Psyllid ID: psy12776

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-----
MPFVFVDFPEEQYWILRHLTLFNKLIVFIPTYNFIMDSDINEGTEDPVCRNLFTDYYPSTWRKHLGNFLKCNRTLPVLETVPHIFPMKIIEGVCTNATAPSVSSINRILRNRAAERAAAEFARAAGYGIYHTAHPYASFHWPNPGIWNPNNPPVVSNQGPGTTPSSGAAGSPRGLMPRLFVPFGHCYSFSPTSDHVHINNEHTPITPCFVSDGDAKDDDSVGSGSGSEQPKFRRNRTTFSPSQLDELEKEFDKSHYPCVSTRERLAAKTSLSEARVQFLTIIPTPSHTYLPRIERNSTFMYFIFYLILVLFTTHCGKFLTIIPTPSHTWDLRIGRTDGHFKSVWFSNRRAKWRRHQRMNLLKSRRANAANVSGQGQVTSDSSSPSTPSLWRHMGGENSAFKSLSHLSYNNNNIDDADQHYPSSDESEEINVTFTF
ccEEEEcccccHHHHHHHHHHHccEEEEEEcccEEEcccccccccccHHHHcccccccHHHHHHHccccccccHHHHHHccccEEEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccHHHHHHHHHHccccccEEEEEcccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEc
ccEEEEcccHHHHHHHHHHHHHHHHEEEcccccEEEccccccccccHHHHHHcccccccHHHHHHccHccHHHHHHHHHHcccEEEEEHHcccccccccccHHHHHHHHHHHHHHcHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHEHHHcccHHHHHcccccccccccccccccccccccccccccccccccccccccccEccccccEEEEEcccHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHcccccHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEEEc
mpfvfvdfpeEQYWILRHLTLFNKLIVfiptynfimdsdinegtedpvcrnlftdyypstWRKHLGnflkcnrtlpvletvphifpmkiiegvctnatapsvSSINRILRNRAAERAAAEFARAAgygiyhtahpyasfhwpnpgiwnpnnppvvsnqgpgttpssgaagsprglmprlfvpfghcysfsptsdhvhinnehtpitpcfvsdgdakdddsvgsgsgseqpkfrrnrttfspsqldelekefdkshypcvstreRLAAKTSLSEARVQFLtiiptpshtylpriernsTFMYFIFYLILVLFTTHcgkfltiiptpshtwdlrigrtdghfksVWFSNRRAKWRRHQRMNLLKSRranaanvsgqgqvtsdssspstpslwrhmggensafKSLSHLSynnnniddadqhypssdeseeinvtftf
MPFVFVDFPEEQYWILRHLTLFNKLIVFIPTYNFIMDSDINEGTEDPVCRNLFTDYYPSTWRKHLGNFLKCNRTLPVLETVPHIFPMKIIEGVCTNATAPSVSSINRILRNRAAERAAAEFARAAGYGIYHTAHPYASFHWPNPGIWNPNNPPVVSNQGPGTTPSSGAAGSPRGLMPRLFVPFGHCYSFSPTSDHVHINNEHTPITPCFVSDGDAKDDDSVGsgsgseqpkfrrnrttfspsqldelekefdkshypcvSTRERLAAKTSLSEARVQFltiiptpshtylpRIERNSTFMYFIFYLILVLFTTHCGKFLTIIPTPSHTWDLRigrtdghfksvwfsnrrakwrRHQRMNLLKSrranaanvsgqgqvtsdsssPSTPSLWRHMGGENSAFKSLSHLSYNNNNIDDADQhypssdeseeinvtftf
MPFVFVDFPEEQYWILRHLTLFNKLIVFIPTYNFIMDSDINEGTEDPVCRNLFTDYYPSTWRKHLGNFLKCNRTLPVLETVPHIFPMKIIEGVCTNATAPSVSSINRILRNraaeraaaefaraaGYGIYHTAHPYASFHwpnpgiwnpnnppVVSNQGPGTTPSSGAAGSPRGLMPRLFVPFGHCYSFSPTSDHVHINNEHTPITPCFVsdgdakdddsvgsgsgsEQPKFRRNRTTFSPSQLDELEKEFDKSHYPCVSTRERLAAKTSLSEARVQFLTIIPTPSHTYLPRIERNSTFMYFIFYLILVLFTTHCGKFLTIIPTPSHTWDLRIGRTDGHFKSVWFSNRRAKWRRHQRMNLLKSRRANAANVSGQGQVtsdssspstpsLWRHMGGENSAFKSLSHLSYNNNNIDDADQHYPSSDESEEINVTFTF
**FVFVDFPEEQYWILRHLTLFNKLIVFIPTYNFIMDSDINEGTEDPVCRNLFTDYYPSTWRKHLGNFLKCNRTLPVLETVPHIFPMKIIEGVCTNATAPSVSSINRILRNRAAERAAAEFARAAGYGIYHTAHPYASFHWPNPGIWN***************************MPRLFVPFGHCYSFSPTSDHVHINNEHTPITPCFV**********************************************************TSLSEARVQFLTIIPTPSHTYLPRIERNSTFMYFIFYLILVLFTTHCGKFLTIIPTPSHTWDLRIGRTDGHFKSVWFSNRRAKWRR*********************************************************************************
*PFVFVDFPEEQYWILRHLTLFNKLIVFIPTYNFIMDSDINEGTEDPVCRNLFTDYYPSTWRKHLGNFLKCNRTLPVLETVPHIFPMKIIEGVCTNATAPSVSSINRILRN*******************************************************************************************************************************FSPSQLDELEKEFDKSHYPCVSTRERLAAKTSLSEARVQFLTIIPT*****************************************************************************************************************************************************T*
MPFVFVDFPEEQYWILRHLTLFNKLIVFIPTYNFIMDSDINEGTEDPVCRNLFTDYYPSTWRKHLGNFLKCNRTLPVLETVPHIFPMKIIEGVCTNATAPSVSSINRILRNRAAERAAAEFARAAGYGIYHTAHPYASFHWPNPGIWNPNNPPVVSNQ************SPRGLMPRLFVPFGHCYSFSPTSDHVHINNEHTPITPCFVSDGD********************NRTTFSPSQLDELEKEFDKSHYPCVSTRERLAAKTSLSEARVQFLTIIPTPSHTYLPRIERNSTFMYFIFYLILVLFTTHCGKFLTIIPTPSHTWDLRIGRTDGHFKSVWFSNRRAKWRRHQRMNLLKSRRAN**********************WRHMGGENSAFKSLSHLSYNNNNIDDADQHYPSSDESEEINVTFTF
MPFVFVDFPEEQYWILRHLTLFNKLIVFIPTYNFIMDSDINEGTEDPVCRNLFTDYYPSTWRKHLGNFLKCNRTLPVLETVPHIFPMKIIEGVCTNATAPSVSSINRILRNRAAERAAAEFA**AGYGIYHTAHPYASFHWPNPGIWNPNNPPVVSNQGPGTTPSSGAAGS***************************************************************NRTTFSPSQLDELEKEFDKSHYPCVSTRERLAAKTSLSEARVQFLTIIPTPSHTYLPRIERNSTFMYFIFYLILVLFTTHCGKFLTIIPTPSHTWDLRIGRTDGHFKSVWFSNRRAKWRRHQRMNLLK************************PSLWRH***ENSAFKSLSHLSYNNNNIDDADQHYPSSDESEEINVTFTF
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPFVFVDFPEEQYWILRHLTLFNKLIVFIPTYNFIMDSDINEGTEDPVCRNLFTDYYPSTWRKHLGNFLKCNRTLPVLETVPHIFPMKIIEGVCTNATAPSVSSINRILRNRAAERAAAEFARAAGYGIYHTAHPYASFHWPNPGIWNPNNPPVVSNQGPGTTPSSGAAGSPRGLMPRLFVPFGHCYSFSPTSDHVHINNEHTPITPCFVSDGDAKDDDSVGSGSGSEQPKFRRNRTTFSPSQLDELEKEFDKSHYPCVSTRERLAAKTSLSEARVQFLTIIPTPSHTYLPRIERNSTFMYFIFYLILVLFTTHCGKFLTIIPTPSHTWDLRIGRTDGHFKSVWFSNRRAKWRRHQRMNLLKSRRANAANVSGQGQVTSDSSSPSTPSLWRHMGGENSAFKSLSHLSYNNNNIDDADQHYPSSDESEEINVTFTF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query435 2.2.26 [Sep-21-2011]
P26630437 Paired box protein Pax-6 yes N/A 0.340 0.338 0.341 6e-16
P63016422 Paired box protein Pax-6 yes N/A 0.360 0.372 0.331 8e-16
O73917437 Paired box protein Pax-6 N/A N/A 0.340 0.338 0.336 1e-15
P63015422 Paired box protein Pax-6 yes N/A 0.360 0.372 0.331 1e-15
P26367422 Paired box protein Pax-6 yes N/A 0.360 0.372 0.331 1e-15
Q1LZF1422 Paired box protein Pax-6 yes N/A 0.360 0.372 0.331 2e-15
P47238416 Paired box protein Pax-6 N/A N/A 0.360 0.377 0.336 9e-15
P55864422 Paired box protein Pax-6 N/A N/A 0.356 0.367 0.323 1e-13
Q9PVX0317 Retinal homeobox protein no N/A 0.213 0.293 0.443 2e-10
O42115453 Aristaless-related homeob no N/A 0.154 0.147 0.554 4e-10
>sp|P26630|PAX6_DANRE Paired box protein Pax-6 OS=Danio rerio GN=pax6a PE=2 SV=1 Back     alignment and function desciption
 Score = 85.9 bits (211), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 72/211 (34%), Positives = 93/211 (44%), Gaps = 63/211 (29%)

Query: 82  PHIFPMKI-----IEGVCTNATAPSVSSINRILRNRAAERAAAEFARAAGYGIYHTAHPY 136
           P IF  +I      EGVCTN   PSVSSINR+LRN A+E+      +    G+Y      
Sbjct: 114 PSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLRNLASEKQ-----QMGADGMYEKLRML 168

Query: 137 ASFHWPNPGIWNPNNPPVVSNQGPGTTPSSGAAGSPRGLMPRLFVPFGHCYSFSPTSDHV 196
                   G W             GT P         G  P   VP        P  D  
Sbjct: 169 NG----QTGTW-------------GTRP---------GWYPGTSVPG------QPNQDG- 195

Query: 197 HINNEHTPITPCFVSDGDAKDDDSVGS-GSGSEQPKFR--------RNRTTFSPSQLDEL 247
                      C  SDG  ++ +S+ S G  S++ + R        RNRT+F+  Q++ L
Sbjct: 196 -----------CQQSDGGGENTNSISSNGEDSDETQMRLQLKRKLQRNRTSFTQEQIEAL 244

Query: 248 EKEFDKSHYPCVSTRERLAAKTSLSEARVQF 278
           EKEF+++HYP V  RERLAAK  L EAR+Q 
Sbjct: 245 EKEFERTHYPDVFARERLAAKIDLPEARIQV 275
Transcription factor expressed in spatially restricted regions of the neural tube during embryonic development.
Danio rerio (taxid: 7955)
>sp|P63016|PAX6_RAT Paired box protein Pax-6 OS=Rattus norvegicus GN=Pax6 PE=2 SV=1 Back     alignment and function description
>sp|O73917|PAX6_ORYLA Paired box protein Pax-6 OS=Oryzias latipes GN=pax6 PE=2 SV=1 Back     alignment and function description
>sp|P63015|PAX6_MOUSE Paired box protein Pax-6 OS=Mus musculus GN=Pax6 PE=1 SV=1 Back     alignment and function description
>sp|P26367|PAX6_HUMAN Paired box protein Pax-6 OS=Homo sapiens GN=PAX6 PE=1 SV=2 Back     alignment and function description
>sp|Q1LZF1|PAX6_BOVIN Paired box protein Pax-6 OS=Bos taurus GN=PAX6 PE=2 SV=1 Back     alignment and function description
>sp|P47238|PAX6_COTJA Paired box protein Pax-6 OS=Coturnix coturnix japonica GN=PAX6 PE=2 SV=1 Back     alignment and function description
>sp|P55864|PAX6_XENLA Paired box protein Pax-6 OS=Xenopus laevis GN=pax6 PE=2 SV=1 Back     alignment and function description
>sp|Q9PVX0|RX2_CHICK Retinal homeobox protein Rx2 OS=Gallus gallus GN=RX2 PE=2 SV=1 Back     alignment and function description
>sp|O42115|ARX_DANRE Aristaless-related homeobox protein OS=Danio rerio GN=arx PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query435
328718969 691 PREDICTED: hypothetical protein LOC10016 0.411 0.259 0.606 3e-43
195376711 719 GJ13265 [Drosophila virilis] gi|19415429 0.409 0.247 0.492 8e-36
195327129 669 GM24656 [Drosophila sechellia] gi|194119 0.395 0.257 0.470 8e-36
24663292 670 eyegone, isoform A [Drosophila melanogas 0.395 0.256 0.470 2e-35
21260588 670 eyegone [Drosophila melanogaster] 0.395 0.256 0.470 2e-35
60678223 675 AT09010p [Drosophila melanogaster] 0.395 0.254 0.470 2e-35
194869847 670 GG13831 [Drosophila erecta] gi|190654316 0.395 0.256 0.470 3e-35
195493839 680 GE20121 [Drosophila yakuba] gi|194180686 0.4 0.255 0.472 3e-35
3659897523 Eyegone [Drosophila melanogaster] 0.395 0.328 0.470 3e-35
195589826 666 GD12719 [Drosophila simulans] gi|1941966 0.395 0.258 0.470 3e-35
>gi|328718969|ref|XP_001942532.2| PREDICTED: hypothetical protein LOC100165522 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  182 bits (462), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 125/206 (60%), Positives = 140/206 (67%), Gaps = 27/206 (13%)

Query: 89  IIEGVCTNATAPSVSSINRILRNRAAERAAAEFARAAGYGIYHTAHPYASFHWP-NP-GI 146
           I EGVCTN TAPSVSSINRILRNRAAERAAAEFARAAGYG+Y  +HPYASF WP +P G+
Sbjct: 176 ISEGVCTNGTAPSVSSINRILRNRAAERAAAEFARAAGYGLYQVSHPYASFPWPPHPHGM 235

Query: 147 WNPNNPPVVSNQGPGTTPSSGAAGSPRGLMPRLFVPFGHCYSFSPTSDHVHINNEHTP-- 204
           W     P V+  GP    ++ ++    G +P    P G     +P    +   N H P  
Sbjct: 236 W-----PGVATDGPSAVAAAVSS---SGGLPMHHGPSGASNKNTPLQQMI---NAHQPCG 284

Query: 205 ------ITPCFVSDGDA-----KDD-DSVGSGSGSEQPKFRRNRTTFSPSQLDELEKEFD 252
                 + P  + DG       KDD +SVGSGSGSEQPKFRRNRTTFSP QLDELEKEFD
Sbjct: 285 VMSSRDLMPRLLGDGSGGVDGCKDDMESVGSGSGSEQPKFRRNRTTFSPDQLDELEKEFD 344

Query: 253 KSHYPCVSTRERLAAKTSLSEARVQF 278
           KSHYPCVSTRERLAAKTSLSEARVQ 
Sbjct: 345 KSHYPCVSTRERLAAKTSLSEARVQV 370

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|195376711|ref|XP_002047136.1| GJ13265 [Drosophila virilis] gi|194154294|gb|EDW69478.1| GJ13265 [Drosophila virilis] Back     alignment and taxonomy information
>gi|195327129|ref|XP_002030274.1| GM24656 [Drosophila sechellia] gi|194119217|gb|EDW41260.1| GM24656 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|24663292|ref|NP_524042.2| eyegone, isoform A [Drosophila melanogaster] gi|62472161|ref|NP_001014582.1| eyegone, isoform B [Drosophila melanogaster] gi|23093607|gb|AAF49918.2| eyegone, isoform A [Drosophila melanogaster] gi|61678464|gb|AAX52747.1| eyegone, isoform B [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|21260588|gb|AAM43805.1| eyegone [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|60678223|gb|AAX33618.1| AT09010p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|194869847|ref|XP_001972533.1| GG13831 [Drosophila erecta] gi|190654316|gb|EDV51559.1| GG13831 [Drosophila erecta] Back     alignment and taxonomy information
>gi|195493839|ref|XP_002094585.1| GE20121 [Drosophila yakuba] gi|194180686|gb|EDW94297.1| GE20121 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|3659897|gb|AAC78330.1| Eyegone [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195589826|ref|XP_002084650.1| GD12719 [Drosophila simulans] gi|194196659|gb|EDX10235.1| GD12719 [Drosophila simulans] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query435
FB|FBgn0000625 675 eyg "eyegone" [Drosophila mela 0.413 0.266 0.458 3.8e-45
FB|FBgn0036285640 toe "twin of eyg" [Drosophila 0.114 0.078 0.88 3.3e-37
UNIPROTKB|F1NXF7186 PAX6 "Paired box protein Pax-6 0.108 0.252 0.595 6.3e-22
UNIPROTKB|G3V3Q9377 PAX6 "Paired box protein Pax-6 0.108 0.124 0.595 9e-18
ZFIN|ZDB-GENE-001031-1437 pax6b "paired box gene 6b" [Da 0.108 0.107 0.595 1.3e-17
UNIPROTKB|F1NF66422 PAX6 "Paired box protein Pax-6 0.108 0.111 0.595 1.8e-17
UNIPROTKB|Q1LZF1422 PAX6 "Paired box protein Pax-6 0.108 0.111 0.595 1.8e-17
UNIPROTKB|P26367422 PAX6 "Paired box protein Pax-6 0.108 0.111 0.595 1.8e-17
UNIPROTKB|F2Z5M7422 PAX6 "Uncharacterized protein" 0.108 0.111 0.595 1.8e-17
MGI|MGI:97490422 Pax6 "paired box gene 6" [Mus 0.108 0.111 0.595 1.8e-17
FB|FBgn0000625 eyg "eyegone" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 328 (120.5 bits), Expect = 3.8e-45, Sum P(4) = 3.8e-45
 Identities = 95/207 (45%), Positives = 106/207 (51%)

Query:    89 IIEGVCTNATAPSVSSINRILRNXXXXXXXXXXXXXXGYGIYHTA-HPYASFHXXXXXXX 147
             I EGVCTNATAPSVSSINRILRN               YG+Y    HPY SF        
Sbjct:   201 ISEGVCTNATAPSVSSINRILRNRAAERVATEFARTAAYGLYPPPPHPYGSF-------T 253

Query:   148 XXXXXXVVSNQG--PGTTPS---SGAAGSPRGLMPRLF--VPFGHCYSFSPTSDHVHINN 200
                   V   QG  P   PS   S AA +   L P     VP   C S S  S H+    
Sbjct:   254 WHPAGNVPGGQGVPPPPPPSALWSVAAPTLANLPPSAASAVPVSTCGSLS--SAHLMAGG 311

Query:   201 EH-TP----ITPCF-----VXXXXXXXXXXXXXXXXXEQPKFRRNRTTFSPSQLDELEKE 250
                TP    I+P       +                 ++PKFRRNRTTFSP QL+ELEKE
Sbjct:   312 AGGTPTNRAISPGSGSHDTLESADENRHIDSDYLDDDDEPKFRRNRTTFSPEQLEELEKE 371

Query:   251 FDKSHYPCVSTRERLAAKTSLSEARVQ 277
             FDKSHYPCVSTRERL+++TSLSEARVQ
Sbjct:   372 FDKSHYPCVSTRERLSSRTSLSEARVQ 398
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS;NAS
GO:0005667 "transcription factor complex" evidence=ISS
GO:0007435 "salivary gland morphogenesis" evidence=TAS
GO:0001654 "eye development" evidence=IMP
GO:0001745 "compound eye morphogenesis" evidence=IMP
GO:0000977 "RNA polymerase II regulatory region sequence-specific DNA binding" evidence=IDA
GO:0000122 "negative regulation of transcription from RNA polymerase II promoter" evidence=IDA
GO:0005634 "nucleus" evidence=IDA
GO:0007477 "notum development" evidence=IMP
GO:0007469 "antennal development" evidence=IMP
GO:0048749 "compound eye development" evidence=IMP
GO:0035214 "eye-antennal disc development" evidence=IMP
FB|FBgn0036285 toe "twin of eyg" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1NXF7 PAX6 "Paired box protein Pax-6" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|G3V3Q9 PAX6 "Paired box protein Pax-6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-001031-1 pax6b "paired box gene 6b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NF66 PAX6 "Paired box protein Pax-6" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q1LZF1 PAX6 "Paired box protein Pax-6" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P26367 PAX6 "Paired box protein Pax-6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z5M7 PAX6 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:97490 Pax6 "paired box gene 6" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query435
pfam0004657 pfam00046, Homeobox, Homeobox domain 6e-17
smart0038957 smart00389, HOX, Homeodomain 1e-14
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 2e-14
cd00131128 cd00131, PAX, Paired Box domain 6e-06
smart00351125 smart00351, PAX, Paired Box domain 8e-05
pfam00292125 pfam00292, PAX, 'Paired box' domain 3e-04
COG5576156 COG5576, COG5576, Homeodomain-containing transcrip 0.001
pfam0004657 pfam00046, Homeobox, Homeobox domain 0.002
>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information 
 Score = 74.1 bits (183), Expect = 6e-17
 Identities = 26/45 (57%), Positives = 33/45 (73%)

Query: 233 RRNRTTFSPSQLDELEKEFDKSHYPCVSTRERLAAKTSLSEARVQ 277
           RR RTTF+P QL+ELEKEF+K+ YP    RE LA K  L+E +V+
Sbjct: 1   RRKRTTFTPEQLEELEKEFEKNRYPSAEEREELAKKLGLTERQVK 45

Length = 57
>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information
>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>gnl|CDD|238076 cd00131, PAX, Paired Box domain Back     alignment and domain information
>gnl|CDD|128645 smart00351, PAX, Paired Box domain Back     alignment and domain information
>gnl|CDD|109353 pfam00292, PAX, 'Paired box' domain Back     alignment and domain information
>gnl|CDD|227863 COG5576, COG5576, Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 435
KOG0849|consensus354 99.86
KOG0484|consensus125 99.75
KOG0488|consensus309 99.69
KOG0489|consensus261 99.68
KOG0494|consensus332 99.66
KOG2251|consensus228 99.66
KOG0850|consensus245 99.61
KOG3862|consensus327 99.6
KOG0842|consensus307 99.58
KOG0485|consensus268 99.57
KOG0848|consensus317 99.54
KOG0487|consensus308 99.51
KOG0843|consensus197 99.51
KOG0492|consensus246 99.5
KOG0486|consensus351 99.49
KOG3517|consensus334 99.42
PF0004657 Homeobox: Homeobox domain not present here.; Inter 99.41
PF00292125 PAX: 'Paired box' domain; InterPro: IPR001523 The 99.35
KOG0490|consensus235 99.33
KOG0493|consensus342 99.31
KOG0844|consensus408 99.31
KOG0491|consensus194 99.28
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 99.27
KOG0483|consensus198 99.25
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 99.2
cd0008659 homeodomain Homeodomain; DNA binding domains invol 99.18
KOG4577|consensus383 99.17
COG5576156 Homeodomain-containing transcription factor [Trans 99.14
KOG0847|consensus288 99.11
KOG3802|consensus398 98.85
KOG1168|consensus385 98.04
KOG0490|consensus235 97.87
KOG0775|consensus304 97.68
KOG0774|consensus334 97.59
cd00131128 PAX Paired Box domain 96.99
smart00351125 PAX Paired Box domain. 96.87
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 96.82
KOG2252|consensus558 96.72
KOG1146|consensus 1406 96.42
KOG0773|consensus342 87.3
KOG3623|consensus 1007 85.97
>KOG0849|consensus Back     alignment and domain information 
Probab=99.86  E-value=3.8e-22  Score=202.39  Aligned_cols=140  Identities=40%  Similarity=0.470  Sum_probs=97.4

Q ss_pred             chhhccchhhhhcCCceeeeee-----ccccCCCCCCCcchhhhHHHHhhHHHHHHHHHHHhhccCCCCCCCCCCCCCCC
Q psy12776         68 FLKCNRTLPVLETVPHIFPMKI-----IEGVCTNATAPSVSSINRILRNRAAERAAAEFARAAGYGIYHTAHPYASFHWP  142 (435)
Q Consensus        68 ~~~~~~i~~~k~e~P~iFawEi-----~e~vC~~~~~PSVssinrilr~~~~~~~~~~~a~~~~~~~y~~~~p~~s~~W~  142 (435)
                      -.|+.+|.+||++||+||||||     .+++|+++++|||++|+|++|+....+++.  . ...+..+.+.         
T Consensus        77 ~~~~~~i~~~k~~~P~~~~~~ir~~l~~~~~~~~~t~Ps~ssi~r~~r~~~~~~d~~--~-~~~~~~~~~~---------  144 (354)
T KOG0849|consen   77 PEVEAKIEQYKRENPAMFAWEIRDQLLHEGLCTQATLPSVSSINRVLRNGALGKDQG--L-PSQQVTKEKS---------  144 (354)
T ss_pred             chhHHHHHHHHhcCCcccchhhhhcccCcccccCCCCCChhhhhHHhhccccccccc--c-cccccccccc---------
Confidence            4678999999999999999995     899999999999999999999887655431  0 0000000000         


Q ss_pred             CCCCCCCCCCCCcCCCCCCCCCCCCCCCCCCCCCCCcccCCCCCCCCCCCCCCccCCCCCCCCCCCcCCCCCCCCCCCCC
Q psy12776        143 NPGIWNPNNPPVVSNQGPGTTPSSGAAGSPRGLMPRLFVPFGHCYSFSPTSDHVHINNEHTPITPCFVSDGDAKDDDSVG  222 (435)
Q Consensus       143 ~~~~wyp~sPp~~s~~ppg~tpSS~aagSpsg~lP~s~~P~~sSsS~SPtss~~Sin~s~~~stp~~sSdg~s~ddss~~  222 (435)
                                          .+.++..+++                       .            ..+.. ..+++  .
T Consensus       145 --------------------~~~~~~~gs~-----------------------~------------~~s~~-~~~~~--~  166 (354)
T KOG0849|consen  145 --------------------PSISGALGSQ-----------------------A------------GASLL-SADDE--E  166 (354)
T ss_pred             --------------------CCcccccCCc-----------------------c------------ccccc-cCCcc--c
Confidence                                0000110000                       0            00000 00111  1


Q ss_pred             CCCCCCCCCCCCCCccCCHHHHHHHHHHhhhcCCCChHHHHHHHHhcCCCcccee
Q psy12776        223 SGSGSEQPKFRRNRTTFSPSQLDELEKEFDKSHYPCVSTRERLAAKTSLSEARVQ  277 (435)
Q Consensus       223 sss~s~~rKkRR~RT~FT~eQL~~LE~~Fern~YPs~~eReeLA~kLGLtErQVQ  277 (435)
                      ......+++.+|.||+|+..|++.||+.|++++||++..|++||.++++++.+|+
T Consensus       167 ~p~~~~~~~~rr~rtsft~~Q~~~le~~f~rt~yP~i~~Re~La~~i~l~e~riq  221 (354)
T KOG0849|consen  167 PPGYALQRGGRRNRTSFSPSQLEALEECFQRTPYPDIVGRETLAKETGLPEPRVQ  221 (354)
T ss_pred             cccccccccccccccccccchHHHHHHHhcCCCCCchhhHHHHhhhccCCchHHH
Confidence            1123456677888999999999999999999999999999999999999999999

>KOG0484|consensus Back     alignment and domain information
>KOG0488|consensus Back     alignment and domain information
>KOG0489|consensus Back     alignment and domain information
>KOG0494|consensus Back     alignment and domain information
>KOG2251|consensus Back     alignment and domain information
>KOG0850|consensus Back     alignment and domain information
>KOG3862|consensus Back     alignment and domain information
>KOG0842|consensus Back     alignment and domain information
>KOG0485|consensus Back     alignment and domain information
>KOG0848|consensus Back     alignment and domain information
>KOG0487|consensus Back     alignment and domain information
>KOG0843|consensus Back     alignment and domain information
>KOG0492|consensus Back     alignment and domain information
>KOG0486|consensus Back     alignment and domain information
>KOG3517|consensus Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>PF00292 PAX: 'Paired box' domain; InterPro: IPR001523 The paired box is a conserved 124 amino acid N-terminal domain of unknown function that usually, but not always, precedes a homeobox domain (see IPR001356 from INTERPRO) [, ] Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG0493|consensus Back     alignment and domain information
>KOG0844|consensus Back     alignment and domain information
>KOG0491|consensus Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>KOG0483|consensus Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>KOG4577|consensus Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>KOG0847|consensus Back     alignment and domain information
>KOG3802|consensus Back     alignment and domain information
>KOG1168|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG0775|consensus Back     alignment and domain information
>KOG0774|consensus Back     alignment and domain information
>cd00131 PAX Paired Box domain Back     alignment and domain information
>smart00351 PAX Paired Box domain Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>KOG2252|consensus Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>KOG0773|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query435
1fjl_A81 Homeodomain From The Drosophila Paired Protein Boun 9e-11
2m0c_A75 Solution Nmr Structure Of Homeobox Domain Of Human 1e-10
2cue_A80 Solution Structure Of The Homeobox Domain Of The Hu 1e-09
3cmy_A61 Structure Of A Homeodomain In Complex With Dna Leng 2e-09
3a01_B67 Crystal Structure Of Aristaless And Clawless Homeod 3e-09
3lnq_A58 Structure Of Aristaless Homeodomain In Complex With 3e-08
2l7m_P68 Solution Structure Of The Pitx2 Homeodomain R24h Mu 6e-07
3a02_A60 Crystal Structure Of Aristaless Homeodomain Length 6e-07
2l7f_P68 Solution Structure Of The Pitx2 Homeodomain Length 2e-06
2dms_A80 Solution Structure Of The Homeobox Domain Of Homeob 3e-06
2dmu_A70 Solution Structure Of The Homeobox Domain Of Homeob 3e-05
2m34_A71 Nmr Structure Of The Homeodomain Transcription Fact 8e-04
>pdb|1FJL|A Chain A, Homeodomain From The Drosophila Paired Protein Bound To A Dna Oligonucleotide Length = 81 Back     alignment and structure 
Iteration: 1

 Score = 64.7 bits (156), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 29/47 (61%), Positives = 39/47 (82%)
Query: 231 KFRRNRTTFSPSQLDELEKEFDKSHYPCVSTRERLAAKTSLSEARVQ 277
           K RR+RTTFS SQLDELE+ F+++ YP + TRE LA +T+L+EAR+Q
Sbjct: 17  KQRRSRTTFSASQLDELERAFERTQYPDIYTREELAQRTNLTEARIQ 63
>pdb|2M0C|A Chain A, Solution Nmr Structure Of Homeobox Domain Of Human Alx4, Northeast Structural Genomics Consortium (Nesg) Target Hr4490c Length = 75 Back     alignment and structure
>pdb|2CUE|A Chain A, Solution Structure Of The Homeobox Domain Of The Human Paired Box Protein Pax-6 Length = 80 Back     alignment and structure
>pdb|3CMY|A Chain A, Structure Of A Homeodomain In Complex With Dna Length = 61 Back     alignment and structure
>pdb|3A01|B Chain B, Crystal Structure Of Aristaless And Clawless Homeodomains Bo Length = 67 Back     alignment and structure
>pdb|3LNQ|A Chain A, Structure Of Aristaless Homeodomain In Complex With Dna Length = 58 Back     alignment and structure
>pdb|2L7M|P Chain P, Solution Structure Of The Pitx2 Homeodomain R24h Mutant Length = 68 Back     alignment and structure
>pdb|3A02|A Chain A, Crystal Structure Of Aristaless Homeodomain Length = 60 Back     alignment and structure
>pdb|2L7F|P Chain P, Solution Structure Of The Pitx2 Homeodomain Length = 68 Back     alignment and structure
>pdb|2DMS|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Otx2 Length = 80 Back     alignment and structure
>pdb|2DMU|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Goosecoid Length = 70 Back     alignment and structure
>pdb|2M34|A Chain A, Nmr Structure Of The Homeodomain Transcription Factor Gbx1 From Homo Sapiens Length = 71 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query435
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 4e-26
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 7e-06
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 8e-26
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 4e-07
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 6e-25
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 6e-06
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 5e-24
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 2e-06
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 1e-23
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 5e-06
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 1e-23
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 2e-06
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 1e-22
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 4e-06
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 4e-22
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 4e-05
3a02_A60 Homeobox protein aristaless; homeodomain, developm 2e-21
3a02_A60 Homeobox protein aristaless; homeodomain, developm 5e-07
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 5e-21
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 2e-04
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 6e-21
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 4e-06
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 2e-18
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 2e-04
1uhs_A72 HOP, homeodomain only protein; structural genomics 8e-18
1uhs_A72 HOP, homeodomain only protein; structural genomics 3e-06
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 3e-17
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 5e-06
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 9e-17
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 5e-04
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 2e-15
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 3e-04
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 4e-14
3d1n_I151 POU domain, class 6, transcription factor 1; prote 2e-13
1lfb_A99 Liver transcription factor (LFB1); transcription r 3e-13
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 5e-13
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 2e-12
2xsd_C164 POU domain, class 3, transcription factor 1; trans 3e-12
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 3e-12
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 7e-12
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 3e-11
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 3e-11
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 4e-11
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 4e-11
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 6e-11
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 9e-11
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 2e-10
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 3e-10
1e3o_C160 Octamer-binding transcription factor 1; transcript 3e-10
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 4e-10
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 5e-10
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 5e-10
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 8e-10
3a01_A93 Homeodomain-containing protein; homeodomain, prote 8e-10
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 9e-10
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 9e-10
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 1e-09
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 9e-09
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 1e-08
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 5e-08
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 5e-08
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 4e-07
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 4e-07
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 6e-07
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 1e-06
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 1e-06
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 1e-06
1k78_A149 Paired box protein PAX5; paired domain, ETS domain 2e-06
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 4e-06
2k27_A159 Paired box protein PAX-8; paired domain, solution 4e-06
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 4e-06
1pdn_C128 Protein (PRD paired); protein-DNA complex, double 9e-06
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 2e-05
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 4e-05
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 6e-05
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81 Back     alignment and structure
 Score = 99.8 bits (249), Expect = 4e-26
 Identities = 32/64 (50%), Positives = 45/64 (70%), Gaps = 2/64 (3%)

Query: 214 DAKDDDSVGSGSGSEQPKFRRNRTTFSPSQLDELEKEFDKSHYPCVSTRERLAAKTSLSE 273
           D  D +S      + + K RR+RTTFS SQLDELE+ F+++ YP + TRE LA +T+L+E
Sbjct: 2   DISDCES--EPGIALKRKQRRSRTTFSASQLDELERAFERTQYPDIYTREELAQRTNLTE 59

Query: 274 ARVQ 277
           AR+Q
Sbjct: 60  ARIQ 63
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81 Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 80 Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 80 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Length = 60 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Length = 60 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Length = 99 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Length = 194 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Length = 221 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Length = 77 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Length = 58 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Length = 93 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Length = 58 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Length = 62 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Length = 61 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Length = 56 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Length = 73 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Length = 63 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Length = 97 Back     alignment and structure
>1k78_A Paired box protein PAX5; paired domain, ETS domain, transcription factor, transcription/DNA complex; 2.25A {Homo sapiens} SCOP: a.4.1.5 a.4.1.5 PDB: 1mdm_A 6pax_A Length = 149 Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Length = 88 Back     alignment and structure
>2k27_A Paired box protein PAX-8; paired domain, solution structure, triple frequency, 3D NMR, induced FIT, alternative splicing, developmental protein; NMR {Homo sapiens} Length = 159 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Length = 68 Back     alignment and structure
>1pdn_C Protein (PRD paired); protein-DNA complex, double helix, PAX, paired domain, DNA-binding protein, gene regulation/DNA complex; HET: DNA; 2.50A {Drosophila melanogaster} SCOP: a.4.1.5 Length = 128 Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Length = 81 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Length = 77 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 76 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query435
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.75
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.72
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.72
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.72
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.71
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.71
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.7
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.69
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 99.69
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.69
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.69
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.69
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.69
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.69
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.68
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.68
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.68
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.68
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.68
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 99.67
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.67
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.67
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.67
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.67
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.66
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.66
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.66
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.66
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.66
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.65
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 99.65
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 99.65
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.64
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.64
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.64
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.63
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.63
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 99.62
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 99.62
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 99.62
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 99.62
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.62
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 99.61
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.61
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 99.61
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 99.61
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 99.6
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 99.6
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 99.59
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.59
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 99.59
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 99.58
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 99.55
1e3o_C160 Octamer-binding transcription factor 1; transcript 99.55
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 99.55
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 99.55
2xsd_C164 POU domain, class 3, transcription factor 1; trans 99.54
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 99.54
3d1n_I151 POU domain, class 6, transcription factor 1; prote 99.53
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 99.53
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 99.53
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 99.51
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 99.51
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 99.5
1lfb_A99 Liver transcription factor (LFB1); transcription r 99.5
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 99.49
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 99.49
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 99.48
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 99.48
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 99.44
2e19_A64 Transcription factor 8; homeobox domain, structura 99.41
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 99.39
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 99.26
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 99.13
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 99.08
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 99.04
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 98.95
2nzz_A37 Penetratin conjugated GAS (374-394) peptide; confo 98.06
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
Probab=99.75  E-value=2.6e-19  Score=144.69  Aligned_cols=51  Identities=27%  Similarity=0.378  Sum_probs=47.8

Q ss_pred             CCCCCCCCCCccCCHHHHHHHHHHhhhcCCCChHHHHHHHHhcCCCcccee
Q psy12776        227 SEQPKFRRNRTTFSPSQLDELEKEFDKSHYPCVSTRERLAAKTSLSEARVQ  277 (435)
Q Consensus       227 s~~rKkRR~RT~FT~eQL~~LE~~Fern~YPs~~eReeLA~kLGLtErQVQ  277 (435)
                      ....+.||.||.|+..|+.+||..|+.++||+..+|++||.+|||+++||+
T Consensus        17 ~~~~~~rr~Rt~ft~~Q~~~Le~~F~~~~yp~~~~r~~La~~l~l~~~qV~   67 (84)
T 2kt0_A           17 KVPVKKQKTRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVK   67 (84)
T ss_dssp             CCCSCSCCCSSCCCHHHHHHHHHHHHHSSSCCHHHHHHHHHHTTCCHHHHH
T ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHHHhCCCCCHHHHHHHHHHcCCCHHHHH
Confidence            345567889999999999999999999999999999999999999999999
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 435
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 2e-16
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 1e-04
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 3e-14
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 3e-04
d2cufa182 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM 1e-13
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 5e-13
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 0.004
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 6e-13
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 5e-05
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 9e-13
d1lfba_78 a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN 2e-12
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 2e-12
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 0.001
d1au7a158 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra 2e-12
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 3e-12
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 3e-12
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 0.003
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 5e-12
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 2e-04
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 1e-11
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 5e-04
d1uhsa_72 a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse 3e-11
d1uhsa_72 a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse 5e-04
d1le8a_53 a.4.1.1 (A:) Mating type protein A1 Homeodomain {B 4e-11
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 4e-11
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 5e-04
d1s7ea150 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M 5e-11
d1jgga_57 a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( 6e-11
d1ocpa_67 a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus 6e-11
d1ig7a_58 a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu 6e-11
d1zq3p167 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl 2e-10
d1zq3p167 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl 0.003
d1vnda_77 a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi 3e-10
d1vnda_77 a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi 0.003
d6paxa265 a.4.1.5 (A:69-133) Pax-6 {Human (Homo sapiens) [Ta 5e-10
d1pufb_73 a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 9e-10
d1wi3a_71 a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom 9e-10
d1e3oc157 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( 2e-09
d1wh7a_80 a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha 3e-09
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 3e-09
d2cqxa159 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 9e-09
d1k78a261 a.4.1.5 (A:82-142) Pax-5 {Human (Homo sapiens) [Ta 1e-08
d1k61a_60 a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast 2e-08
d1x2ma152 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 7e-08
d2ecba176 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote 2e-05
d2ecca176 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein H 4e-04
d1pdnc_123 a.4.1.5 (C:) Paired protein (prd) {Fruit fly (Dros 4e-04
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Paired box protein pax6
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 71.4 bits (175), Expect = 2e-16
 Identities = 27/45 (60%), Positives = 36/45 (80%)

Query: 233 RRNRTTFSPSQLDELEKEFDKSHYPCVSTRERLAAKTSLSEARVQ 277
           +RNRT+F+  Q++ LEKEF+++HYP V  RERLAAK  L EAR+Q
Sbjct: 2   QRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQ 46
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 Back     information, alignment and structure
>d6paxa2 a.4.1.5 (A:69-133) Pax-6 {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d1k78a2 a.4.1.5 (A:82-142) Pax-5 {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1pdnc_ a.4.1.5 (C:) Paired protein (prd) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 123 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query435
d6paxa265 Pax-6 {Human (Homo sapiens) [TaxId: 9606]} 99.77
d1k78a261 Pax-5 {Human (Homo sapiens) [TaxId: 9606]} 99.74
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.72
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.71
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.7
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.7
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.69
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.69
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.68
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.68
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.68
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.68
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.68
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.67
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.66
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.66
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.65
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 99.61
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.58
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.58
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.57
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.57
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.54
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.53
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 99.52
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.46
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 99.44
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 99.42
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 99.41
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 99.34
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 99.32
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 99.28
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 99.2
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 99.14
d1pdnc_123 Paired protein (prd) {Fruit fly (Drosophila melano 98.29
>d6paxa2 a.4.1.5 (A:69-133) Pax-6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Paired domain
domain: Pax-6
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.77  E-value=2.3e-20  Score=144.53  Aligned_cols=48  Identities=48%  Similarity=0.699  Sum_probs=45.5

Q ss_pred             hhhccchhhhhcCCceeeeee-----ccccCCCCCCCcchhhhHHHHhhHHHH
Q psy12776         69 LKCNRTLPVLETVPHIFPMKI-----IEGVCTNATAPSVSSINRILRNRAAER  116 (435)
Q Consensus        69 ~~~~~i~~~k~e~P~iFawEi-----~e~vC~~~~~PSVssinrilr~~~~~~  116 (435)
                      .|+++|++||+|||+||||||     +||||+++|+|||||||||||+++.++
T Consensus        11 ~V~~kI~~yK~enP~iFaWEIRd~Li~egiC~~~~vPSvSsInRilR~~~~~~   63 (65)
T d6paxa2          11 EVVSKIAQYKQECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLRNLASEK   63 (65)
T ss_dssp             HHHHHHHHHHHHCTTCCHHHHHHHHHHTTSSCTTTCCCHHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHhCCccchHHHHHHHHHcCCCCCCCCCchHHHHHHHHHhhhhh
Confidence            689999999999999999994     899999999999999999999998865
>d1k78a2 a.4.1.5 (A:82-142) Pax-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pdnc_ a.4.1.5 (C:) Paired protein (prd) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure