependent DNA helicase RecG. 96.99
KOG1756|consensus131 96.98
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 96.98
PRK05580679 primosome assembly protein PriA; Validated 96.96
PRK07952244 DNA replication protein DnaC; Validated 96.96
PRK07952244 DNA replication protein DnaC; Validated 96.93
PRK08181269 transposase; Validated 96.93
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 96.92
PTZ00424401 helicase 45; Provisional 96.91
smart00382148 AAA ATPases associated with a variety of cellular 96.89
COG1061 442 SSL2 DNA or RNA helicases of superfamily II [Trans 96.84
PRK08181269 transposase; Validated 96.83
smart00382148 AAA ATPases associated with a variety of cellular 96.81
PTZ00424 401 helicase 45; Provisional 96.81
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 96.81
PRK12377248 putative replication protein; Provisional 96.79
TIGR00643630 recG ATP-dependent DNA helicase RecG. 96.79
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 96.79
TIGR00609 1087 recB exodeoxyribonuclease V, beta subunit. All pro 96.77
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 96.76
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 96.76
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 96.72
COG1112767 Superfamily I DNA and RNA helicases and helicase s 96.71
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 96.7
PRK05973237 replicative DNA helicase; Provisional 96.7
PRK08533230 flagellar accessory protein FlaH; Reviewed 96.7
COG3973 747 Superfamily I DNA and RNA helicases [General funct 96.68
PRK08116268 hypothetical protein; Validated 96.67
COG5262132 HTA1 Histone H2A [Chromatin structure and dynamics 96.65
PRK12377248 putative replication protein; Provisional 96.63
TIGR00609 1087 recB exodeoxyribonuclease V, beta subunit. All pro 96.62
PRK01172674 ski2-like helicase; Provisional 96.62
PRK05973237 replicative DNA helicase; Provisional 96.61
PRK11192 434 ATP-dependent RNA helicase SrmB; Provisional 96.6
KOG1757|consensus131 96.6
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 96.59
PRK13833323 conjugal transfer protein TrbB; Provisional 96.59
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 96.58
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 96.58
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 96.56
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 96.56
PRK01172 674 ski2-like helicase; Provisional 96.53
PRK06526254 transposase; Provisional 96.5
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 96.48
PRK08533230 flagellar accessory protein FlaH; Reviewed 96.47
KOG0989|consensus346 96.47
PRK14974336 cell division protein FtsY; Provisional 96.45
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 96.45
PRK11634629 ATP-dependent RNA helicase DeaD; Provisional 96.44
PRK13894319 conjugal transfer ATPase TrbB; Provisional 96.43
KOG0989|consensus346 96.42
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 96.41
PRK06526254 transposase; Provisional 96.39
PRK06893229 DNA replication initiation factor; Validated 96.38
PRK14974336 cell division protein FtsY; Provisional 96.38
PRK10689 1147 transcription-repair coupling factor; Provisional 96.38
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 96.37
PRK08116268 hypothetical protein; Validated 96.36
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 96.36
PRK06067234 flagellar accessory protein FlaH; Validated 96.36
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 96.35
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 96.35
COG1484254 DnaC DNA replication protein [DNA replication, rec 96.35
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 96.34
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 96.34
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 96.33
TIGR00064272 ftsY signal recognition particle-docking protein F 96.32
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 96.31
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 96.31
PF00004132 AAA: ATPase family associated with various cellula 96.3
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 96.3
COG3973747 Superfamily I DNA and RNA helicases [General funct 96.3
PRK13833323 conjugal transfer protein TrbB; Provisional 96.3
COG0467260 RAD55 RecA-superfamily ATPases implicated in signa 96.29
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 96.29
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 96.29
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 96.28
PRK08084235 DNA replication initiation factor; Provisional 96.28
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 96.28
PF00004132 AAA: ATPase family associated with various cellula 96.28
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 96.25
PRK106891147 transcription-repair coupling factor; Provisional 96.25
TIGR00603 732 rad25 DNA repair helicase rad25. All proteins in t 96.24
PRK09401 1176 reverse gyrase; Reviewed 96.24
PRK13894319 conjugal transfer ATPase TrbB; Provisional 96.24
PRK06067234 flagellar accessory protein FlaH; Validated 96.23
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 96.23
PRK10876 1181 recB exonuclease V subunit beta; Provisional 96.23
PRK04328249 hypothetical protein; Provisional 96.22
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 96.22
TIGR02525372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 96.21
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 96.21
TIGR00064272 ftsY signal recognition particle-docking protein F 96.2
PRK114481123 hsdR type I restriction enzyme EcoKI subunit R; Pr 96.2
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 96.2
COG0467260 RAD55 RecA-superfamily ATPases implicated in signa 96.19
smart00488289 DEXDc2 DEAD-like helicases superfamily. 96.17
smart00489289 DEXDc3 DEAD-like helicases superfamily. 96.17
PRK09183259 transposase/IS protein; Provisional 96.17
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 96.16
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 96.16
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 96.15
PF09848 352 DUF2075: Uncharacterized conserved protein (DUF207 96.15
KOG0743|consensus457 96.15
PRK04328249 hypothetical protein; Provisional 96.13
PRK08084235 DNA replication initiation factor; Provisional 96.13
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 96.11
PRK00254720 ski2-like helicase; Provisional 96.11
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 96.1
PRK06893229 DNA replication initiation factor; Validated 96.09
PRK09401 1176 reverse gyrase; Reviewed 96.06
PRK08903227 DnaA regulatory inactivator Hda; Validated 96.04
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 96.04
cd03115173 SRP The signal recognition particle (SRP) mediates 96.04
PRK10416318 signal recognition particle-docking protein FtsY; 96.03
PRK10590 456 ATP-dependent RNA helicase RhlE; Provisional 96.02
PRK10867 433 signal recognition particle protein; Provisional 96.02
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 96.02
TIGR02928365 orc1/cdc6 family replication initiation protein. M 96.02
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 96.02
TIGR01970819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 96.02
COG1484254 DnaC DNA replication protein [DNA replication, rec 96.01
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 96.01
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 96.0
KOG0744|consensus423 96.0
PRK04837 423 ATP-dependent RNA helicase RhlB; Provisional 95.99
PRK04296190 thymidine kinase; Provisional 95.99
PRK09183259 transposase/IS protein; Provisional 95.97
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 95.97
PRK06835329 DNA replication protein DnaC; Validated 95.97
PRK10416318 signal recognition particle-docking protein FtsY; 95.96
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 95.96
PRK08903227 DnaA regulatory inactivator Hda; Validated 95.96
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 95.95
PRK00771 437 signal recognition particle protein Srp54; Provisi 95.95
cd03115173 SRP The signal recognition particle (SRP) mediates 95.95
TIGR02784 1141 addA_alphas double-strand break repair helicase Ad 95.92
PRK04296190 thymidine kinase; Provisional 95.92
PRK00771437 signal recognition particle protein Srp54; Provisi 95.9
PRK11664812 ATP-dependent RNA helicase HrpB; Provisional 95.9
TIGR02928 365 orc1/cdc6 family replication initiation protein. M 95.9
KOG0744|consensus423 95.88
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 95.88
PRK04537572 ATP-dependent RNA helicase RhlB; Provisional 95.88
PRK09361225 radB DNA repair and recombination protein RadB; Pr 95.87
PLN03025319 replication factor C subunit; Provisional 95.85
PRK06851367 hypothetical protein; Provisional 95.85
PRK08727233 hypothetical protein; Validated 95.85
PRK02362737 ski2-like helicase; Provisional 95.83
TIGR02237209 recomb_radB DNA repair and recombination protein R 95.78
cd01394218 radB RadB. The archaeal protein radB shares simila 95.77
PRK00254 720 ski2-like helicase; Provisional 95.77
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 95.77
TIGR01587 358 cas3_core CRISPR-associated helicase Cas3. This mo 95.77
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 95.75
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 95.74
PLN03025319 replication factor C subunit; Provisional 95.74
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 95.74
TIGR02533486 type_II_gspE general secretory pathway protein E. 95.74
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 95.73
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 95.73
PRK09361225 radB DNA repair and recombination protein RadB; Pr 95.73
TIGR02237209 recomb_radB DNA repair and recombination protein R 95.73
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 95.72
PRK10876 1181 recB exonuclease V subunit beta; Provisional 95.72
PRK09694878 helicase Cas3; Provisional 95.72
COG1198730 PriA Primosomal protein N' (replication factor Y) 95.71
KOG0743|consensus457 95.71
TIGR01425 429 SRP54_euk signal recognition particle protein SRP5 95.71
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 95.7
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 95.69
TIGR02525372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 95.68
cd01394218 radB RadB. The archaeal protein radB shares simila 95.68
PF05729166 NACHT: NACHT domain 95.66
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 95.66
TIGR02784 1141 addA_alphas double-strand break repair helicase Ad 95.66
PRK00411394 cdc6 cell division control protein 6; Reviewed 95.66
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 95.66
KOG1804|consensus775 95.64
TIGR02533486 type_II_gspE general secretory pathway protein E. 95.64
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 95.64
TIGR00348 667 hsdR type I site-specific deoxyribonuclease, HsdR 95.63
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 95.63
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 95.63
PRK06835329 DNA replication protein DnaC; Validated 95.63
PHA00729226 NTP-binding motif containing protein 95.63
PRK10436462 hypothetical protein; Provisional 95.62
TIGR03817742 DECH_helic helicase/secretion neighborhood putativ 95.61
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 95.61
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 95.6
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 95.6
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 95.59
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 95.57
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 95.56
PRK02362 737 ski2-like helicase; Provisional 95.55
KOG0991|consensus333 95.52
PRK06921266 hypothetical protein; Provisional 95.52
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 95.52
PRK10436462 hypothetical protein; Provisional 95.52
COG0552340 FtsY Signal recognition particle GTPase [Intracell 95.51
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 95.51
PRK13766773 Hef nuclease; Provisional 95.5
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 95.49
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 95.48
PRK00411 394 cdc6 cell division control protein 6; Reviewed 95.48
PRK08727233 hypothetical protein; Validated 95.47
PRK09694 878 helicase Cas3; Provisional 95.47
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 95.45
TIGR00959 428 ffh signal recognition particle protein. This mode 95.44
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 95.44
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 95.44
PRK06851 367 hypothetical protein; Provisional 95.44
PRK12402337 replication factor C small subunit 2; Reviewed 95.42
PRK14701 1638 reverse gyrase; Provisional 95.42
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 95.4
TIGR00959428 ffh signal recognition particle protein. This mode 95.38
TIGR00604 705 rad3 DNA repair helicase (rad3). All proteins in t 95.38
COG0552340 FtsY Signal recognition particle GTPase [Intracell 95.37
TIGR00362405 DnaA chromosomal replication initiator protein Dna 95.36
PRK14088440 dnaA chromosomal replication initiation protein; P 95.35
PRK12402337 replication factor C small subunit 2; Reviewed 95.34
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 95.34
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 95.34
PRK09302509 circadian clock protein KaiC; Reviewed 95.32
smart00489289 DEXDc3 DEAD-like helicases superfamily. 95.31
smart00488289 DEXDc2 DEAD-like helicases superfamily. 95.31
TIGR02538564 type_IV_pilB type IV-A pilus assembly ATPase PilB. 95.27
PF13173128 AAA_14: AAA domain 95.26
PHA02653675 RNA helicase NPH-II; Provisional 95.26
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 95.26
PRK00149450 dnaA chromosomal replication initiation protein; R 95.25
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 95.25
TIGR00604705 rad3 DNA repair helicase (rad3). All proteins in t 95.25
PRK05642234 DNA replication initiation factor; Validated 95.25
PTZ00110545 helicase; Provisional 95.24
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 95.24
PRK11823446 DNA repair protein RadA; Provisional 95.24
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 95.23
PRK13767876 ATP-dependent helicase; Provisional 95.23
PF05729166 NACHT: NACHT domain 95.22
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 95.22
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 95.22
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 95.22
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 95.21
PRK14701 1638 reverse gyrase; Provisional 95.21
PRK08939306 primosomal protein DnaI; Reviewed 95.21
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 95.19
PF02492178 cobW: CobW/HypB/UreG, nucleotide-binding domain; I 95.18
PRK00149450 dnaA chromosomal replication initiation protein; R 95.14
PRK01297 475 ATP-dependent RNA helicase RhlB; Provisional 95.12
PHA02653 675 RNA helicase NPH-II; Provisional 95.12
TIGR02538564 type_IV_pilB type IV-A pilus assembly ATPase PilB. 95.1
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 95.1
PRK11823 446 DNA repair protein RadA; Provisional 95.07
TIGR00362405 DnaA chromosomal replication initiator protein Dna 95.05
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 95.03
PF13173128 AAA_14: AAA domain 95.03
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 95.03
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 95.01
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 95.01
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 94.99
PRK05642234 DNA replication initiation factor; Validated 94.99
PRK10867433 signal recognition particle protein; Provisional 94.99
PRK09302509 circadian clock protein KaiC; Reviewed 94.99
PTZ00110 545 helicase; Provisional 94.95
KOG2028|consensus554 94.95
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 94.95
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 94.94
PRK11331459 5-methylcytosine-specific restriction enzyme subun 94.93
PRK13767 876 ATP-dependent helicase; Provisional 94.91
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 94.9
PRK06921266 hypothetical protein; Provisional 94.9
KOG2028|consensus 554 94.9
PRK11331459 5-methylcytosine-specific restriction enzyme subun 94.9
PHA00729226 NTP-binding motif containing protein 94.89
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 94.88
COG4096 875 HsdR Type I site-specific restriction-modification 94.86
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 94.83
KOG0991|consensus333 94.82
PRK14088440 dnaA chromosomal replication initiation protein; P 94.8
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 94.8
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 94.79
TIGR02012321 tigrfam_recA protein RecA. This model describes or 94.78
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 94.78
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 94.78
PRK13909910 putative recombination protein RecB; Provisional 94.78
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 94.77
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 94.77
cd01393226 recA_like RecA is a bacterial enzyme which has rol 94.77
PRK08939306 primosomal protein DnaI; Reviewed 94.75
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 94.75
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 94.74
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 94.73
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 94.72
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 94.72
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 94.72
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 94.72
PLN00206 518 DEAD-box ATP-dependent RNA helicase; Provisional 94.7
COG1074 1139 RecB ATP-dependent exoDNAse (exonuclease V) beta s 94.68
TIGR02012321 tigrfam_recA protein RecA. This model describes or 94.67
COG1474 366 CDC6 Cdc6-related protein, AAA superfamily ATPase 94.66
KOG0354|consensus 746 94.64
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 94.62
TIGR00416454 sms DNA repair protein RadA. The gene protuct code 94.6
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 94.6
KOG0354|consensus746 94.6
TIGR00595505 priA primosomal protein N'. All proteins in this f 94.59
cd00983325 recA RecA is a bacterial enzyme which has roles in 94.58
PF02492178 cobW: CobW/HypB/UreG, nucleotide-binding domain; I 94.58
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 94.57
COG1198 730 PriA Primosomal protein N' (replication factor Y) 94.55
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 94.54
COG2256436 MGS1 ATPase related to the helicase subunit of the 94.5
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 94.5
PRK13768253 GTPase; Provisional 94.48
PRK14087450 dnaA chromosomal replication initiation protein; P 94.48
TIGR00416 454 sms DNA repair protein RadA. The gene protuct code 94.48
PRK13766 773 Hef nuclease; Provisional 94.47
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a var 94.47
PRK13768253 GTPase; Provisional 94.45
COG2256 436 MGS1 ATPase related to the helicase subunit of the 94.45
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 94.45
PHA02544316 44 clamp loader, small subunit; Provisional 94.44
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 94.41
COG0507696 RecD ATP-dependent exoDNAse (exonuclease V), alpha 94.4
PRK11057607 ATP-dependent DNA helicase RecQ; Provisional 94.37
PRK09354349 recA recombinase A; Provisional 94.34
TIGR00750300 lao LAO/AO transport system ATPase. Mutations have 94.34
TIGR00595 505 priA primosomal protein N'. All proteins in this f 94.31
CHL00181287 cbbX CbbX; Provisional 94.31
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 94.3
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a var 94.3
TIGR03158 357 cas3_cyano CRISPR-associated helicase, Cyano-type. 94.24
PRK12608380 transcription termination factor Rho; Provisional 94.24
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 94.23
CHL00181287 cbbX CbbX; Provisional 94.22
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 94.21
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 94.21
COG5192 1077 BMS1 GTP-binding protein required for 40S ribosome 94.2
cd00983325 recA RecA is a bacterial enzyme which has roles in 94.19
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 94.19
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 94.18
PRK13909 910 putative recombination protein RecB; Provisional 94.17
PRK14087450 dnaA chromosomal replication initiation protein; P 94.17
PRK03992389 proteasome-activating nucleotidase; Provisional 94.16
TIGR00750300 lao LAO/AO transport system ATPase. Mutations have 94.16
PRK03992389 proteasome-activating nucleotidase; Provisional 94.16
PRK04195482 replication factor C large subunit; Provisional 94.15
cd01393226 recA_like RecA is a bacterial enzyme which has rol 94.15
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 94.13
PF03308266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 94.12
PRK13342413 recombination factor protein RarA; Reviewed 94.11
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 94.09
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 94.08
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 94.08
PRK00440319 rfc replication factor C small subunit; Reviewed 94.08
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 94.06
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 94.04
TIGR00176155 mobB molybdopterin-guanine dinucleotide biosynthes 94.04
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 94.03
COG1074 1139 RecB ATP-dependent exoDNAse (exonuclease V) beta s 94.02
TIGR01389591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 94.02
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 94.02
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 94.01
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 93.97
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 93.97
TIGR00176155 mobB molybdopterin-guanine dinucleotide biosynthes 93.95
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 93.94
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 93.93
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is 93.92
PTZ00301210 uridine kinase; Provisional 93.9
PRK10751173 molybdopterin-guanine dinucleotide biosynthesis pr 93.89
PRK12608380 transcription termination factor Rho; Provisional 93.86
PHA02544316 44 clamp loader, small subunit; Provisional 93.86
PRK04195 482 replication factor C large subunit; Provisional 93.84
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 93.83
PRK00440319 rfc replication factor C small subunit; Reviewed 93.82
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 93.81
cd03114148 ArgK-like The function of this protein family is u 93.8
PRK04301317 radA DNA repair and recombination protein RadA; Va 93.77
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 93.76
COG0556 663 UvrB Helicase subunit of the DNA excision repair c 93.72
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 93.71
COG1201 814 Lhr Lhr-like helicases [General function predictio 93.67
PF12846304 AAA_10: AAA-like domain 93.67
PF03029238 ATP_bind_1: Conserved hypothetical ATP binding pro 93.64
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 93.64
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 93.63
PRK08233182 hypothetical protein; Provisional 93.61
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 93.61
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 93.6
PRK08233182 hypothetical protein; Provisional 93.6
PTZ00301210 uridine kinase; Provisional 93.58
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 93.58
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 93.58
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 93.56
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is 93.56
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 93.54
PRK13342 413 recombination factor protein RarA; Reviewed 93.52
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 93.52
COG1199 654 DinG Rad3-related DNA helicases [Transcription / D 93.51
PRK00131175 aroK shikimate kinase; Reviewed 93.49
PRK08118167 topology modulation protein; Reviewed 93.46
COG3854308 SpoIIIAA ncharacterized protein conserved in bacte 93.45
PRK05541176 adenylylsulfate kinase; Provisional 93.45
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 93.44
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 93.44
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 93.43
PRK13531498 regulatory ATPase RavA; Provisional 93.43
PRK12422445 chromosomal replication initiation protein; Provis 93.41
KOG1804|consensus 775 93.41
PF1355562 AAA_29: P-loop containing region of AAA domain 93.38
PRK06762166 hypothetical protein; Provisional 93.36
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 93.36
COG1224 450 TIP49 DNA helicase TIP49, TBP-interacting protein 93.34
>KOG1806|consensus Back     alignment and domain information 
Probab=100.00  E-value=2.5e-88  Score=797.73  Aligned_cols=475  Identities=54%  Similarity=0.879  Sum_probs=445.8

Q ss_pred             cccccccccHHHhhcCCCCCCChhhhccCCCCCCcccCCcccccCcCccccccChhhHHHhhhhhhhhhhhcccccchhh
Q psy12659        451 ISRHEKRSSQLEALNSMPLYPTQEIIWNENIVPTEYFSGEGCLALPKLNLQFLTLHDYLLRNFNLFRLESTCRVNYVLAK  530 (1051)
Q Consensus       451 IS~~Err~s~~~~~~~~~~~p~e~~~~~~~~~~~~~~~~~~~~~l~klnlq~l~~~D~l~r~~~l~r~es~~~i~~~~~~  530 (1051)
                      |+.+||++||.|..|.+|+||+|++|||++.+|.++|. ++||||||||||||||+||+.|||++||+|++|+|      
T Consensus       373 Vm~nEK~rs~ve~~~~~~l~p~~~i~wd~~v~~~e~~l-e~cl~l~kl~lq~ltL~~~er~all~F~~~~f~si------  445 (1320)
T KOG1806|consen  373 VMTNEKTRSQVEDYNEIPLYPLEDILWDESVMPSENYL-EGCLALPKLNLQFLTLHDYERRALLLFRLESFYSI------  445 (1320)
T ss_pred             hhhhHHHHHHHHHHHhhhcCchhhhccccccchhhhhh-hhhhcchhhHHHHhHHHHHHHHHHHHHHHHHHHHH------
Confidence            45789999999999999999999999999999999999 99999999999999999999999999999999999      


Q ss_pred             hhhHHHHHHHhccccCCCCCeeEeeccCCcchhhhhhhhhHhhhccccccCCCcccccccCCCcccccCCCeEEEEEEEE
Q psy12659        531 RLDLLQEVERLQKSLDVSGDVAYTCETAGHFFLYQVLARWEKFLATVRQRKQDRRKPAVSRTNIIREKQPSRVRADVIVN  610 (1051)
Q Consensus       531 r~d~e~~i~rl~p~~~~~~~~~f~~~~~~~~~~~~~~~g~srm~~~~a~~i~~~~i~~v~~p~~ig~~~p~~v~a~~~~~  610 (1051)
                      |.||.+.+.|+.|   .+|++.|              +||+||    |.|+..|.|.+|++|+ ||++.|.+|+|+++++
T Consensus       446 e~ei~~~~~~~l~---~~~~vs~--------------~~W~~l----~~~r~~f~v~eV~~p~-ige~~p~kv~ad~~~~  503 (1320)
T KOG1806|consen  446 EAEILNFVERYLR---LSGKVAF--------------KGWARL----AFPRNDFKVTEVAPPN-IGENLPQKVTADVTLS  503 (1320)
T ss_pred             HHHHHHHHHHHhh---hccchhh--------------hhhhhc----cchhhhheeeecCCcc-hhhhhhhhhhhhcccc
Confidence            9999999999998   6889999              999999    9999999999999999 9999999999999999


Q ss_pred             cC-CchhHHHHHhhcCCCceEEEEeecCCCCCCCCCCCCCCcccccCccceecchhhhhhcccCcccCCCCCCCCCCCCC
Q psy12659        611 LN-VKREIKGEWESLRKHDVCFLITLKPPLPIGTKISYKGPFLEQTGLTYVRGCEIEGMLDVNGRIIEDGPEPRPVLPGD  689 (1051)
Q Consensus       611 ~~-~~~~~r~ew~~lr~~dv~fL~~v~~~~~~~~~~~~~~~~~~~~gi~~vR~~Ei~~~~de~g~~~~~~~~~~~~~~~~  689 (1051)
                      +. .++.++++|+.+++||||||++++|..+.+.+.+...+...+.|+++||+||+..|+|.+|..+.+          +
T Consensus       504 ~~~eRh~~~nli~~f~k~~~~~Li~i~P~e~~~~~~~~~~~~eg~vp~~~v~yCErf~~f~idlesild----------t  573 (1320)
T KOG1806|consen  504 RPGERHSILNLIENFKKHDVLFLIYIRPMEPKGLEGNALDPLEGRVPLTYVRYCERFGMFDIDLESILD----------T  573 (1320)
T ss_pred             CcchHHHHHHHHHHhhhcCeeEEEEeccCcccCcccccccccccccCcccchhhhhhhhhhhhhhhccC----------C
Confidence            97 799999999999999999999999988888888888888899999999999999999999999874          2


Q ss_pred             CceEEEecChhhHhhchhh-hhcCCCcceeeeEEEEecCCCccchHHHHHHHHHhhccCCCCChhhhhhhcccCCCCCCc
Q psy12659        690 TRTFRVMLDCNQYKEDLDN-VAQGNEDVYETFNVLMRRKPKENNFKAVLETIRDLMNTECVVPDWLHDIILGYGDPGAAH  768 (1051)
Q Consensus       690 ~r~l~v~LD~~qy~~d~~~-~~~~~~dvy~~fNllirr~~~ennfk~vl~~i~~ll~~~~~lP~wl~difLG~gdp~~a~  768 (1051)
                      .|++.|.||+.+|+.++.. .+.+.+++|.+||++++++|++|+|+.+++.|++++|..|.+|.|+++++||||+|+.++
T Consensus       574 rRffnvvLd~~h~~~lLs~li~~~ag~lf~qF~~~l~~~~~~n~~~~~l~~l~~l~n~~~~~p~wl~~~~Lg~g~pS~~~  653 (1320)
T KOG1806|consen  574 RRFFNVVLDPFHYHHLLSGLIEYGAGDLFFQFNLLLRRKPEENNFKAILEIIRSLMNRACEVPKWLHDLFLGYGTPSIAH  653 (1320)
T ss_pred             cceEEEecchHHHHHHhhHHhhcCchhhhhhhhheeeeccCcchhHhHHHHHHHHHHhhhccchhhhccccccCCcchhh
Confidence            3899999999999999988 577899999999999999999999999999999999999999999999999999999999


Q ss_pred             ccchhhhhcccccCccccccccccccCCCcccccccCC-------------------CCC---------CC---CCC---
Q psy12659        769 YTEMPNEIATMDFNDTFLNMDHLRSSFPQAEIRVKTDN-------------------PTK---------LV---PPF---  814 (1051)
Q Consensus       769 y~~m~~~l~~ld~~dtfl~~~hl~~sfp~~~i~~~~~~-------------------~~~---------~~---~~~---  814 (1051)
                      |.+|++.+...+  ++|++..|+.++||++.+.+..+.                   +.+         ..   -||   
T Consensus       654 ~~n~~~~~~~~~--~~f~~~~ql~~~f~~~~v~~v~~~~al~~~k~~~~~nki~~~~~ae~~~~~v~~~~lp~~~py~y~  731 (1320)
T KOG1806|consen  654 YPNMPNLSIYAD--DTFLTVEHLQSSFPNCNVSSNLSTEALQIKKFYTDQNKISADVTAEVPALIVEPFTLPSNGPYPYN  731 (1320)
T ss_pred             ccCchhhHHHHH--HhhhhHHHHHHhccCCCccccCccHHHHHHHhhhhccccCccccccchhhccCccccCCCCCCCcC
Confidence            999999998887  899999999999998876542211                   000         00   112   


Q ss_pred             ------CCCHHHHHHHHHhcCCCeEEEECCCCCChhHHHHHHHHHHHHhCCCCcEEEEecchHHHHHHHHHHHhcCCCcc
Q psy12659        815 ------KLTFHEIEAIRAGMQPGLTLVVGPPGTGKTDVAVQIISNLYHNFPHQRTLIVTHSNQALNQLFEKIISLDVDER  888 (1051)
Q Consensus       815 ------~Ln~~Q~~Ai~~~l~~~~tlIqGPPGTGKT~ti~~iI~~ll~~~~~~riLV~a~SN~Ald~l~e~l~~~~~~~~  888 (1051)
                            ..|+.|.+||.+++++|+|+|.||||||||.++++||..++++.|++|++|+++||+|++.+++++++.+++.+
T Consensus       732 p~~n~v~ft~~qveai~sg~qpgltmvvgppgtgktd~avqil~~lyhn~p~qrTlivthsnqaln~lfeKi~~~d~d~r  811 (1320)
T KOG1806|consen  732 PKKNQVKFTPTQVEAILSGMQPGLTMVVGPPGTGKTDVAVQILSVLYHNSPNQRTLIVTHSNQALNQLFEKIMALDVDER  811 (1320)
T ss_pred             cccchhccCHHHHHHHHhcCCCCceeeecCCCCCCcchhhhhhhhhhhcCCCcceEEEEecccchhHHHHHHHhcccchh
Confidence                  34789999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccccccccChhhHHHhccCHHHHHhhhcCceeeccccccccccccchHHHHhhcCCCCCCCCCCCCccccchhhhhhhh
Q psy12659        889 HLLHKKYRITPRYLLLAIKNDVELSQLLSDVTIAQGGVMPNIQSMKFDKTLKTLLSPWKSEDGSPFFGGWARMAQPIVNF  968 (1051)
Q Consensus       889 ~llRlgsritpr~l~laVrnd~eL~~LL~~vtIs~ggvlp~i~k~ll~k~~~~ll~P~~~~~~~~~~~~w~~~~~~i~~~  968 (1051)
                      +++|+|                                                                          
T Consensus       812 hLlrlg--------------------------------------------------------------------------  817 (1320)
T KOG1806|consen  812 HLLRLG--------------------------------------------------------------------------  817 (1320)
T ss_pred             hHHHhc--------------------------------------------------------------------------
Confidence            999999                                                                          


Q ss_pred             hhhhhcccchhhhhhhhhhhhhhhhHHHHHHHHHHHHHHHHHHHHhcCCCCCcccchhhhhHHHHHHHHHHHHHHHHHHh
Q psy12659        969 AVVEVAKPNIEEALETEKDFSRYGRVNYVLAKRLDLLQEVERLQKSLDVSGDVAYTCETAGHFFLYQVLARWEKFLATVR 1048 (1051)
Q Consensus       969 ~~~~~~~~~~~~~l~~~~~~s~~grv~~~l~~r~~Ll~eve~L~~~l~~~~~~~~~~e~a~~f~~~~~~~~we~~~~~~~ 1048 (1051)
                              ||+++++++++|++||||++++.+|.+|++||++|++|++++||+.|||+||+|||.++|.++||+|++++.
T Consensus       818 --------~ge~eletd~dfsrygrvn~~l~~r~~ll~ev~rla~sl~~pgdv~ytcetagyf~~~~V~~~wee~l~~v~  889 (1320)
T KOG1806|consen  818 --------HGEEELETDKDFSRYGRVNYVLSRRLELLREVERLAKSLQAPGDVDYTCETAGYFFLAYVKRRWEEYLAKVD  889 (1320)
T ss_pred             --------ccHHhhhcccchhheeeEeeeeccchHHHHHHHHhhhhhcCccccccccchhhhhhhhHHHhhhHHHHHHhc
Confidence                    999999999999999999999999999999999999999999999999999999999999999999999987

>KOG1806|consensus Back     alignment and domain information
>KOG1802|consensus Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>KOG1803|consensus Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>KOG1805|consensus Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>KOG1803|consensus Back     alignment and domain information
>KOG1802|consensus Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>KOG1807|consensus Back     alignment and domain information
>KOG1805|consensus Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>KOG1807|consensus Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>PRK10919 ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>PRK10919 ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>PRK11773 uvrD DNA-dependent helicase II; Provisional Back     alignment and domain information
>TIGR01075 uvrD DNA helicase II Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>PRK11773 uvrD DNA-dependent helicase II; Provisional Back     alignment and domain information
>TIGR01075 uvrD DNA helicase II Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>TIGR01074 rep ATP-dependent DNA helicase Rep Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>TIGR01073 pcrA ATP-dependent DNA helicase PcrA Back     alignment and domain information
>TIGR01074 rep ATP-dependent DNA helicase Rep Back     alignment and domain information
>TIGR01073 pcrA ATP-dependent DNA helicase PcrA Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>PRK14712 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>PRK13709 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>COG0210 UvrD Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14712 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>COG0210 UvrD Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13709 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>PTZ00252 histone H2A; Provisional Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>PLN00153 histone H2A; Provisional Back     alignment and domain information
>TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type Back     alignment and domain information
>PLN00156 histone H2AX; Provisional Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PTZ00017 histone H2A; Provisional Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>PLN00157 histone H2A; Provisional Back     alignment and domain information
>TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type Back     alignment and domain information
>smart00414 H2A Histone 2A Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>cd00074 H2A Histone 2A; H2A is a subunit of the nucleosome Back     alignment and domain information
>PLN00154 histone H2A; Provisional Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>KOG1756|consensus Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>TIGR00609 recB exodeoxyribonuclease V, beta subunit Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>COG1112 Superfamily I DNA and RNA helicases and helicase subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>COG3973 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>COG5262 HTA1 Histone H2A [Chromatin structure and dynamics] Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>TIGR00609 recB exodeoxyribonuclease V, beta subunit Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>KOG1757|consensus Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>KOG0989|consensus Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>KOG0989|consensus Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>COG3973 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>PRK10876 recB exonuclease V subunit beta; Provisional Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>KOG0743|consensus Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>KOG0744|consensus Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>TIGR02784 addA_alphas double-strand break repair helicase AddA, alphaproteobacterial type Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>KOG0744|consensus Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK06851 hypothetical protein; Provisional Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>PRK10876 recB exonuclease V subunit beta; Provisional Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0743|consensus Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>TIGR02784 addA_alphas double-strand break repair helicase AddA, alphaproteobacterial type Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>KOG1804|consensus Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0991|consensus Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PRK06851 hypothetical protein; Provisional Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF02492 cobW: CobW/HypB/UreG, nucleotide-binding domain; InterPro: IPR003495 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>KOG2028|consensus Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>KOG2028|consensus Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>KOG0991|consensus Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PRK13909 putative recombination protein RecB; Provisional Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>COG1074 RecB ATP-dependent exoDNAse (exonuclease V) beta subunit (contains helicase and exonuclease domains) [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0354|consensus Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG0354|consensus Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PF02492 cobW: CobW/HypB/UreG, nucleotide-binding domain; InterPro: IPR003495 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>COG0507 RecD ATP-dependent exoDNAse (exonuclease V), alpha subunit - helicase superfamily I member [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>PRK13909 putative recombination protein RecB; Provisional Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1074 RecB ATP-dependent exoDNAse (exonuclease V) beta subunit (contains helicase and exonuclease domains) [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>cd03114 ArgK-like The function of this protein family is unkown Back     alignment and domain information
>PRK04301 radA DNA repair and recombination protein RadA; Validated Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>PF12846 AAA_10: AAA-like domain Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>KOG1804|consensus Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1051
2pyo_C120 Drosophila Nucleosome Core Length = 120 1e-09
2nqb_C123 Drosophila Nucleosome Structure Length = 123 1e-09
1eqz_A129 X-Ray Structure Of The Nucleosome Core Particle At 2e-09
1m18_C129 Ligand Binding Alters The Structure And Dynamics Of 2e-09
1zbb_C129 Structure Of The 4_601_167 Tetranucleosome Length = 2e-09
2hio_A128 Histone Octamer (Chicken), Chromosomal Protein Leng 2e-09
2f8n_K149 2.9 Angstrom X-Ray Structure Of Hybrid Macroh2a Nuc 2e-09
1s32_C119 Molecular Recognition Of The Nucleosomal 'supergroo 2e-09
3a6n_C133 The Nucleosome Containing A Testis-Specific Histone 2e-09
1aoi_C116 Complex Between Nucleosome Core Particle (H3,H4,H2a 3e-09
3c1b_C129 The Effect Of H3 K79 Dimethylation And H4 K20 Trime 3e-09
1zla_C129 X-Ray Structure Of A Kaposi's Sarcoma Herpesvirus L 3e-09
2cv5_C130 Crystal Structure Of Human Nucleosome Core Particle 3e-09
1kx3_C128 X-Ray Structure Of The Nucleosome Core Particle, Nc 3e-09
3kwq_C107 Structural Characterization Of H3k56q Nucleosomes A 3e-09
1u35_C120 Crystal Structure Of The Nucleosome Core Particle C 2e-08
1id3_C131 Crystal Structure Of The Yeast Nucleosome Core Part 2e-08
1hio_A95 Histone Octamer (Chicken), Chromosomal Protein, Alp 4e-07
2wjv_A800 Crystal Structure Of The Complex Between Human Nons 4e-05
2wjv_A 800 Crystal Structure Of The Complex Between Human Nons 7e-04
2gjk_A624 Structural And Functional Insights Into The Human U 5e-05
2gjk_A 624 Structural And Functional Insights Into The Human U 8e-04
2xzo_A623 Upf1 Helicase - Rna Complex Length = 623 6e-05
2xzo_A 623 Upf1 Helicase - Rna Complex Length = 623 8e-04
2xql_A91 Fitting Of The H2a-H2b Histones In The Electron Mic 9e-05
4b3f_X646 Crystal Structure Of 1ghmbp2 Helicase Length = 646 2e-04
4b3g_A646 Crystal Structure Of Ighmbp2 Helicase In Complex Wi 2e-04
>pdb|2PYO|C Chain C, Drosophila Nucleosome Core Length = 120 Back     alignment and structure 
Iteration: 1

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 30/46 (65%), Positives = 38/46 (82%)
Query: 892 HKKYRITPRYLLLAIKNDVELSQLLSDVTIAQGGVMPNIQSMKFDK 937
           +KK RI PR+L LAI+ND EL++LLS VTIAQGGV+PNIQ++   K
Sbjct: 72  NKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPK 117
>pdb|2NQB|C Chain C, Drosophila Nucleosome Structure Length = 123 Back     alignment and structure
>pdb|1EQZ|A Chain A, X-Ray Structure Of The Nucleosome Core Particle At 2.5 A Resolution Length = 129 Back     alignment and structure
>pdb|1M18|C Chain C, Ligand Binding Alters The Structure And Dynamics Of Nucleosomal Dna Length = 129 Back     alignment and structure
>pdb|1ZBB|C Chain C, Structure Of The 4_601_167 Tetranucleosome Length = 129 Back     alignment and structure
>pdb|2HIO|A Chain A, Histone Octamer (Chicken), Chromosomal Protein Length = 128 Back     alignment and structure
>pdb|2F8N|K Chain K, 2.9 Angstrom X-Ray Structure Of Hybrid Macroh2a Nucleosomes Length = 149 Back     alignment and structure
>pdb|1S32|C Chain C, Molecular Recognition Of The Nucleosomal 'supergroove' Length = 119 Back     alignment and structure
>pdb|3A6N|C Chain C, The Nucleosome Containing A Testis-Specific Histone Variant, Human H3t Length = 133 Back     alignment and structure
>pdb|1AOI|C Chain C, Complex Between Nucleosome Core Particle (H3,H4,H2a,H2b) And 146 Bp Long Dna Fragment Length = 116 Back     alignment and structure
>pdb|3C1B|C Chain C, The Effect Of H3 K79 Dimethylation And H4 K20 Trimethylation On Nucleosome And Chromatin Structure Length = 129 Back     alignment and structure
>pdb|1ZLA|C Chain C, X-Ray Structure Of A Kaposi's Sarcoma Herpesvirus Lana Peptide Bound To The Nucleosomal Core Length = 129 Back     alignment and structure
>pdb|2CV5|C Chain C, Crystal Structure Of Human Nucleosome Core Particle Length = 130 Back     alignment and structure
>pdb|1KX3|C Chain C, X-Ray Structure Of The Nucleosome Core Particle, Ncp146, At 2.0 A Resolution Length = 128 Back     alignment and structure
>pdb|3KWQ|C Chain C, Structural Characterization Of H3k56q Nucleosomes And Nucleo Arrays Length = 107 Back     alignment and structure
>pdb|1U35|C Chain C, Crystal Structure Of The Nucleosome Core Particle Containing The Histone Domain Of Macroh2a Length = 120 Back     alignment and structure
>pdb|1ID3|C Chain C, Crystal Structure Of The Yeast Nucleosome Core Particle Reveals Fundamental Differences In Inter-Nucleosome Interactions Length = 131 Back     alignment and structure
>pdb|1HIO|A Chain A, Histone Octamer (Chicken), Chromosomal Protein, Alpha Carbons Only Length = 95 Back     alignment and structure
>pdb|2WJV|A Chain A, Crystal Structure Of The Complex Between Human Nonsense Mediated Decay Factors Upf1 And Upf2 Length = 800 Back     alignment and structure
>pdb|2WJV|A Chain A, Crystal Structure Of The Complex Between Human Nonsense Mediated Decay Factors Upf1 And Upf2 Length = 800 Back     alignment and structure
>pdb|2GJK|A Chain A, Structural And Functional Insights Into The Human Upf1 Helicase Core Length = 624 Back     alignment and structure
>pdb|2GJK|A Chain A, Structural And Functional Insights Into The Human Upf1 Helicase Core Length = 624 Back     alignment and structure
>pdb|2XZO|A Chain A, Upf1 Helicase - Rna Complex Length = 623 Back     alignment and structure
>pdb|2XZO|A Chain A, Upf1 Helicase - Rna Complex Length = 623 Back     alignment and structure
>pdb|2XQL|A Chain A, Fitting Of The H2a-H2b Histones In The Electron Microscopy Map Of The Complex Nucleoplasmin:h2a-H2b Histones (1:5). Length = 91 Back     alignment and structure
>pdb|4B3F|X Chain X, Crystal Structure Of 1ghmbp2 Helicase Length = 646 Back     alignment and structure
>pdb|4B3G|A Chain A, Crystal Structure Of Ighmbp2 Helicase In Complex With Rna Length = 646 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1051
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-16
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-10
2f8n_K149 Histone H2A type 1; nucleosome, NCP, macroh2A, his 2e-14
1tzy_A129 Histone H2A-IV; histone-fold, tetramer-dimer-dimer 4e-13
2f8n_G120 Core histone macro-H2A.1; nucleosome, NCP, macroh2 6e-13
1id3_C131 Histone H2A.1; nucleosome core particle, chromatin 2e-12
2nqb_C123 Histone H2A; nucleosome, NCP, chromatin, structura 4e-11
2wjy_A800 Regulator of nonsense transcripts 1; nonsense medi 4e-10
2wjy_A 800 Regulator of nonsense transcripts 1; nonsense medi 2e-06
2xzl_A802 ATP-dependent helicase NAM7; hydrolase-RNA complex 5e-10
2xzl_A 802 ATP-dependent helicase NAM7; hydrolase-RNA complex 3e-07
1f66_C128 Histone H2A.Z; nucleosome, chromatin, histone vari 1e-09
2gk6_A624 Regulator of nonsense transcripts 1; UPF1, helicas 3e-09
2gk6_A 624 Regulator of nonsense transcripts 1; UPF1, helicas 3e-06
2jss_A192 Chimera of histone H2B.1 and histone H2A.Z; histon 1e-08
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 4e-07
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 8e-07
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 7e-06
2fwr_A 472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 9e-06
4a2w_A936 RIG-I, retinoic acid inducible protein I; hydrolas 1e-05
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 3e-05
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 1e-04
3b6e_A216 Interferon-induced helicase C domain-containing P; 3e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 83.4 bits (205), Expect = 2e-16
 Identities = 97/666 (14%), Positives = 189/666 (28%), Gaps = 195/666 (29%)

Query: 30  DHDMTQI--HYQNITSLQKAAFAKFPDLRSFSLANVASVDTRETLTKHFEPLTPLCVLKK 87
           D +  +    Y++I S+ + AF    D +          D ++             +L K
Sbjct: 8   DFETGEHQYQYKDILSVFEDAFVDNFDCK----------DVQDMPKS---------ILSK 48

Query: 88  RTEEEENEDEDVEMENKDANVLTTTPPRQAIIIGFLLIQ---VLKKRTEEEENEDEDVEM 144
                E  D  +  ++  +  L         +   LL +   +++K  EE    +    M
Sbjct: 49  -----EEIDHIIMSKDAVSGTL--------RLFWTLLSKQEEMVQKFVEEVLRINYKFLM 95

Query: 145 ENKDGKPIITVEPHVIPSRGPYLFNEPRKNTI----PFTP------TQIEAIRAG---MQ 191
                   I  E    PS    ++ E R         F             +R     ++
Sbjct: 96  SP------IKTEQR-QPSMMTRMYIEQRDRLYNDNQVFAKYNVSRLQPYLKLRQALLELR 148

Query: 192 PGLTLVV-GPPGTGKTDVAVQIISN--LYHNFPHQRTLI----VTHSNQALNQLFEKIIS 244
           P   +++ G  G+GKT VA+ +  +  +      +   I    + + N     + E +  
Sbjct: 149 PAKNVLIDGVLGSGKTWVALDVCLSYKVQCKMDFK---IFWLNLKNCNSP-ETVLEMLQK 204

Query: 245 LDVDERHLLRLGHGEEALETEKDFSRYGRVNYVLAK-RLDLLQEVERLQKSLDVSGDVAY 303
           L      L ++   +    +  D S   ++     +  L  L + +  +  L V  +V  
Sbjct: 205 L------LYQI---DPNWTSRSDHSSNIKLRIHSIQAELRRLLKSKPYENCLLVLLNV-Q 254

Query: 304 TCETAGHFFLYQVLARWEKF------LATVRPSDGKTVPVKTIKTEFPFHGFFENAPKPL 357
             +             W  F      L T R    K V    +      H   ++    L
Sbjct: 255 NAKA------------WNAFNLSCKILLTTR--F-KQV-TDFLSAATTTHISLDHHSMTL 298

Query: 358 FKEKSYETDMEIAEGCFRYIEKMFTQL-EEFRAF---------ELLRSGLDRSKYLLV-- 405
             ++       +     +Y++     L  E             E +R GL          
Sbjct: 299 TPDEV----KSL---LLKYLDCRPQDLPREVLTTNPRRLSIIAESIRDGLATWDNWKHVN 351

Query: 406 --KEAKIIAMTCTHAALKRKELVDMGFSFSISP------------IW------VSFNTVS 445
             K   II  +     L+  E   M    S+ P            IW           V+
Sbjct: 352 CDKLTTIIESSL--NVLEPAEYRKMFDRLSVFPPSAHIPTILLSLIWFDVIKSDVMVVVN 409

Query: 446 DLC--SQISRHEKRSS------QLEALNSMPLYPT--QEIIWNENIVPTEYFSGEGCLAL 495
            L   S + +  K S+       LE    +       + I+  ++    + F  +  +  
Sbjct: 410 KLHKYSLVEKQPKESTISIPSIYLELKVKLENEYALHRSIV--DHYNIPKTFDSDDLIPP 467

Query: 496 PKLN--LQFLTLHDYLLRN---FNLFR------------LESTCRVNYVLAKRLDLLQEV 538
                    +  H   + +     LFR            +             L+ LQ++
Sbjct: 468 YLDQYFYSHIGHHLKNIEHPERMTLFRMVFLDFRFLEQKIRHDSTAWNASGSILNTLQQL 527

Query: 539 ERLQKSLDVSGDVAYTCETAGHFFLYQVLARWEKFLATVRQRKQDRRKPAVSRTNIIREK 598
           +  +          Y C+    +   +++     FL  +               N+I  K
Sbjct: 528 KFYKP---------YICDNDPKY--ERLVNAILDFLPKI-------------EENLICSK 563

Query: 599 QPSRVR 604
               +R
Sbjct: 564 YTDLLR 569
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2f8n_K Histone H2A type 1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Mus musculus} SCOP: a.22.1.1 Length = 149 Back     alignment and structure
>1tzy_A Histone H2A-IV; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_A 1hq3_A 2aro_A 2hio_A 3c9k_A 3azg_C 3a6n_C 3an2_C 3av1_C 3av2_C 3ayw_C 3aze_C 3azf_C 3afa_C 3azh_C 3azi_C 3azj_C 3azk_C 3azl_C 3azm_C ... Length = 129 Back     alignment and structure
>2f8n_G Core histone macro-H2A.1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Homo sapiens} SCOP: a.22.1.1 PDB: 1u35_C Length = 120 Back     alignment and structure
>1id3_C Histone H2A.1; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 Length = 131 Back     alignment and structure
>2nqb_C Histone H2A; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_C* Length = 123 Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Length = 800 Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Length = 800 Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Length = 802 Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Length = 802 Back     alignment and structure
>1f66_C Histone H2A.Z; nucleosome, chromatin, histone variant, protein DNA interaction, nucleoprotein, supercoiled DNA, complex (nucleosome core/DNA); 2.60A {Homo sapiens} SCOP: a.22.1.1 Length = 128 Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Length = 624 Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Length = 624 Back     alignment and structure
>2jss_A Chimera of histone H2B.1 and histone H2A.Z; histone/chaperone complex, intrinsically unfolded protein, chaperone/structural protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.22.1.1 a.22.1.1 Length = 192 Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Length = 237 Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Length = 237 Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Length = 472 Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Length = 472 Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Length = 936 Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Length = 797 Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Length = 574 Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Length = 216 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1051
4b3f_X646 DNA-binding protein smubp-2; hydrolase, helicase; 99.88
2gk6_A624 Regulator of nonsense transcripts 1; UPF1, helicas 99.72
2xzl_A802 ATP-dependent helicase NAM7; hydrolase-RNA complex 99.71
2wjy_A800 Regulator of nonsense transcripts 1; nonsense medi 99.67
4b3f_X 646 DNA-binding protein smubp-2; hydrolase, helicase; 99.65
2gk6_A 624 Regulator of nonsense transcripts 1; UPF1, helicas 99.33
2xzl_A 802 ATP-dependent helicase NAM7; hydrolase-RNA complex 99.28
2wjy_A 800 Regulator of nonsense transcripts 1; nonsense medi 99.24
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 98.79
3e1s_A 574 Exodeoxyribonuclease V, subunit RECD; alpha and be 98.75
3lfu_A647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 98.71
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 98.7
3lfu_A 647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 98.65
1w36_D608 RECD, exodeoxyribonuclease V alpha chain; recombin 98.6
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 98.55
1w36_D 608 RECD, exodeoxyribonuclease V alpha chain; recombin 98.54
1uaa_A673 REP helicase, protein (ATP-dependent DNA helicase 98.43
1uaa_A 673 REP helicase, protein (ATP-dependent DNA helicase 98.36
1pjr_A724 PCRA; DNA repair, DNA replication, SOS response, h 98.36
1pjr_A 724 PCRA; DNA repair, DNA replication, SOS response, h 98.3
3u4q_A 1232 ATP-dependent helicase/nuclease subunit A; helicas 98.02
3b6e_A216 Interferon-induced helicase C domain-containing P; 98.0
3b6e_A216 Interferon-induced helicase C domain-containing P; 97.86
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 97.85
3u4q_A 1232 ATP-dependent helicase/nuclease subunit A; helicas 97.84
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 97.82
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 97.79
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 97.76
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 97.74
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 97.73
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 97.7
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 97.68
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 97.68
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 97.65
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 97.64
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 97.64
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 97.63
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 97.61
1hv8_A 367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 97.61
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 97.59
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 97.58
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 97.57
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 97.57
3bor_A237 Human initiation factor 4A-II; translation initiat 97.56
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 97.54
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 97.52
3bor_A237 Human initiation factor 4A-II; translation initiat 97.51
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 97.49
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 97.46
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 97.44
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 97.44
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 97.43
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 97.42
3tbk_A 555 RIG-I helicase domain; DECH helicase, ATP binding, 97.4
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 97.4
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 97.37
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 97.36
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 97.36
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 97.36
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 97.36
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 97.35
2fwr_A 472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 97.35
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 97.35
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 97.34
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 97.32
2oca_A 510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 97.31
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 97.3
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 97.3
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 97.29
4a2p_A 556 RIG-I, retinoic acid inducible protein I; hydrolas 97.29
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 97.28
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 97.28
3pey_A 395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 97.25
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 97.25
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 97.22
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 97.21
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 97.21
1s2m_A 400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 97.2
1xti_A 391 Probable ATP-dependent RNA helicase P47; alpha-bet 97.19
1wp9_A 494 ATP-dependent RNA helicase, putative; ATPase, DNA 97.18
3fht_A 412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 97.18
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 97.17
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 97.16
3eiq_A 414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 97.16
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 97.15
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 97.14
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 97.13
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 97.11
1fuu_A 394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 97.1
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 97.1
2j0s_A 410 ATP-dependent RNA helicase DDX48; mRNA processing, 97.09
3h1t_A590 Type I site-specific restriction-modification syst 97.09
3l9o_A1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 97.09
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 97.07
2f8n_G120 Core histone macro-H2A.1; nucleosome, NCP, macroh2 97.05
3h1t_A 590 Type I site-specific restriction-modification syst 97.04
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 97.03
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 97.0
2va8_A715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 97.0
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 96.98
2nqb_C123 Histone H2A; nucleosome, NCP, chromatin, structura 96.97
4a4z_A997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 96.96
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 96.94
1tzy_A129 Histone H2A-IV; histone-fold, tetramer-dimer-dimer 96.94
1id3_C131 Histone H2A.1; nucleosome core particle, chromatin 96.93
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 96.92
2i4i_A 417 ATP-dependent RNA helicase DDX3X; DEAD, structural 96.91
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 96.9
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 96.89
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 96.88
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 96.88
2p6r_A702 Afuhel308 helicase; protein-DNA complex, SF2 helic 96.85
4a2q_A 797 RIG-I, retinoic acid inducible protein I; hydrolas 96.81
2xgj_A1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 96.81
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 96.81
1f66_C128 Histone H2A.Z; nucleosome, chromatin, histone vari 96.8
3fho_A 508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 96.79
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 96.79
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 96.79
4gl2_A 699 Interferon-induced helicase C domain-containing P; 96.79
4gl2_A699 Interferon-induced helicase C domain-containing P; 96.79
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 96.79
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 96.75
2zj8_A720 DNA helicase, putative SKI2-type helicase; RECA fo 96.75
3fmp_B 479 ATP-dependent RNA helicase DDX19B; nuclear porin, 96.75
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 96.73
2ykg_A696 Probable ATP-dependent RNA helicase DDX58; hydrola 96.72
1w36_B 1180 RECB, exodeoxyribonuclease V beta chain; recombina 96.7
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 96.68
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 96.66
2f8n_K149 Histone H2A type 1; nucleosome, NCP, macroh2A, his 96.66
2db3_A 434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 96.64
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 96.61
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 96.6
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 96.6
1w36_B 1180 RECB, exodeoxyribonuclease V beta chain; recombina 96.6
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 96.58
3bos_A242 Putative DNA replication factor; P-loop containing 96.56
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 96.56
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 96.54
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 96.51
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 96.5
3bos_A242 Putative DNA replication factor; P-loop containing 96.5
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 96.49
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 96.48
4a2w_A936 RIG-I, retinoic acid inducible protein I; hydrolas 96.48
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 96.4
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 96.4
2eyq_A1151 TRCF, transcription-repair coupling factor; MFD, S 96.31
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 96.31
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 96.24
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 96.17
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 96.15
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 96.13
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 96.03
3dmq_A968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 96.02
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 95.97
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 95.96
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 95.95
2chg_A226 Replication factor C small subunit; DNA-binding pr 95.94
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 95.93
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 95.93
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 95.92
2chg_A226 Replication factor C small subunit; DNA-binding pr 95.9
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 95.86
2xau_A773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 95.86
2kjq_A149 DNAA-related protein; solution structure, NESG, st 95.84
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 95.84
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 95.81
2kjq_A149 DNAA-related protein; solution structure, NESG, st 95.78
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 95.77
3kl4_A 433 SRP54, signal recognition 54 kDa protein; signal r 95.74
2zpa_A671 Uncharacterized protein YPFI; RNA modification enz 95.74
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 95.73
2qgz_A308 Helicase loader, putative primosome component; str 95.72
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 95.71
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 95.71
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 95.7
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 95.67
3io5_A333 Recombination and repair protein; storage dimer, i 95.66
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 95.65
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 95.64
2v1x_A591 ATP-dependent DNA helicase Q1; DNA strand annealin 95.62
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 95.61
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 95.6
2zpa_A 671 Uncharacterized protein YPFI; RNA modification enz 95.6
2v1u_A387 Cell division control protein 6 homolog; DNA repli 95.6
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 95.6
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 95.59
4f92_B1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 95.59
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 95.59
2vl7_A 540 XPD; helicase, unknown function; 2.25A {Sulfolobus 95.59
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 95.59
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 95.58
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 95.57
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 95.56
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 95.54
3io5_A333 Recombination and repair protein; storage dimer, i 95.54
1z63_A 500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 95.53
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 95.52
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 95.52
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 95.51
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 95.51
2qgz_A308 Helicase loader, putative primosome component; str 95.51
1oyw_A523 RECQ helicase, ATP-dependent DNA helicase; winged 95.5
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 95.49
2qby_B 384 CDC6 homolog 3, cell division control protein 6 ho 95.49
1tue_A212 Replication protein E1; helicase, replication, E1E 95.48
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 95.46
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 95.45
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 95.44
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, FLAV 95.41
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 95.39
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 95.38
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 95.35
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 95.34
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 95.32
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 95.31
1yks_A440 Genome polyprotein [contains: flavivirin protease 95.29
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 95.28
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 95.27
1tue_A212 Replication protein E1; helicase, replication, E1E 95.27
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 95.26
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 95.24
2r62_A268 Cell division protease FTSH homolog; ATPase domain 95.22
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 95.2
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 95.19
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 95.19
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 95.16
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 95.16
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 95.15
1yks_A 440 Genome polyprotein [contains: flavivirin protease 95.14
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 95.1
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 95.09
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 95.09
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 95.09
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 95.06
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 95.05
3co5_A143 Putative two-component system transcriptional RES 95.03
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 95.03
1vma_A306 Cell division protein FTSY; TM0570, structural gen 95.02
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 95.01
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 94.98
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 94.97
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 94.97
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 94.97
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 94.96
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 94.95
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 94.93
3co5_A143 Putative two-component system transcriptional RES 94.92
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 94.9
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 94.88
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 94.88
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 94.86
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 94.82
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 94.79
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 94.78
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 94.77
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 94.77
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 94.74
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 94.74
2r62_A268 Cell division protease FTSH homolog; ATPase domain 94.73
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 94.72
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 94.72
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 94.72
3u4q_B 1166 ATP-dependent helicase/deoxyribonuclease subunit; 94.67
3u4q_B 1166 ATP-dependent helicase/deoxyribonuclease subunit; 94.67
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 94.66
2w00_A1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 94.63
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 94.58
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 94.58
1u94_A356 RECA protein, recombinase A; homologous recombinat 94.57
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 94.56
2chq_A319 Replication factor C small subunit; DNA-binding pr 94.55
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 94.54
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 94.53
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 94.53
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 94.49
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 94.47
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 94.46
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 94.45
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 94.45
4a15_A 620 XPD helicase, ATP-dependent DNA helicase TA0057; h 94.45
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 94.45
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 94.44
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 94.44
2z43_A324 DNA repair and recombination protein RADA; archaea 94.41
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 94.41
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 94.41
3rc3_A677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 94.4
1c4o_A 664 DNA nucleotide excision repair enzyme UVRB; uvrabc 94.4
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 94.4
1vma_A306 Cell division protein FTSY; TM0570, structural gen 94.39
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 94.37
1xjc_A169 MOBB protein homolog; structural genomics, midwest 94.36
2chq_A319 Replication factor C small subunit; DNA-binding pr 94.34
1u94_A356 RECA protein, recombinase A; homologous recombinat 94.33
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 94.32
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 94.32
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 94.31
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 94.31
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 94.3
1xjc_A169 MOBB protein homolog; structural genomics, midwest 94.3
2r44_A331 Uncharacterized protein; putative ATPase, structur 94.28
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 94.27
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 94.25
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 94.22
2cvh_A220 DNA repair and recombination protein RADB; filamen 94.22
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 94.19
3cpe_A 592 Terminase, DNA packaging protein GP17; large termi 94.19
1jr3_A 373 DNA polymerase III subunit gamma; processivity, pr 94.18
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 94.18
2cvh_A220 DNA repair and recombination protein RADB; filamen 94.18
2r44_A331 Uncharacterized protein; putative ATPase, structur 94.17
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 94.17
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 94.15
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 94.15
1xp8_A366 RECA protein, recombinase A; recombination, radior 94.14
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 94.14
3pvs_A447 Replication-associated recombination protein A; ma 94.13
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 94.12
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 94.11
1p9r_A418 General secretion pathway protein E; bacterial typ 94.11
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 94.1
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 94.09
2r6a_A454 DNAB helicase, replicative helicase; replication, 94.08
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 94.06
2v3c_C 432 SRP54, signal recognition 54 kDa protein; nucleoti 94.05
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 94.04
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 94.04
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 94.03
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 94.02
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 94.02
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 94.02
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 94.0
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 93.98
3cpe_A592 Terminase, DNA packaging protein GP17; large termi 93.98
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 93.97
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 93.95
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 93.95
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 93.95
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 93.94
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 93.93
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 93.93
1xp8_A366 RECA protein, recombinase A; recombination, radior 93.92
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 93.92
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 93.88
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 93.87
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 93.85
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 93.84
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 93.84
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 93.83
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 93.82
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 93.82
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 93.81
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 93.8
3pvs_A 447 Replication-associated recombination protein A; ma 93.8
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 93.78
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 93.78
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 93.77
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 93.77
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 93.76
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 93.76
1q57_A503 DNA primase/helicase; dntpase, DNA replication, tr 93.74
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 93.73
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 93.73
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 93.71
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 93.71
2r6a_A454 DNAB helicase, replicative helicase; replication, 93.7
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 93.68
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 93.67
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 93.67
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 93.65
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 93.64
1p9r_A418 General secretion pathway protein E; bacterial typ 93.63
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 93.62
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 93.6
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 93.58
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 93.58
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 93.57
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 93.57
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 93.56
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 93.54
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 93.52
2fna_A357 Conserved hypothetical protein; structural genomic 93.51
1w5s_A 412 Origin recognition complex subunit 2 ORC2; replica 93.5
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 93.5
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 93.49
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 93.48
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 93.47
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 93.46
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 93.44
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 93.39
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 93.39
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 93.37
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 93.34
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 93.32
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 93.32
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 93.3
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 93.3
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 93.29
2xxa_A 433 Signal recognition particle protein; protein trans 93.28
2o0j_A385 Terminase, DNA packaging protein GP17; nucleotide- 93.28
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 93.27
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 93.25
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 93.25
3crv_A 551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 93.24
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 93.19
2z43_A324 DNA repair and recombination protein RADA; archaea 93.18
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 93.17
2o0j_A385 Terminase, DNA packaging protein GP17; nucleotide- 93.11
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 93.07
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 93.07
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 93.06
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 93.04
2fna_A 357 Conserved hypothetical protein; structural genomic 93.04
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 93.01
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 92.99
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 92.94
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 92.92
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 92.9
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 92.89
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 92.85
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 92.82
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 92.82
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 92.81
1ojl_A304 Transcriptional regulatory protein ZRAR; response 92.79
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 92.72
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 92.69
3vaa_A199 Shikimate kinase, SK; structural genomics, center 92.64
1z3i_X 644 Similar to RAD54-like; recombination ATPase helica 92.64
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 92.64
1kag_A173 SKI, shikimate kinase I; transferase, structural g 92.6
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 92.59
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 92.57
1q57_A503 DNA primase/helicase; dntpase, DNA replication, tr 92.57
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 92.56
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 92.55
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 92.54
3nbx_X500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 92.51
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 92.51
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 92.5
1ojl_A304 Transcriptional regulatory protein ZRAR; response 92.48
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 92.48
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 92.47
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 92.4
3mwy_W 800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 92.39
3vaa_A199 Shikimate kinase, SK; structural genomics, center 92.38
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 92.38
1via_A175 Shikimate kinase; structural genomics, transferase 92.34
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 92.33
1kag_A173 SKI, shikimate kinase I; transferase, structural g 92.32
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 92.27
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 92.23
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 92.23
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 92.21
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 92.19
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 92.17
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 92.17
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 92.17
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 92.17
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 92.15
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 92.13
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 92.1
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 92.1
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 92.1
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 92.09
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 92.09
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 92.08
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 92.0
3bs4_A260 Uncharacterized protein PH0321; structural genomic 91.96
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 91.96
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 91.94
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 91.93
3bs4_A260 Uncharacterized protein PH0321; structural genomic 91.93
2d7d_A 661 Uvrabc system protein B; helicase, protein-DNA-ADP 91.91
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 91.91
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 91.85
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 91.83
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 91.83
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 91.82
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 91.81
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 91.79
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 91.78
1via_A175 Shikimate kinase; structural genomics, transferase 91.75
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 91.74
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 91.74
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 91.74
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 91.73
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 91.73
2xxa_A433 Signal recognition particle protein; protein trans 91.73
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 91.7
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 91.69
1g41_A444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 91.66
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 91.66
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 91.66
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 91.65
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 91.62
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 91.6
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 91.58
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
Probab=99.88  E-value=1.2e-22  Score=247.01  Aligned_cols=149  Identities=22%  Similarity=0.224  Sum_probs=112.6

Q ss_pred             CcceEEEEEeechhhhHHHHHHHhhhhhccccc-CCCCCccccCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHhcC-
Q psy12659        114 PRQAIIIGFLLIQVLKKRTEEEENEDEDVEMEN-KDGKPIITVEPHVIPSRGPYLFNEPRKNTIPFTPTQIEAIRAGMQ-  191 (1051)
Q Consensus       114 ~~~~~~i~~l~~~~~~~R~~~Al~~l~~~~~~~-~~l~~~l~~~~~~~~~~~p~~~~~~~~~~~~ln~~Q~~Ai~~~l~-  191 (1051)
                      ....|.+.++.+..+++|++.|++.+....... ..+..++.......+.....+   .......||++|++||..+++ 
T Consensus       128 ~~~~~~~~~~~~~~~~~r~~~al~~l~~~~~~~~~~l~~~l~~~~~p~~~~~~~~---~~~~~~~LN~~Q~~AV~~al~~  204 (646)
T 4b3f_X          128 RENSYRLLKLANDVTYRRLKKALIALKKYHSGPASSLIEVLFGRSAPSPASEIHP---LTFFNTCLDTSQKEAVLFALSQ  204 (646)
T ss_dssp             SSCCEEEEEECCHHHHHHHHHHHHHHHTCCSSTTHHHHHHHTTSSCCCCCCCCCC---CCCSSTTCCHHHHHHHHHHHHC
T ss_pred             CCCcEEEEEeccchHHHHHHHHHHHhhhcccCchHHHHHHHcCCCCCCCccccCc---ccccCCCCCHHHHHHHHHHhcC
Confidence            445689999999999999999999887532211 112223332221111111111   111234799999999999985 


Q ss_pred             CCeEEEEccCCCChHHHHHHHHHHHHHcCCCCeEEEEeCCHHHHHHHHHHHHhCCCCCCcEEEecCCccccchhhhhcc
Q psy12659        192 PGLTLVVGPPGTGKTDVAVQIISNLYHNFPHQRTLIVTHSNQALNQLFEKIISLDVDERHLLRLGHGEEALETEKDFSR  270 (1051)
Q Consensus       192 ~~~~lI~GPPGTGKT~ti~~ii~~l~~~~p~~riLv~a~SN~Avd~l~~rl~~~~~~~~~lvRlG~~~~~~~~~~~fs~  270 (1051)
                      ++++|||||||||||+|++++|.+++++  +.+||||||||.|||++++||...+.   .++|+|+..+..+....++.
T Consensus       205 ~~~~lI~GPPGTGKT~ti~~~I~~l~~~--~~~ILv~a~TN~AvD~i~erL~~~~~---~ilRlG~~~r~~~~~~~~~l  278 (646)
T 4b3f_X          205 KELAIIHGPPGTGKTTTVVEIILQAVKQ--GLKVLCCAPSNIAVDNLVERLALCKQ---RILRLGHPARLLESIQQHSL  278 (646)
T ss_dssp             SSEEEEECCTTSCHHHHHHHHHHHHHHT--TCCEEEEESSHHHHHHHHHHHHHTTC---CEEECSCCSSCCHHHHTTBH
T ss_pred             CCceEEECCCCCCHHHHHHHHHHHHHhC--CCeEEEEcCchHHHHHHHHHHHhcCC---ceEEecchhhhhhhhhhhhH
Confidence            7899999999999999999999999987  78999999999999999999998766   79999999888766665554
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* Back     alignment and structure
>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* Back     alignment and structure
>3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>2f8n_G Core histone macro-H2A.1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Homo sapiens} SCOP: a.22.1.1 PDB: 1u35_C Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>2nqb_C Histone H2A; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_C* Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>1tzy_A Histone H2A-IV; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_A 1hq3_A 2aro_A 2hio_A 3c9k_A 3azg_C 3a6n_C 3an2_C 3av1_C 3av2_C 3ayw_C 3aze_C 3azf_C 3afa_C 3azh_C 3azi_C 3azj_C 3azk_C 3azl_C 3azm_C ... Back     alignment and structure
>1id3_C Histone H2A.1; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>1f66_C Histone H2A.Z; nucleosome, chromatin, histone variant, protein DNA interaction, nucleoprotein, supercoiled DNA, complex (nucleosome core/DNA); 2.60A {Homo sapiens} SCOP: a.22.1.1 Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>1w36_B RECB, exodeoxyribonuclease V beta chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 c.52.1.24 PDB: 3k70_B* Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2f8n_K Histone H2A type 1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Mus musculus} SCOP: a.22.1.1 Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>1w36_B RECB, exodeoxyribonuclease V beta chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 c.52.1.24 PDB: 3k70_B* Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3u4q_B ATP-dependent helicase/deoxyribonuclease subunit; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_B* Back     alignment and structure
>3u4q_B ATP-dependent helicase/deoxyribonuclease subunit; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_B* Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>3bs4_A Uncharacterized protein PH0321; structural genomics, unknown function, PSI-2, protein struct initiative; 1.60A {Pyrococcus horikoshii} Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>3bs4_A Uncharacterized protein PH0321; structural genomics, unknown function, PSI-2, protein struct initiative; 1.60A {Pyrococcus horikoshii} Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1051
d1tzya_106 a.22.1.1 (A:) Histone H2A {Chicken (Gallus gallus) 9e-15
d1u35c1106 a.22.1.1 (C:814-919) macro-H2A.1, histone domain { 2e-14
d1f66c_103 a.22.1.1 (C:) Histone H2A {Human (Homo sapiens), v 8e-12
d1uaaa1306 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escheri 2e-06
d1uaaa1306 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escheri 4e-05
g1qhh.1623 c.37.1.19 (A:,B:,C:,D:) DEXX box DNA helicase {Bac 2e-05
g1qhh.1 623 c.37.1.19 (A:,B:,C:,D:) DEXX box DNA helicase {Bac 3e-04
d1pjra1318 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillu 6e-05
d1pjra1318 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillu 0.002
d1tf7a2242 c.37.1.11 (A:256-497) Circadian clock protein KaiC 9e-05
d1tf7a2242 c.37.1.11 (A:256-497) Circadian clock protein KaiC 2e-04
d1tf7a1242 c.37.1.11 (A:14-255) Circadian clock protein KaiC 2e-04
d1tf7a1242 c.37.1.11 (A:14-255) Circadian clock protein KaiC 0.001
d1nlfa_274 c.37.1.11 (A:) Hexameric replicative helicase repA 4e-04
d1nlfa_274 c.37.1.11 (A:) Hexameric replicative helicase repA 0.003
d1q9ca_172 a.22.1.3 (A:) Histone domain of Son of sevenless p 0.001
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 0.002
d1n0wa_242 c.37.1.11 (A:) DNA repair protein Rad51, catalytic 0.004
d1n0wa_242 c.37.1.11 (A:) DNA repair protein Rad51, catalytic 0.004
d1szpa2251 c.37.1.11 (A:145-395) DNA repair protein Rad51, ca 0.004
>d1tzya_ a.22.1.1 (A:) Histone H2A {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Length = 106 Back     information, alignment and structure

class: All alpha proteins
fold: Histone-fold
superfamily: Histone-fold
family: Nucleosome core histones
domain: Histone H2A
species: Chicken (Gallus gallus), erythrocytes [TaxId: 9031]

 Score = 69.1 bits (169), Expect = 9e-15
 Identities = 28/42 (66%), Positives = 36/42 (85%)

Query: 892 HKKYRITPRYLLLAIKNDVELSQLLSDVTIAQGGVMPNIQSM 933
           +KK RI PR+L LAI+ND EL++LL  VTIAQGGV+PNIQ++
Sbjct: 61  NKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAV 102
>d1u35c1 a.22.1.1 (C:814-919) macro-H2A.1, histone domain {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1f66c_ a.22.1.1 (C:) Histone H2A {Human (Homo sapiens), variant H2A.Z [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Length = 306 Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Length = 306 Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Length = 318 Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Length = 318 Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Length = 242 Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Length = 242 Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Length = 242 Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Length = 242 Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Length = 274 Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Length = 274 Back     information, alignment and structure
>d1q9ca_ a.22.1.3 (A:) Histone domain of Son of sevenless protein {Human (Homo sapiens) [TaxId: 9606]} Length = 172 Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 251 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1051
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 99.11
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 99.07
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 99.05
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 99.05
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 98.87
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 98.84
g1qhh.1623 DEXX box DNA helicase {Bacillus stearothermophilus 98.59
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 98.49
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 97.87
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 97.87
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 97.85
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 97.82
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 97.77
d1w36b1485 Exodeoxyribonuclease V beta chain (RecB), N-termin 97.77
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 97.75
d1w36b1 485 Exodeoxyribonuclease V beta chain (RecB), N-termin 97.71
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 97.71
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 97.63
d1tzya_106 Histone H2A {Chicken (Gallus gallus), erythrocytes 97.55
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 97.45
d1u35c1106 macro-H2A.1, histone domain {Human (Homo sapiens) 97.45
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 97.32
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 97.31
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 97.29
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 97.24
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 97.23
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 97.2
d1ls1a2207 GTPase domain of the signal sequence recognition p 97.16
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 97.15
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 97.13
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 97.12
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 97.06
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 97.05
d1ls1a2207 GTPase domain of the signal sequence recognition p 97.04
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 97.04
d2qy9a2211 GTPase domain of the signal recognition particle r 97.03
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 97.01
d1f66c_103 Histone H2A {Human (Homo sapiens), variant H2A.Z [ 97.01
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 97.0
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 96.96
d1vmaa2213 GTPase domain of the signal recognition particle r 96.95
d2qy9a2211 GTPase domain of the signal recognition particle r 96.94
d1j8yf2211 GTPase domain of the signal sequence recognition p 96.94
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 96.93
d1okkd2207 GTPase domain of the signal recognition particle r 96.92
d1okkd2207 GTPase domain of the signal recognition particle r 96.92
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 96.89
d1j8yf2211 GTPase domain of the signal sequence recognition p 96.88
d1vmaa2213 GTPase domain of the signal recognition particle r 96.84
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 96.84
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 96.84
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 96.77
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 96.74
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 96.74
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 96.71
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 96.63
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 96.61
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 96.6
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 96.59
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 96.57
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 96.54
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 96.47
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 96.44
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 96.43
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 96.42
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 96.41
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 96.24
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 96.23
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 96.23
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 96.2
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 96.19
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 96.19
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 96.19
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 96.18
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 96.16
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 96.14
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 96.14
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 96.12
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 96.12
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 96.12
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 96.12
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 96.09
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 96.09
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 96.08
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 96.07
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 96.04
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 96.04
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 96.03
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 96.03
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 96.02
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 95.99
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 95.93
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 95.91
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 95.91
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 95.9
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 95.9
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 95.89
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 95.88
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 95.88
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 95.84
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 95.82
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 95.77
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 95.74
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 95.73
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 95.71
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 95.64
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 95.6
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 95.6
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 95.6
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 95.58
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 95.54
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 95.52
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 95.5
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 95.45
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 95.44
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 95.4
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 95.4
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 95.39
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 95.36
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 95.32
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 95.31
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 95.24
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 95.23
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 95.22
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 95.16
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 95.13
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 95.11
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 95.1
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 95.07
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 95.06
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 95.05
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 95.05
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 95.04
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 95.03
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 95.02
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 95.0
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 94.97
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 94.97
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 94.93
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 94.93
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 94.91
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 94.91
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 94.84
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 94.8
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 94.74
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 94.73
d1svma_362 Papillomavirus large T antigen helicase domain {Si 94.72
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 94.71
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 94.66
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 94.65
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 94.62
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 94.6
d1svma_362 Papillomavirus large T antigen helicase domain {Si 94.6
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 94.59
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 94.53
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 94.52
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 94.51
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 94.51
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 94.5
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 94.46
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 94.43
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 94.39
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 94.38
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 94.37
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 94.35
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 94.34
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 94.31
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 94.28
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 94.28
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 94.27
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 94.26
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 94.24
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 94.19
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 94.17
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 94.14
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 94.12
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 94.1
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 94.1
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 94.09
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 94.06
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 94.03
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 93.98
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 93.96
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 93.91
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 93.89
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 93.89
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 93.88
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 93.85
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 93.83
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 93.8
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 93.78
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 93.76
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 93.66
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 93.65
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 93.62
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 93.57
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 93.55
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 93.47
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 93.44
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 93.43
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 93.4
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 93.32
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 93.31
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 93.28
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 93.16
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 93.15
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 92.96
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 92.93
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 92.89
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 92.85
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 92.82
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 92.79
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 92.78
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 92.72
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 92.7
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 92.47
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 92.43
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 92.42
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 92.4
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 92.39
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 92.38
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 92.38
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 91.96
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 91.88
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 91.74
d1t5la1413 Nucleotide excision repair enzyme UvrB {Bacillus c 91.73
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 91.6
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 91.58
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 91.42
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 91.17
d1t5la1 413 Nucleotide excision repair enzyme UvrB {Bacillus c 91.12
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 90.95
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 90.89
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 90.76
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 90.75
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 90.57
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 90.56
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 90.5
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 90.41
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 90.37
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 90.31
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 90.26
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 90.06
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 90.03
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 89.96
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 89.94
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 89.93
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 89.93
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 89.83
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 89.78
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 89.65
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 89.46
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 89.39
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 89.32
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 89.3
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 88.85
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 88.81
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 88.76
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 88.75
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 88.67
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 88.52
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 88.51
d1tuea_205 Replication protein E1 helicase domain {Human papi 88.44
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 88.44
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 87.96
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 87.96
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 87.91
d1xpua3289 Transcription termination factor Rho, ATPase domai 87.85
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 87.72
d1xpua3289 Transcription termination factor Rho, ATPase domai 87.7
d2afhe1289 Nitrogenase iron protein {Azotobacter vinelandii [ 87.52
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 87.5
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 87.46
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 87.4
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 87.2
d1c4oa1408 Nucleotide excision repair enzyme UvrB {Thermus th 87.1
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 87.1
d1c4oa1 408 Nucleotide excision repair enzyme UvrB {Thermus th 86.82
d1tuea_205 Replication protein E1 helicase domain {Human papi 86.57
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 86.22
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 86.22
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 85.97
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 85.78
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 85.37
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 85.29
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 85.16
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 85.01
d1nrjb_209 Signal recognition particle receptor beta-subunit 84.97
g1ii8.1 369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 84.75
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 84.58
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 84.14
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 84.02
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 83.98
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 83.69
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 83.43
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 83.38
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 83.27
d2afhe1289 Nitrogenase iron protein {Azotobacter vinelandii [ 83.01
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 82.99
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 82.97
d1nrjb_209 Signal recognition particle receptor beta-subunit 82.66
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 82.49
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 82.43
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 82.42
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 82.35
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 82.29
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 82.21
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 82.17
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 82.03
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 81.93
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 81.92
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 81.16
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 81.15
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 81.12
d2fh5b1207 Signal recognition particle receptor beta-subunit 81.07
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 81.07
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 81.05
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 80.76
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 80.66
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 80.65
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 80.48
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 80.42
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 80.3
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 80.28
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 80.26
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 80.24
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 80.08
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: DEXX box DNA helicase
species: Escherichia coli, RepD [TaxId: 562]

Probab=99.11  E-value=3.3e-11  Score=128.36  Aligned_cols=67  Identities=27%  Similarity=0.368  Sum_probs=58.5

Q ss_pred             CCCHHHHHHHHHhcCCCeEEEEccCCCChHHHHHHHHHHHHHcC--CCCeEEEEeCCHHHHHHHHHHHHhC
Q psy12659        177 PFTPTQIEAIRAGMQPGLTLVVGPPGTGKTDVAVQIISNLYHNF--PHQRTLIVTHSNQALNQLFEKIISL  245 (1051)
Q Consensus       177 ~ln~~Q~~Ai~~~l~~~~~lI~GPPGTGKT~ti~~ii~~l~~~~--p~~riLv~a~SN~Avd~l~~rl~~~  245 (1051)
                      +||++|++||..  ..+..+|.||||||||+|++..|..++.+.  +..+|||+|+||.|++++.+++.+.
T Consensus         1 ~L~~eQ~~av~~--~~~~~lI~g~aGTGKTt~l~~rv~~ll~~~~~~~~~ILvlt~tn~a~~~i~~~~~~~   69 (306)
T d1uaaa1           1 RLNPGQQQAVEF--VTGPCLVLAGAGSGKTRVITNKIAHLIRGCGYQARHIAAVTFTNKAAREMKERVGQT   69 (306)
T ss_dssp             CCCHHHHHHHHC--CSSEEEECCCTTSCHHHHHHHHHHHHHHHHCCCGGGEEEEESSHHHHHHHHHHHHHH
T ss_pred             CcCHHHHHHHhC--CCCCEEEEeeCCccHHHHHHHHHHHHHHhcCCChhHEEEEeCcHHHHHHHHHHHHHh
Confidence            589999999975  356689999999999999999998888653  4579999999999999999999764
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1tzya_ a.22.1.1 (A:) Histone H2A {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u35c1 a.22.1.1 (C:814-919) macro-H2A.1, histone domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1f66c_ a.22.1.1 (C:) Histone H2A {Human (Homo sapiens), variant H2A.Z [TaxId: 9606]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure