Psyllid ID: psy12834


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-----
MEDHLVSHTGARPYECKTCKKTFVSKYTYKAHLVTHTDRKRPFSCEKCDKSFYTQQNLVQHEKTHSGSKDFVCTECGKAFGTLRNLEVHLAVHTGNRPFICRVCGKSFVRKAEVKDHERTHTGEKPYQCEFCGAQFRFKGSSGTESIDKLLLCFLSQRSNLQSHKRATHFNDKRYPCTSCPKAFKRRRLLDYHIKAAHTGERPYQCDICNATFIYPEHFKKHRRIHTGEKPYVCEVRLAVFYYVTCLFNMIQPKRFRLGRPHLLSQATPVFSMVI
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cccEEEEcccccccccccccccEccccHHHHHHHHcccccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEEEccccEccccccccEcccccccHHHHHHHHHccccccccccHcccccccccHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEcccccccEcccHHHHHHHHHHHHcccccccccHccccEEEcc
medhlvshtgarpyecktckktfvsKYTYKAHLvthtdrkrpfscekcdksfYTQQNlvqhekthsgskdfvCTECGKAFGTLRNLEVHLAVhtgnrpficrvcgksfvrkaevkdherthtgekpyqcefcgaqfrfkgssgteSIDKLLLCFLSQRSNlqshkrathfndkrypctscpkafkRRRLLDYHIKaahtgerpyqcdicnatfiypehfkkhrrihtgekpyVCEVRLAVFYYVTCLfnmiqpkrfrlgrphllsqatpVFSMVI
medhlvshtgarpyecktckktfvSKYTYKAHlvthtdrkrpfSCEKCDKSFYTQQNLVqhekthsgskdFVCTECGKAFGTLRNLEVHLAVHTGNRPFICRVCGKSFVRKAEVkdherthtgekpyqcefCGAQFRFKGSSGTESIDKLLLCFLSQRSNLQSHkrathfndkrypctscpkafkrRRLLDYHIKaahtgerpyqcdICNATFIYPEHFKKHRRIHTGEKPYVCEVRLAVFYYVTCLFNMIQPKRFRLgrphllsqatpvfsmvi
MEDHLVSHTGARPYECKTCKKTFVSKYTYKAHLVTHTDRKRPFSCEKCDKSFYTQQNLVQHEKTHSGSKDFVCTECGKAFGTLRNLEVHLAVHTGNRPFICRVCGKSFVRKAEVKDHERTHTGEKPYQCEFCGAQFRFKGSSGTESIDKLLLCFLSQRSNLQSHKRATHFNDKRYPCTSCPKAFKRRRLLDYHIKAAHTGERPYQCDICNATFIYPEHFKKHRRIHTGEKPYVCEVRLAVFYYVTCLFNMIQPKRFRLGRPHLLSQATPVFSMVI
**********ARPYECKTCKKTFVSKYTYKAHLVTHTDRKRPFSCEKCDKSFYTQQNLVQHEKTHSGSKDFVCTECGKAFGTLRNLEVHLAVHTGNRPFICRVCGKSFVRKAEVKDHERTHTGEKPYQCEFCGAQFRFKGSSGTESIDKLLLCFLSQRSNL***KRATHFNDKRYPCTSCPKAFKRRRLLDYHIKAAHTGERPYQCDICNATFIYPEHFKKHRRIHTGEKPYVCEVRLAVFYYVTCLFNMIQPKRFRLGRPHLLS**********
MEDHLVSHTGARPYECKTCKKTFVSKYTYKAHLVTHTDRKRPFSCEKCDKSFYTQQNLVQHEKTHSGSKDFVCTECGKAFGTLRNLEVHLAVHTGNRPFICRVCGKSFVRKAEVKDHERTHTGEKPYQCEFCGAQFRFKGSSGTESIDKLLLCFLSQRSNLQSHKRATHFNDKRYPCTSCPKAFKRRRLLDYHIKAAHTGERPYQCDICNATFIYPEHFKKHRRIHTGEKPYVCEVRLAVFYYVTCLFNMIQPKRFRLGRPHLLSQATPVFSMVI
*********GARPYECKTCKKTFVSKYTYKAHLVTHTDRKRPFSCEKCDKSFYTQQNLV********SKDFVCTECGKAFGTLRNLEVHLAVHTGNRPFICRVCGKSFVRKAEVKDHERTHTGEKPYQCEFCGAQFRFKGSSGTESIDKLLLCFLSQRSNLQSHKRATHFNDKRYPCTSCPKAFKRRRLLDYHIKAAHTGERPYQCDICNATFIYPEHFKKHRRIHTGEKPYVCEVRLAVFYYVTCLFNMIQPKRFRLGRPHLLSQATPVFSMVI
MEDHLVSHTGARPYECKTCKKTFVSKYTYKAHLVTHTDRKRPFSCEKCDKSFYTQQNLVQHEKTHSGSKDFVCTECGKAFGTLRNLEVHLAVHTGNRPFICRVCGKSFVRKAEVKDHERTHTGEKPYQCEFCGAQFRFKGSSGTESIDKLLLCFLSQRSNLQSHKRATHFNDKRYPCTSCPKAFKRRRLLDYHIKAAHTGERPYQCDICNATFIYPEHFKKHRRIHTGEKPYVCEVRLAVFYYVTCLFNMIQPKRFRLGRPHLLSQATPVFS*V*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEDHLVSHTGARPYECKTCKKTFVSKYTYKAHLVTHTDRKRPFSCEKCDKSFYTQQNLVQHEKTHSGSKDFVCTECGKAFGTLRNLEVHLAVHTGNRPFICRVCGKSFVRKAEVKDHERTHTGEKPYQCEFCGAQFRFKGSSGTESIDKLLLCFLSQRSNLQSHKRATHFNDKRYPCTSCPKAFKRRRLLDYHIKAAHTGERPYQCDICNATFIYPEHFKKHRRIHTGEKPYVCEVRLAVFYYVTCLFNMIQPKRFRLGRPHLLSQATPVFSMVI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query275 2.2.26 [Sep-21-2011]
P51786506 Zinc finger protein 157 O yes N/A 0.894 0.486 0.408 3e-48
A6NNF4738 Zinc finger protein 726 O no N/A 0.909 0.338 0.386 5e-48
Q5RCD9645 Zinc finger and SCAN doma yes N/A 0.821 0.350 0.421 1e-47
Q7Z7L9614 Zinc finger and SCAN doma no N/A 0.821 0.368 0.421 2e-47
Q6ZMW2699 Zinc finger protein 782 O no N/A 0.763 0.300 0.418 4e-47
Q07230614 Zinc finger and SCAN doma no N/A 0.829 0.371 0.408 1e-46
P51523738 Zinc finger protein 84 OS no N/A 0.818 0.304 0.400 1e-46
Q02525718 Zinc finger protein 39 OS no N/A 0.789 0.302 0.422 1e-46
Q3ZCX4 644 Zinc finger protein 568 O no N/A 0.872 0.372 0.398 2e-46
A2VDQ7687 Zinc finger protein 420 O no N/A 0.836 0.334 0.422 3e-46
>sp|P51786|ZN157_HUMAN Zinc finger protein 157 OS=Homo sapiens GN=ZNF157 PE=2 SV=2 Back     alignment and function desciption
 Score =  192 bits (487), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 111/272 (40%), Positives = 145/272 (53%), Gaps = 26/272 (9%)

Query: 3   DHLVSHTGARPYECKTCKKTFVSKYTYKAHLVTHTDRKRPFSCEKCDKSFYTQQNLVQHE 62
           +HL  HTG RPYEC  C KTF ++    AH  THT  +RPF C +C KSF  +  L+ H 
Sbjct: 179 EHLRIHTGERPYECGECAKTFSARSYLIAHQKTHTG-ERPFECNECGKSFGRKSQLILHT 237

Query: 63  KTHSGSKDFVCTECGKAFGTLRNLEVHLAVHTGNRPFICRVCGKSFVRKAEVKDHERTHT 122
           +TH+G + + CTECGK F     L +H   HTG +P+ C  CGK+F  K  +  H RTHT
Sbjct: 238 RTHTGERPYECTECGKTFSEKATLTIHQRTHTGEKPYECSECGKTFRVKISLTQHHRTHT 297

Query: 123 GEKPYQCEFCGAQFRFKGSSGTESIDKLLLCFLSQRSNLQSHKRATHFNDKRYPCTSCPK 182
           GEKPY+C  CG  FR K S                   L  H+R  H  +K Y C  C K
Sbjct: 298 GEKPYECGECGKNFRAKKS-------------------LNQHQR-IHTGEKPYECGECGK 337

Query: 183 AFKRRRLLDYHIKAAHTGERPYQCDICNATFIYPEHFKKHRRIHTGEKPYVCEVRLAVFY 242
            F+ +  L+ H +  HTGE+PYQC+ C  +F        H+RIHTGEKPY C      FY
Sbjct: 338 FFRMKMTLNNHQR-THTGEKPYQCNECGKSFRVHSSLGIHQRIHTGEKPYECNECGNAFY 396

Query: 243 YVTCLFNMIQPKRFRLG-RPHLLSQATPVFSM 273
                  +I+ +R   G +P+  S+   +FSM
Sbjct: 397 VKA---RLIEHQRMHSGEKPYECSECGKIFSM 425




May be involved in transcriptional regulation.
Homo sapiens (taxid: 9606)
>sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=3 Back     alignment and function description
>sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 Back     alignment and function description
>sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 Back     alignment and function description
>sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 Back     alignment and function description
>sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 Back     alignment and function description
>sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 Back     alignment and function description
>sp|Q02525|ZFP39_MOUSE Zinc finger protein 39 OS=Mus musculus GN=Zfp39 PE=2 SV=2 Back     alignment and function description
>sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 Back     alignment and function description
>sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query275
340709551 741 PREDICTED: zinc finger protein 845-like 0.789 0.292 0.677 8e-93
328712100 852 PREDICTED: zinc finger protein 12-like i 0.789 0.254 0.665 1e-91
332019403 724 Zinc finger protein 235 [Acromyrmex echi 0.789 0.299 0.669 5e-91
156553982 774 PREDICTED: zinc finger protein 235-like 0.789 0.280 0.665 1e-89
307190293365 Zinc finger protein 569 [Camponotus flor 0.789 0.594 0.673 2e-89
242013882 833 gonadotropin inducible transcription fac 0.789 0.260 0.656 2e-88
189242420 767 PREDICTED: similar to zinc finger protei 0.789 0.282 0.635 2e-87
357602481 977 putative zinc finger protein 484 [Danaus 0.789 0.222 0.614 1e-84
157138482 538 zinc finger protein [Aedes aegypti] gi|1 0.789 0.403 0.588 1e-80
170030182 538 zinc finger protein 780B [Culex quinquef 0.789 0.403 0.576 4e-78
>gi|340709551|ref|XP_003393369.1| PREDICTED: zinc finger protein 845-like [Bombus terrestris] Back     alignment and taxonomy information
 Score =  346 bits (887), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 160/236 (67%), Positives = 186/236 (78%), Gaps = 19/236 (8%)

Query: 1   MEDHLVSHTGARPYECKTCKKTFVSKYTYKAHLVTHTDRKRPFSCEKCDKSFYTQQNLVQ 60
           +E+H+ +HTG RPY C+ C K F SKYTYKAH+ TH  R RP+ C +C+K+F +QQNL Q
Sbjct: 310 LEEHINTHTGVRPYVCENCGKDFASKYTYKAHVKTHEIRPRPYQCSQCNKTFLSQQNLNQ 369

Query: 61  HEKTHSGSKDFVCTECGKAFGTLRNLEVHLAVHTGNRPFICRVCGKSFVRKAEVKDHERT 120
           HE+TH+G K++VC +CGKAFG+  NLEVH  VHTG +P+ICRVCGK+F RKAE++DHERT
Sbjct: 370 HERTHNGVKEYVCHQCGKAFGSPHNLEVHNIVHTGYKPYICRVCGKAFARKAEIRDHERT 429

Query: 121 HTGEKPYQCEFCGAQFRFKGSSGTESIDKLLLCFLSQRSNLQSHKRATHFNDKRYPCTSC 180
           HTGEKPYQCEFCGA F                   SQRSNLQSHKRATH+NDKRY C  C
Sbjct: 430 HTGEKPYQCEFCGATF-------------------SQRSNLQSHKRATHYNDKRYKCDDC 470

Query: 181 PKAFKRRRLLDYHIKAAHTGERPYQCDICNATFIYPEHFKKHRRIHTGEKPYVCEV 236
            K FKRRRLLDYHIKAAHTGERPY+CDIC ATF+YPEHFKKH RIHTGEKPY+CEV
Sbjct: 471 GKGFKRRRLLDYHIKAAHTGERPYKCDICTATFVYPEHFKKHMRIHTGEKPYLCEV 526




Source: Bombus terrestris

Species: Bombus terrestris

Genus: Bombus

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|328712100|ref|XP_001946127.2| PREDICTED: zinc finger protein 12-like isoform 1 [Acyrthosiphon pisum] gi|328712102|ref|XP_003244731.1| PREDICTED: zinc finger protein 12-like isoform 2 [Acyrthosiphon pisum] gi|328712104|ref|XP_003244732.1| PREDICTED: zinc finger protein 12-like isoform 3 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|332019403|gb|EGI59889.1| Zinc finger protein 235 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|156553982|ref|XP_001603104.1| PREDICTED: zinc finger protein 235-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|307190293|gb|EFN74385.1| Zinc finger protein 569 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|242013882|ref|XP_002427629.1| gonadotropin inducible transcription factor, putative [Pediculus humanus corporis] gi|212512050|gb|EEB14891.1| gonadotropin inducible transcription factor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|189242420|ref|XP_001811279.1| PREDICTED: similar to zinc finger protein [Tribolium castaneum] gi|270016260|gb|EFA12706.1| hypothetical protein TcasGA2_TC002340 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|357602481|gb|EHJ63415.1| putative zinc finger protein 484 [Danaus plexippus] Back     alignment and taxonomy information
>gi|157138482|ref|XP_001657318.1| zinc finger protein [Aedes aegypti] gi|108880637|gb|EAT44862.1| AAEL003815-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|170030182|ref|XP_001842969.1| zinc finger protein 780B [Culex quinquefasciatus] gi|167865975|gb|EDS29358.1| zinc finger protein 780B [Culex quinquefasciatus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query275
UNIPROTKB|F1RX41568 ZNF782 "Uncharacterized protei 0.84 0.406 0.442 1.1e-53
ZFIN|ZDB-GENE-110914-160 1003 si:dkey-240n22.7 "si:dkey-240n 0.843 0.231 0.418 3.1e-53
UNIPROTKB|J9NXK0744 ZNF84 "Uncharacterized protein 0.952 0.352 0.399 4.9e-53
UNIPROTKB|F1RI76738 F1RI76 "Uncharacterized protei 0.952 0.355 0.395 8e-53
ZFIN|ZDB-GENE-120214-29518 si:ch73-367f21.5 "si:ch73-367f 0.832 0.442 0.4 1.7e-52
UNIPROTKB|F1LNE0454 Zfp9 "Protein Zfp9" [Rattus no 0.832 0.504 0.431 1.7e-52
RGD|2293498455 Zfp9 "zinc finger protein 9" [ 0.832 0.503 0.431 1.7e-52
UNIPROTKB|J9NUM4720 ZNF782 "Uncharacterized protei 0.84 0.320 0.423 2.1e-52
UNIPROTKB|F1MV59460 LOC786724 "Uncharacterized pro 0.96 0.573 0.403 2.7e-52
UNIPROTKB|G3V1K9567 ZNF782 "Zinc finger protein 78 0.84 0.407 0.423 5.6e-52
UNIPROTKB|F1RX41 ZNF782 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
 Score = 555 (200.4 bits), Expect = 1.1e-53, P = 1.1e-53
 Identities = 107/242 (44%), Positives = 143/242 (59%)

Query:     1 MEDHLVSHTGARPYECKTCKKTFVSKYTYKAHLVTHTDRKRPFSCEKCDKSFYTQQNLVQ 60
             +  H  +HTG +PY+C  C+KTF +K   + H   HT  K PF C +C KSF  +  L+ 
Sbjct:   279 LRKHQRTHTGEKPYKCDGCEKTFSAKSGLRIHQRIHTGEK-PFGCNECGKSFNYKSILIV 337

Query:    61 HEKTHSGSKDFVCTECGKAFGTLRNLEVHLAVHTGNRPFICRVCGKSFVRKAEVKDHERT 120
             H++TH+G K F C+ECGK+F  L  L  H   HTG RP+ C  CGK+F  K+ +K H RT
Sbjct:   338 HQRTHTGEKPFECSECGKSFSHLSGLRNHQRTHTGERPYKCDECGKAFKLKSGLKKHHRT 397

Query:   121 HTGEKPYQCEFCGAQF----RFKGS----SGTESIDKLLLCFLSQRSNLQSHKRATHFND 172
             HTGEKPY+C  CG  F    + +G     +G   I+  L     Q+SNL+ H R TH  +
Sbjct:   398 HTGEKPYKCNQCGKAFGQKSQLRGHHRIHTGKNPINVSLWRSFRQKSNLRVHHR-THTGE 456

Query:   173 KRYPCTSCPKAFKRRRLLDYHIKAAHTGERPYQCDICNATFIYPEHFKKHRRIHTGEKPY 232
             K Y C  C K F+++  L  H +  HTGE+PY+C+ C   FI     +KH+RIHTGEKPY
Sbjct:   457 KPYKCDECGKTFRQKSNLRGH-QRTHTGEKPYECNECGKAFIERSVLRKHQRIHTGEKPY 515

Query:   233 VC 234
              C
Sbjct:   516 NC 517


GO:0008270 "zinc ion binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
ZFIN|ZDB-GENE-110914-160 si:dkey-240n22.7 "si:dkey-240n22.7" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|J9NXK0 ZNF84 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1RI76 F1RI76 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-120214-29 si:ch73-367f21.5 "si:ch73-367f21.5" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1LNE0 Zfp9 "Protein Zfp9" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|2293498 Zfp9 "zinc finger protein 9" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|J9NUM4 ZNF782 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1MV59 LOC786724 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|G3V1K9 ZNF782 "Zinc finger protein 782" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query275
pfam1346526 pfam13465, zf-H2C2_2, Zinc-finger double domain 0.004
>gnl|CDD|222150 pfam13465, zf-H2C2_2, Zinc-finger double domain Back     alignment and domain information
 Score = 33.5 bits (77), Expect = 0.004
 Identities = 14/26 (53%), Positives = 17/26 (65%)

Query: 85  NLEVHLAVHTGNRPFICRVCGKSFVR 110
           NL  H+  HTG +P+ C VCGKSF  
Sbjct: 1   NLRRHMRTHTGEKPYKCPVCGKSFSS 26


Length = 26

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 275
KOG3608|consensus467 99.95
KOG1074|consensus958 99.95
KOG2462|consensus279 99.93
KOG3608|consensus 467 99.92
KOG2462|consensus279 99.92
KOG3623|consensus1007 99.91
KOG1074|consensus958 99.9
KOG3623|consensus1007 99.8
KOG3576|consensus267 99.63
KOG3576|consensus267 99.61
PLN03086567 PRLI-interacting factor K; Provisional 99.27
PLN03086567 PRLI-interacting factor K; Provisional 99.26
PHA00733128 hypothetical protein 99.2
PHA00733128 hypothetical protein 99.04
PHA0276855 hypothetical protein; Provisional 98.98
KOG3993|consensus500 98.93
KOG3993|consensus500 98.84
PHA0276855 hypothetical protein; Provisional 98.75
PHA0061644 hypothetical protein 98.72
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.71
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.53
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.43
PHA0073279 hypothetical protein 98.42
PHA0061644 hypothetical protein 98.37
PHA0073279 hypothetical protein 98.36
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.35
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 98.09
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.96
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.92
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.69
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.68
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.66
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.66
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.52
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 97.51
KOG1146|consensus 1406 97.36
COG5189423 SFP1 Putative transcriptional repressor regulating 97.28
smart0035526 ZnF_C2H2 zinc finger. 97.13
COG5189423 SFP1 Putative transcriptional repressor regulating 97.09
PRK04860160 hypothetical protein; Provisional 97.03
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 97.02
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 96.99
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.99
KOG2231|consensus 669 96.96
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.93
smart0035526 ZnF_C2H2 zinc finger. 96.66
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 96.58
KOG2785|consensus 390 96.57
KOG2231|consensus 669 96.56
KOG2482|consensus423 96.55
KOG2785|consensus 390 96.49
KOG1146|consensus 1406 96.35
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 96.33
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 96.1
COG5236493 Uncharacterized conserved protein, contains RING Z 95.91
KOG2482|consensus423 95.66
PRK04860160 hypothetical protein; Provisional 95.6
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 95.31
COG5236 493 Uncharacterized conserved protein, contains RING Z 95.28
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 94.83
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 94.8
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 94.47
KOG4173|consensus253 94.43
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 94.24
KOG2893|consensus341 93.36
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 93.17
COG404965 Uncharacterized protein containing archaeal-type C 92.96
KOG2893|consensus 341 92.18
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 91.96
COG5048467 FOG: Zn-finger [General function prediction only] 91.82
KOG4173|consensus253 91.24
COG288861 Predicted Zn-ribbon RNA-binding protein with a fun 88.43
cd0072934 rubredoxin_SM Rubredoxin, Small Modular nonheme ir 88.21
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 88.2
PF09986214 DUF2225: Uncharacterized protein conserved in bact 88.13
COG404965 Uncharacterized protein containing archaeal-type C 88.06
TIGR0209838 MJ0042_CXXC MJ0042 family finger-like domain. This 87.33
COG5048 467 FOG: Zn-finger [General function prediction only] 87.3
PF1290740 zf-met2: Zinc-binding 86.58
PF1371937 zinc_ribbon_5: zinc-ribbon domain 85.45
KOG2186|consensus276 84.1
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 84.1
PF1371736 zinc_ribbon_4: zinc-ribbon domain 83.98
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 83.69
KOG2186|consensus276 83.63
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 83.61
PRK00464154 nrdR transcriptional regulator NrdR; Validated 82.98
PF09986214 DUF2225: Uncharacterized protein conserved in bact 82.76
KOG1280|consensus 381 82.66
smart0065944 RPOLCX RNA polymerase subunit CX. present in RNA p 82.51
PRK1489059 putative Zn-ribbon RNA-binding protein; Provisiona 82.5
smart0073426 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18 82.19
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 81.83
PHA0062659 hypothetical protein 81.52
PF06524314 NOA36: NOA36 protein; InterPro: IPR010531 This fam 80.91
TIGR00373158 conserved hypothetical protein TIGR00373. This fam 80.51
COG1592166 Rubrerythrin [Energy production and conversion] 80.04
>KOG3608|consensus Back     alignment and domain information
Probab=99.95  E-value=8.5e-28  Score=186.68  Aligned_cols=227  Identities=27%  Similarity=0.482  Sum_probs=199.9

Q ss_pred             ccCCCCceec--ccccccccCHHHHHHHHHhhcCC-----------C-CCccccc--chhhcccchHHHHHHhhhcCCCc
Q psy12834          7 SHTGARPYEC--KTCKKTFVSKYTYKAHLVTHTDR-----------K-RPFSCEK--CDKSFYTQQNLVQHEKTHSGSKD   70 (275)
Q Consensus         7 ~~~~~~~~~C--~~C~~~f~~~~~l~~H~~~~~~~-----------~-~~~~C~~--C~~~f~~~~~l~~H~~~~~~~~~   70 (275)
                      +...+..|.|  ..|+..|.+...|..|+..|...           + ..+.|.+  |-+.+.+++.|..|.+.|.+++.
T Consensus       128 ip~~g~~f~C~WedCe~~F~s~~ef~dHV~~H~l~ceyd~~~~~~D~~pv~~C~W~~Ct~~~~~k~~LreH~r~Hs~eKv  207 (467)
T KOG3608|consen  128 IPALGQNFRCGWEDCEREFVSIVEFQDHVVKHALFCEYDIQKTPEDERPVTMCNWAMCTKHMGNKYRLREHIRTHSNEKV  207 (467)
T ss_pred             cccchhhhccChhhcCCcccCHHHHHHHHHHhhhhhhhhhhhCCCCCCceeeccchhhhhhhccHHHHHHHHHhcCCCeE
Confidence            3344567787  57999999999999999887542           2 2345655  99999999999999999999999


Q ss_pred             cccCcchhhcCChHHHHHHHHh--hcCCCCccCCcccccccChhHHHHHHhhccCCCCccccccccccccccCCCccccc
Q psy12834         71 FVCTECGKAFGTLRNLEVHLAV--HTGNRPFICRVCGKSFVRKAEVKDHERTHTGEKPYQCEFCGAQFRFKGSSGTESID  148 (275)
Q Consensus        71 ~~C~~C~~~f~~~~~l~~H~~~--~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~c~~c~~~~~~~~~~~~~~~~  148 (275)
                      ..|+.|+..|..+..|-.|.+.  .....+|.|..|.+.|.+...|..|+..|.  ..|.|+.|+-..            
T Consensus       208 vACp~Cg~~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv~rHv--n~ykCplCdmtc------------  273 (467)
T KOG3608|consen  208 VACPHCGELFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHVVRHV--NCYKCPLCDMTC------------  273 (467)
T ss_pred             EecchHHHHhccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHHHHhh--hcccccccccCC------------
Confidence            9999999999999999999653  455779999999999999999999999886  559999999999            


Q ss_pred             ccccccccccchHHHHHhhcCCCCCCCCCCCChhhccChhhHHHHHHhhcCCCCCccccc--ccccCCChhHHHHHHHhh
Q psy12834        149 KLLLCFLSQRSNLQSHKRATHFNDKRYPCTSCPKAFKRRRLLDYHIKAAHTGERPYQCDI--CNATFIYPEHFKKHRRIH  226 (275)
Q Consensus       149 ~~~~~~~~~~~~~~~h~~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~C~~--C~~~f~~~~~l~~H~~~h  226 (275)
                             +..+.|..|++..|...+||+|..|++.|.+.++|.+|+. .|+ +..|+|..  |..+|.+...|..|++.+
T Consensus       274 -------~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~-~HS-~~~y~C~h~~C~~s~r~~~q~~~H~~ev  344 (467)
T KOG3608|consen  274 -------SSASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQ-VHS-KTVYQCEHPDCHYSVRTYTQMRRHFLEV  344 (467)
T ss_pred             -------CChHHHHHHHHhhhccCCCccccchhhhhccHHHHHHHHH-hcc-ccceecCCCCCcHHHHHHHHHHHHHHHh
Confidence                   8889999999999999999999999999999999999987 788 66799988  999999999999999876


Q ss_pred             c-CCC--ceeCcccchhhhhhhHHHhhhccccc
Q psy12834        227 T-GEK--PYVCEVRLAVFYYVTCLFNMIQPKRF  256 (275)
Q Consensus       227 ~-~~~--~~~C~~C~~~~~~~~~~~~H~~~~~~  256 (275)
                      + |.+  +|.|-.|++.|..=-+|..|+.++|.
T Consensus       345 hEg~np~~Y~CH~Cdr~ft~G~~L~~HL~kkH~  377 (467)
T KOG3608|consen  345 HEGNNPILYACHCCDRFFTSGKSLSAHLMKKHG  377 (467)
T ss_pred             ccCCCCCceeeecchhhhccchhHHHHHHHhhc
Confidence            5 544  59999999999999999999977654



>KOG1074|consensus Back     alignment and domain information
>KOG2462|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG2462|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF12907 zf-met2: Zinc-binding Back     alignment and domain information
>PF13719 zinc_ribbon_5: zinc-ribbon domain Back     alignment and domain information
>KOG2186|consensus Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>PF13717 zinc_ribbon_4: zinc-ribbon domain Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>KOG2186|consensus Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>PRK00464 nrdR transcriptional regulator NrdR; Validated Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG1280|consensus Back     alignment and domain information
>smart00659 RPOLCX RNA polymerase subunit CX Back     alignment and domain information
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional Back     alignment and domain information
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>PHA00626 hypothetical protein Back     alignment and domain information
>PF06524 NOA36: NOA36 protein; InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues Back     alignment and domain information
>TIGR00373 conserved hypothetical protein TIGR00373 Back     alignment and domain information
>COG1592 Rubrerythrin [Energy production and conversion] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query275
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 3e-35
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 2e-17
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 3e-11
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 2e-15
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 2e-11
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 3e-14
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 7e-08
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 1e-13
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 2e-08
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 2e-13
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 2e-06
1tf6_A190 Co-crystal Structure Of Xenopus Tfiiia Zinc Finger 3e-13
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 3e-13
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 9e-09
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 5e-13
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 5e-09
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 7e-13
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 5e-09
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 8e-13
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 1e-08
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 8e-13
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 5e-09
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 9e-13
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 3e-07
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 1e-12
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 8e-09
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 2e-06
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 2e-12
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 5e-09
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 2e-12
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 6e-09
2gli_A155 Five-Finger GliDNA COMPLEX Length = 155 2e-12
2gli_A155 Five-Finger GliDNA COMPLEX Length = 155 1e-05
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 3e-12
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 1e-08
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 1e-11
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 5e-07
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 6e-07
2csh_A110 Solution Structure Of Tandem Repeat Of The Zf-C2h2 1e-10
2csh_A110 Solution Structure Of Tandem Repeat Of The Zf-C2h2 9e-09
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 5e-10
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 4e-09
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 2e-08
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 2e-04
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 9e-09
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 6e-07
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 4e-06
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 1e-08
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 4e-08
1tf3_A92 Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures 2e-07
1tf3_A92 Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures 1e-04
1x6e_A72 Solution Structures Of The C2h2 Type Zinc Finger Do 2e-07
1x6e_A72 Solution Structures Of The C2h2 Type Zinc Finger Do 5e-06
1llm_C88 Crystal Structure Of A Zif23-Gcn4 Chimera Bound To 5e-07
1llm_C88 Crystal Structure Of A Zif23-Gcn4 Chimera Bound To 2e-04
2lt7_A133 Solution Nmr Structure Of Kaiso Zinc Finger Dna Bin 6e-07
2lt7_A133 Solution Nmr Structure Of Kaiso Zinc Finger Dna Bin 1e-04
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 1e-06
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 3e-05
2wbu_A90 Crystal Structure Of The Zinc Finger Domain Of Klf4 2e-06
2wbu_A90 Crystal Structure Of The Zinc Finger Domain Of Klf4 1e-04
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 3e-06
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 1e-04
2adr_A60 Adr1 Dna-Binding Domain From Saccharomyces Cerevisi 4e-05
1f2i_G73 Cocrystal Structure Of Selected Zinc Finger Dimer B 4e-05
1f2i_G73 Cocrystal Structure Of Selected Zinc Finger Dimer B 2e-04
2yts_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 6e-05
2ep0_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 1e-04
2em3_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 1e-04
2em3_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 9e-04
2epa_A72 Solution Structure Of The First And Second Zf-C2h2 2e-04
4gzn_C60 Mouse Zfp57 Zinc Fingers In Complex With Methylated 2e-04
2emm_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 2e-04
3uk3_C57 Crystal Structure Of Znf217 Bound To Dna Length = 5 2e-04
2emh_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 2e-04
2eor_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 3e-04
2eqw_A42 Solution Structure Of The 6th C2h2 Type Zinc Finger 4e-04
2ep2_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 4e-04
2ena_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 6e-04
2yrj_A46 Solution Structure Of The C2h2-Type Zinc Finger Dom 6e-04
2dlk_A79 Solution Structure Of The First And The Second Zf-C 6e-04
2en6_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 8e-04
2eme_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 8e-04
2yti_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 8e-04
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure

Iteration: 1

Score = 145 bits (365), Expect = 3e-35, Method: Compositional matrix adjust. Identities = 76/191 (39%), Positives = 111/191 (58%), Gaps = 21/191 (10%) Query: 40 KRPFSCEKCDKSFYTQQNLVQHEKTHSGSKDFVCTECGKAFGTLRNLEVHLAVHTGNRPF 99 ++P++C +C KSF +L +H++TH+G K + C ECGK+F ++L H HTG +P+ Sbjct: 19 EKPYACPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFSDKKDLTRHQRTHTGEKPY 78 Query: 100 ICRVCGKSFVRKAEVKDHERTHTGEKPYQCEFCGAQFRFKGSSGTESIDKLLLCFLSQRS 159 C CGKSF ++A ++ H+RTHTGEKPY C CG F SQ + Sbjct: 79 KCPECGKSFSQRANLRAHQRTHTGEKPYACPECGKSF-------------------SQLA 119 Query: 160 NLQSHKRATHFNDKRYPCTSCPKAFKRRRLLDYHIKAAHTGERPYQCDICNATFIYPEHF 219 +L++H+R TH +K Y C C K+F R L H + HTGE+PY+C C +F + Sbjct: 120 HLRAHQR-THTGEKPYKCPECGKSFSREDNLHTHQRT-HTGEKPYKCPECGKSFSRRDAL 177 Query: 220 KKHRRIHTGEK 230 H+R HTG+K Sbjct: 178 NVHQRTHTGKK 188
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|1TF6|A Chain A, Co-crystal Structure Of Xenopus Tfiiia Zinc Finger Domain Bound To The 5s Ribosomal Rna Gene Internal Control Region Length = 190 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 Back     alignment and structure
>pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|2CSH|A Chain A, Solution Structure Of Tandem Repeat Of The Zf-C2h2 Domains Of Human Zinc Finger Protein 297b Length = 110 Back     alignment and structure
>pdb|2CSH|A Chain A, Solution Structure Of Tandem Repeat Of The Zf-C2h2 Domains Of Human Zinc Finger Protein 297b Length = 110 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|1TF3|A Chain A, Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures Length = 92 Back     alignment and structure
>pdb|1TF3|A Chain A, Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures Length = 92 Back     alignment and structure
>pdb|1X6E|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Zinc Finger Protein 24 Length = 72 Back     alignment and structure
>pdb|1X6E|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Zinc Finger Protein 24 Length = 72 Back     alignment and structure
>pdb|1LLM|C Chain C, Crystal Structure Of A Zif23-Gcn4 Chimera Bound To Dna Length = 88 Back     alignment and structure
>pdb|1LLM|C Chain C, Crystal Structure Of A Zif23-Gcn4 Chimera Bound To Dna Length = 88 Back     alignment and structure
>pdb|2LT7|A Chain A, Solution Nmr Structure Of Kaiso Zinc Finger Dna Binding Domain In Complex With Kaiso Binding Site Dna Length = 133 Back     alignment and structure
>pdb|2LT7|A Chain A, Solution Nmr Structure Of Kaiso Zinc Finger Dna Binding Domain In Complex With Kaiso Binding Site Dna Length = 133 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 Back     alignment and structure
>pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 Back     alignment and structure
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure
>pdb|2ADR|A Chain A, Adr1 Dna-Binding Domain From Saccharomyces Cerevisiae, Nmr, 25 Structures Length = 60 Back     alignment and structure
>pdb|1F2I|G Chain G, Cocrystal Structure Of Selected Zinc Finger Dimer Bound To Dna Length = 73 Back     alignment and structure
>pdb|1F2I|G Chain G, Cocrystal Structure Of Selected Zinc Finger Dimer Bound To Dna Length = 73 Back     alignment and structure
>pdb|2YTS|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 715- 747) Of Human Zinc Finger Protein 484 Length = 46 Back     alignment and structure
>pdb|2EP0|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 528- 560) Of Human Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure
>pdb|2EM3|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 640- 672) Of Human Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure
>pdb|2EM3|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 640- 672) Of Human Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure
>pdb|2EPA|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domains From Human Krueppel-Like Factor 10 Length = 72 Back     alignment and structure
>pdb|4GZN|C Chain C, Mouse Zfp57 Zinc Fingers In Complex With Methylated Dna Length = 60 Back     alignment and structure
>pdb|2EMM|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 544- 576) Of Human Zinc Finger Protein 95 Homolog Length = 46 Back     alignment and structure
>pdb|3UK3|C Chain C, Crystal Structure Of Znf217 Bound To Dna Length = 57 Back     alignment and structure
>pdb|2EMH|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 491- 523) Of Human Zinc Finger Protein 484 Length = 46 Back     alignment and structure
>pdb|2EOR|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 255- 287) Of Human Zinc Finger Protein 224 Length = 46 Back     alignment and structure
>pdb|2EQW|A Chain A, Solution Structure Of The 6th C2h2 Type Zinc Finger Domain Of Zinc Finger Protein 484 Length = 42 Back     alignment and structure
>pdb|2EP2|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 603- 635) Of Human Zinc Finger Protein 484 Length = 46 Back     alignment and structure
>pdb|2ENA|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 311- 343) Of Human Zinc Finger Protein 224 Length = 46 Back     alignment and structure
>pdb|2YRJ|A Chain A, Solution Structure Of The C2h2-Type Zinc Finger Domain (781- 813) From Zinc Finger Protein 473 Length = 46 Back     alignment and structure
>pdb|2DLK|A Chain A, Solution Structure Of The First And The Second Zf-C2h2 Domains Of Zinc Finger Protein 692 Length = 79 Back     alignment and structure
>pdb|2EN6|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 887- 919) Of Human Zinc Finger Protein 268 Length = 46 Back     alignment and structure
>pdb|2EME|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 725- 757) Of Human Zinc Finger Protein 473 Length = 46 Back     alignment and structure
>pdb|2YTI|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 564- 596) Of Human Zinc Finger Protein 347 Length = 46 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query275
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-55
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 9e-52
1tf6_A190 Protein (transcription factor IIIA); complex (tran 5e-42
1tf6_A190 Protein (transcription factor IIIA); complex (tran 1e-40
1tf6_A190 Protein (transcription factor IIIA); complex (tran 3e-38
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 7e-38
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 3e-27
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 6e-24
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 3e-09
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 3e-37
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 7e-34
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 3e-22
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 4e-09
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 1e-33
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 4e-33
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 3e-22
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 1e-11
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 5e-04
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 6e-32
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 5e-31
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 5e-23
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-22
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 8e-06
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 3e-31
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 3e-29
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 1e-19
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 8e-11
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 6e-31
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 2e-30
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 1e-29
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 4e-22
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 7e-04
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 1e-30
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-30
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 5e-27
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 1e-19
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 6e-14
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-04
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 4e-29
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 6e-28
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 6e-27
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 1e-25
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 8e-16
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 8e-26
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 4e-25
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 1e-23
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 1e-18
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 1e-15
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 2e-13
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 5e-25
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 1e-20
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 7e-18
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 5e-25
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-24
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 8e-24
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 1e-16
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 9e-13
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 7e-11
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 5e-23
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 5e-21
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-19
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-17
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 2e-16
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 9e-23
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 1e-21
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-20
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 1e-14
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-10
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 2e-22
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 7e-22
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 1e-17
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 5e-14
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 7e-13
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 3e-12
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 2e-04
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 3e-22
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 2e-19
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 8e-16
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 1e-13
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 2e-12
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 8e-04
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 5e-22
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 3e-20
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 6e-17
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 1e-12
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 9e-04
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 9e-22
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 4e-18
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 4e-18
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 2e-15
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 1e-10
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-21
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 3e-20
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 7e-19
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-14
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 1e-11
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 1e-04
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 2e-21
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 5e-20
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 1e-18
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 1e-13
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 2e-12
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 4e-19
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 5e-18
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 1e-16
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 4e-14
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 8e-14
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 2e-11
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 2e-04
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 2e-18
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 5e-18
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 3e-13
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 3e-09
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 3e-17
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 3e-16
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-15
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 2e-13
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 5e-13
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-10
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 9e-16
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 3e-15
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 1e-12
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 1e-11
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 4e-15
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 1e-13
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 2e-11
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 1e-10
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 5e-10
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 2e-08
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 8e-04
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 5e-14
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 8e-10
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 4e-08
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 1e-06
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 5e-06
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 7e-14
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 4e-12
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 7e-12
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 4e-11
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 1e-09
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 3e-08
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 3e-07
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 1e-13
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 3e-13
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 4e-11
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 1e-10
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 3e-06
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 2e-05
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 1e-13
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 6e-12
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 9e-12
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 2e-09
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-13
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-11
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-07
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-06
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-05
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-13
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 3e-12
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-08
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 3e-08
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 5e-06
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 9e-06
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-13
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-13
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-08
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-05
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-13
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-12
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-07
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-05
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-04
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-13
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-12
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-08
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-06
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 5e-13
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 8e-12
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 1e-08
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-07
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 6e-05
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 9e-05
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 7e-13
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-11
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-08
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-05
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-05
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-13
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-11
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-09
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-08
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-06
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 7e-13
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-12
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-08
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-06
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-05
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-13
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-11
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-08
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-05
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-05
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-05
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-13
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-12
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-08
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-06
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-12
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-12
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-07
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-05
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-05
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-05
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-12
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-12
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 7e-06
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-05
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 7e-05
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-04
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-12
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-12
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-09
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-04
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-04
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-12
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-12
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-07
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 8e-05
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-04
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-12
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-12
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-08
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-05
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-12
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-11
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 5e-08
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-07
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-05
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-05
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-04
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-12
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 5e-11
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 5e-09
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-08
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 5e-06
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-05
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-04
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 1e-12
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 1e-11
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 3e-08
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 1e-05
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 1e-05
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 7e-05
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-12
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-11
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-08
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-06
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-05
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-04
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 1e-12
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 2e-11
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 3e-08
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 1e-05
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 5e-05
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 5e-05
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-12
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-11
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-08
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-05
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-05
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 1e-12
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 2e-11
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 2e-08
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 9e-06
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 4e-05
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-12
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-11
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-08
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-05
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-04
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-12
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 9e-12
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-07
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-04
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-04
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-12
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-12
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-07
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-05
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-12
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-12
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-07
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-04
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-04
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-12
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-11
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-08
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-06
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-05
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-12
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-11
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-08
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-05
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-04
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-12
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-11
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-08
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-05
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-05
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-05
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 2e-12
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 2e-11
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 7e-08
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 3e-06
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 3e-05
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 3e-05
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-12
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-11
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-07
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-04
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-04
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-12
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-10
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-06
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 6e-06
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 8e-05
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-12
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-11
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-07
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-05
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-05
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-12
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-11
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-07
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-07
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-05
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-12
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-11
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 5e-08
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-07
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-05
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-04
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-12
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-11
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-08
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-05
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-12
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-12
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-07
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-05
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-04
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-12
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-11
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-08
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-06
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-05
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-05
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-12
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-11
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-08
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-05
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-12
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-12
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-08
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-05
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-04
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-12
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-12
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-07
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-05
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-04
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-12
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-12
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-07
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-04
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-04
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-12
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-12
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-08
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-05
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-04
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 3e-12
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 9e-12
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 4e-08
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 3e-05
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 4e-04
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-12
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-12
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-08
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-05
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-04
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 3e-12
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 1e-11
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 4e-08
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 5e-07
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 2e-05
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 3e-05
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-12
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-12
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-08
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-05
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-05
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-05
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-12
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-11
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-08
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-08
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 9e-06
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-05
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-04
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-12
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-11
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 8e-08
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-04
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-04
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-12
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-12
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-08
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-12
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-11
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-07
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-04
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-04
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-12
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-12
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-08
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-04
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-12
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-12
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-09
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-08
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-07
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-05
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-04
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-12
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-11
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-08
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-05
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-05
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-12
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-11
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-08
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-07
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-06
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-05
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-12
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-11
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-08
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-05
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-05
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-12
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-12
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 7e-08
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-04
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 8e-04
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 4e-12
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 2e-11
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 2e-06
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 5e-05
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 6e-05
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-12
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-11
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-07
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-04
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-04
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-12
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-12
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-08
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-06
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 4e-12
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-11
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-08
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 4e-06
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 5e-05
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-04
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 4e-12
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 3e-11
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 9e-11
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 3e-09
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 1e-08
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 5e-07
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-12
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-11
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-08
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-05
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-12
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-12
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-07
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-05
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-05
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-05
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-12
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-11
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-08
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-04
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-04
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-12
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-11
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-08
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-05
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-04
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-12
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-12
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-07
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-05
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-04
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 5e-12
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-11
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 8e-08
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-04
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-04
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-12
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-12
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-07
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-05
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-04
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-12
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-12
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-07
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-04
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-04
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-12
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-11
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-07
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-05
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-04
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-12
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-11
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-08
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-05
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-05
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-12
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-12
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-07
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-05
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-04
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-12
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 7e-12
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-07
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-04
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-04
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-12
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-12
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-08
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 9e-08
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-05
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-04
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-12
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-11
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-08
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-05
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-04
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-12
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-11
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-07
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-07
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-05
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-05
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-11
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-11
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-07
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-04
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-04
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 1e-11
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 2e-09
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 3e-07
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 3e-06
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 6e-05
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 1e-11
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 4e-09
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 1e-07
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 3e-07
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 4e-07
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 2e-04
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-11
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-11
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-07
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-05
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-04
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-11
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-11
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-07
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 9e-05
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-04
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-11
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-11
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-08
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-05
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-05
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-05
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-11
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-11
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 9e-08
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-05
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-04
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 2e-11
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 4e-11
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 1e-07
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 4e-05
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 7e-05
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 1e-04
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 2e-11
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 3e-10
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 1e-07
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 1e-06
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 1e-06
2epa_A72 Krueppel-like factor 10; transforming growth facto 3e-11
2epa_A72 Krueppel-like factor 10; transforming growth facto 2e-10
2epa_A72 Krueppel-like factor 10; transforming growth facto 3e-09
2epa_A72 Krueppel-like factor 10; transforming growth facto 5e-07
2epa_A72 Krueppel-like factor 10; transforming growth facto 1e-06
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-11
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-10
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-07
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-07
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-04
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-04
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 9e-11
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-09
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 4e-07
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 4e-04
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 9e-11
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 3e-10
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 1e-04
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 6e-04
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 1e-10
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 2e-10
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 1e-07
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 2e-07
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 7e-05
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 2e-04
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 3e-04
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 3e-10
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 2e-09
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 3e-07
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 7e-05
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 9e-05
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 4e-04
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 2e-09
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 1e-08
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 3e-05
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 3e-05
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 2e-04
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 1e-08
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 3e-08
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 6e-07
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 7e-05
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 2e-04
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 3e-04
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 1e-08
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 2e-08
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 8e-06
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 2e-04
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 2e-04
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 4e-07
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 7e-07
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 4e-05
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 2e-04
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 5e-07
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 1e-06
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 3e-05
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 1e-04
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 7e-04
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 2e-06
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 1e-04
1ard_A29 Yeast transcription factor ADR1; transcription reg 1e-05
1ard_A29 Yeast transcription factor ADR1; transcription reg 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 2e-05
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 2e-05
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 4e-04
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 2e-05
1ej6_B 1275 Lambda1; icosahedral, non-equivalence, dsRNA virus 5e-05
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 2e-04
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
 Score =  176 bits (448), Expect = 2e-55
 Identities = 78/210 (37%), Positives = 113/210 (53%), Gaps = 22/210 (10%)

Query: 22  TFVSKYTYKAHLVTHTDRKRPFSCEKCDKSFYTQQNLVQHEKTHSGSKDFVCTECGKAFG 81
           +     +  A        K P++C +C KSF    +L +H++TH+G K + C ECGK+F 
Sbjct: 2   SEFGSSSSVAQAALEPGEK-PYACPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFS 60

Query: 82  TLRNLEVHLAVHTGNRPFICRVCGKSFVRKAEVKDHERTHTGEKPYQCEFCGAQFRFKGS 141
             ++L  H   HTG +P+ C  CGKSF ++A ++ H+RTHTGEKPY C  CG  F     
Sbjct: 61  DKKDLTRHQRTHTGEKPYKCPECGKSFSQRANLRAHQRTHTGEKPYACPECGKSF----- 115

Query: 142 SGTESIDKLLLCFLSQRSNLQSHKRATHFNDKRYPCTSCPKAFKRRRLLDYHIKAAHTGE 201
                         SQ ++L++H+R TH  +K Y C  C K+F R   L  H +  HTGE
Sbjct: 116 --------------SQLAHLRAHQR-THTGEKPYKCPECGKSFSREDNLHTH-QRTHTGE 159

Query: 202 RPYQCDICNATFIYPEHFKKHRRIHTGEKP 231
           +PY+C  C  +F   +    H+R HTG+K 
Sbjct: 160 KPYKCPECGKSFSRRDALNVHQRTHTGKKT 189


>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Length = 29 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Length = 29 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Length = 31 Back     alignment and structure
>1ej6_B Lambda1; icosahedral, non-equivalence, dsRNA virus, methylase, methyltransferase, guanylyltransferase, zinc finger, icosahedral virus; 3.60A {Reovirus SP} SCOP: i.7.1.1 PDB: 2cse_V Length = 1275 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 102 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query275
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 100.0
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 100.0
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.98
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.97
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.94
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.94
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.9
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.9
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.9
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.89
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.89
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.89
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.88
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.88
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.88
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.88
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.8
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.78
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.78
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.78
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.77
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.77
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.77
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.77
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.77
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.77
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.76
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.75
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.74
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.74
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.73
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.73
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.72
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.71
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.71
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.7
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.7
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.69
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.65
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.65
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.64
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.64
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.63
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.63
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.63
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.62
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.58
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.56
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.55
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.53
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.53
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.52
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.52
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.52
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.51
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.51
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.51
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.5
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.5
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.5
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.5
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.49
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.49
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.49
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.48
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.47
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.46
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.46
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.46
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.45
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.45
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.45
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.44
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.44
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.44
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.43
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.43
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.38
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.38
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.37
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.36
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.29
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.26
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.26
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.25
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.25
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.25
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.24
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.24
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.24
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.24
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.24
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.24
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.24
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.24
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.24
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.24
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.24
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.24
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.24
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.24
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.24
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.23
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.23
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.23
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.23
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.23
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.23
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.23
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.23
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.23
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.23
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.23
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.22
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.22
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.22
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.22
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.22
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.22
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.22
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.21
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.21
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.21
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.21
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.21
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.21
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.21
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.2
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.2
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.2
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.2
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.19
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.19
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.19
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.19
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.17
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.17
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.15
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.15
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.13
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.13
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.12
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.12
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.12
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.11
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.11
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.11
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.11
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.11
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.11
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.11
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.11
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.11
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.11
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.1
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.1
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.1
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.1
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.1
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.1
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.1
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.1
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.1
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.1
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.1
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.1
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.1
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.1
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.1
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.1
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.1
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.1
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.1
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.09
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.09
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.09
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.09
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.09
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.09
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.09
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.09
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.09
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.09
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.08
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.08
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.08
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.08
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.08
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.08
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.08
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.08
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.08
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.08
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.08
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.08
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.07
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.07
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.07
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.07
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.07
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.07
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.07
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.07
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.07
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.07
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.07
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.06
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.06
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.06
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.06
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.06
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.06
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.05
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.05
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.05
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.05
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.05
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.04
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.04
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.04
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.04
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.04
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.04
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.03
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.03
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.03
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.03
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.03
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.02
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.02
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.02
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.02
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.0
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 99.0
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.0
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.98
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.98
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.97
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.97
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.97
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.97
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.96
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.95
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.95
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.94
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.94
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.94
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.94
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.94
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.94
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.93
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.93
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.93
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.93
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.93
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.93
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.92
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.92
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.92
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.92
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.92
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.91
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.91
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.91
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.91
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.91
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.9
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.9
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.9
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.89
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.89
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.89
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.88
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.87
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.87
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.87
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.86
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.85
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.85
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.85
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.84
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.84
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.81
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.8
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.8
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.79
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.79
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.78
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.78
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.78
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.78
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.78
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.77
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.74
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.72
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.69
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.67
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.67
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.64
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.6
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.6
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.59
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.58
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.56
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.56
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.53
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.52
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.52
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.52
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.51
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.5
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.5
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.46
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.42
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.4
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.38
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.37
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.35
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.35
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.34
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.33
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.32
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.32
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.31
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.3
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.3
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.29
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.29
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.29
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.28
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.27
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.25
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.25
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.24
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.23
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.23
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.23
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.52
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.21
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.21
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.19
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.19
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.49
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.17
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.15
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.14
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.12
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.12
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.11
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.29
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.0
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 97.99
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 97.97
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 97.92
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 97.92
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 97.92
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 97.88
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 97.87
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.86
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 97.84
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.84
1ard_A29 Yeast transcription factor ADR1; transcription reg 97.83
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 97.82
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.79
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.79
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 96.98
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.76
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.76
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.74
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.72
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 96.9
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 96.84
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.62
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.52
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 97.15
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 97.09
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 96.4
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 96.34
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 96.21
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 96.15
2e72_A49 POGO transposable element with ZNF domain; zinc fi 96.02
2e72_A49 POGO transposable element with ZNF domain; zinc fi 95.99
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 95.87
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 95.57
2jvx_A28 NF-kappa-B essential modulator; CCHC classical zin 91.05
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 90.92
2k9h_A57 Glycoprotein; hantavirus, zinc finger, CCHC, metal 90.65
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 90.4
2elu_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 90.36
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 89.28
2k9h_A57 Glycoprotein; hantavirus, zinc finger, CCHC, metal 87.99
4ayb_P48 DNA-directed RNA polymerase; transferase, multi-su 87.06
2yrk_A55 Zinc finger homeobox protein 4; structure genomics 86.11
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 85.96
2gmg_A105 Hypothetical protein PF0610; winged-helix like pro 84.84
2k5c_A95 Uncharacterized protein PF0385; structural genomic 84.73
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 84.46
2i5o_A39 DNA polymerase ETA; zinc finger, DNA polymerase,PO 82.18
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
Probab=100.00  E-value=8.4e-39  Score=243.53  Aligned_cols=183  Identities=42%  Similarity=0.894  Sum_probs=89.7

Q ss_pred             HHHHHHHhhcCCCCCcccccchhhcccchHHHHHHhhhcCCCccccCcchhhcCChHHHHHHHHhhcCCCCccCCccccc
Q psy12834         28 TYKAHLVTHTDRKRPFSCEKCDKSFYTQQNLVQHEKTHSGSKDFVCTECGKAFGTLRNLEVHLAVHTGNRPFICRVCGKS  107 (275)
Q Consensus        28 ~l~~H~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~  107 (275)
                      .|..|+..+.+ +++|.|+.|++.|.+...|..|++.|.+.++|.|+.|++.|.+...|..|+..|.++++|.|+.|++.
T Consensus         8 ~l~~h~~~~~~-~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~   86 (190)
T 2i13_A            8 SSVAQAALEPG-EKPYACPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFSDKKDLTRHQRTHTGEKPYKCPECGKS   86 (190)
T ss_dssp             ------------------------CCSSHHHHHGGGCC---CCEECTTTCCEESSHHHHHHHHHHHHCCCCEECTTTCCE
T ss_pred             cchhhhhhcCC-CCCCcCCCCccccCCHHHHHHHHHHcCCCCCccCCCcCchhCCHHHHHHHHHhcCCCCCccCcccCCc
Confidence            44455555443 44566666666666666666666665555566666666666666666666666666666666666666


Q ss_pred             ccChhHHHHHHhhccCCCCccccccccccccccCCCcccccccccccccccchHHHHHhhcCCCCCCCCCCCChhhccCh
Q psy12834        108 FVRKAEVKDHERTHTGEKPYQCEFCGAQFRFKGSSGTESIDKLLLCFLSQRSNLQSHKRATHFNDKRYPCTSCPKAFKRR  187 (275)
Q Consensus       108 f~~~~~l~~H~~~~~~~~~~~c~~c~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~h~~~~h~~~~~~~C~~C~~~f~~~  187 (275)
                      |.+...|..|++.|+++++|.|+.|++.|                   .+...|..|++ .|.++++|.|+.|++.|.+.
T Consensus        87 f~~~~~l~~H~~~h~~~~~~~C~~C~~~f-------------------~~~~~l~~H~~-~h~~~~~~~C~~C~~~f~~~  146 (190)
T 2i13_A           87 FSQRANLRAHQRTHTGEKPYACPECGKSF-------------------SQLAHLRAHQR-THTGEKPYKCPECGKSFSRE  146 (190)
T ss_dssp             ESCHHHHHHHHHHHHTCCCEECTTTCCEE-------------------SSHHHHHHHHH-HHHCCCCEECTTTCCEESCH
T ss_pred             cCCHHHHHHHHHhcCCCCCCcCCCCCCcc-------------------CCHHHHHHHHH-HhCCCCCeECCCCCcccCCH
Confidence            66666666666655555555555555555                   44445555554 34455555566666666666


Q ss_pred             hhHHHHHHhhcCCCCCcccccccccCCChhHHHHHHHhhcCCCce
Q psy12834        188 RLLDYHIKAAHTGERPYQCDICNATFIYPEHFKKHRRIHTGEKPY  232 (275)
Q Consensus       188 ~~l~~H~~~~H~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~  232 (275)
                      ..|..|++ .|.++++|.|+.|++.|.+...|..|+++|++++||
T Consensus       147 ~~L~~H~~-~H~~~~~~~C~~C~~~f~~~~~L~~H~~~H~~~k~~  190 (190)
T 2i13_A          147 DNLHTHQR-THTGEKPYKCPECGKSFSRRDALNVHQRTHTGKKTS  190 (190)
T ss_dssp             HHHHHHHH-HHHCCCCEECTTTCCEESSHHHHHHHHTTC------
T ss_pred             HHHHHHHH-hcCCCCCeECCCCCCccCCHHHHHHHHHhcCCCCCC
Confidence            66666655 455555666666666666666666666666665554



>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>2jvx_A NF-kappa-B essential modulator; CCHC classical zinc finger, NEMO zinc finger, beta-BETA- alpha fold, coiled coil, cytoplasm, disease mutation; NMR {Synthetic} PDB: 2jvy_A Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>2k9h_A Glycoprotein; hantavirus, zinc finger, CCHC, metal binding protein; NMR {Andes virus} Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>2elu_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2elw_A Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>2k9h_A Glycoprotein; hantavirus, zinc finger, CCHC, metal binding protein; NMR {Andes virus} Back     alignment and structure
>4ayb_P DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2pmz_P 2wb1_P 2y0s_P 3hkz_P 2waq_P 4b1o_P 4b1p_X Back     alignment and structure
>2yrk_A Zinc finger homeobox protein 4; structure genomics, ZF-C2H2 domain, ZFH-4, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.37.1.4 Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82 Back     alignment and structure
>2k5c_A Uncharacterized protein PF0385; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Pyrococcus furiosus} Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>2i5o_A DNA polymerase ETA; zinc finger, DNA polymerase,POL ETA, UBZ, ubiquitin-binding zinc finger, translesion synthesis, ubiquitin-binding domain; HET: DNA; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 275
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 3e-10
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 4e-09
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 5e-08
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 1e-04
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 3e-04
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 0.001
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 1e-09
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 3e-09
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 2e-05
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 3e-05
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 4e-05
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 4e-04
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 6e-08
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 2e-06
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 4e-04
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 0.001
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 1e-07
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 8e-07
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 3e-05
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 1e-04
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 4e-04
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 4e-04
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 0.002
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 1e-07
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 3e-07
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 9e-05
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 1e-04
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 1e-04
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-04
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 3e-07
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 1e-06
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 1e-04
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 0.002
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 4e-07
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 2e-04
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 7e-07
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 1e-06
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 5e-05
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 1e-04
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 0.004
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 8e-07
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 3e-06
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 6e-05
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 4e-04
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 0.002
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 1e-06
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 3e-06
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 1e-05
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-04
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 0.001
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 0.003
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 0.003
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 5e-06
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 6e-06
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 0.001
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 7e-06
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 1e-05
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 7e-05
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 3e-04
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 5e-04
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 7e-04
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 0.003
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 8e-06
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 2e-05
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 3e-04
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 0.002
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 1e-05
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 5e-05
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 6e-05
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 5e-04
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 6e-04
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 0.004
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 8e-04
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 0.001
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 0.002
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 0.001
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 0.001
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: PATZ1
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 52.3 bits (126), Expect = 3e-10
 Identities = 14/39 (35%), Positives = 23/39 (58%), Gaps = 1/39 (2%)

Query: 199 TGERPYQCDICNATFIYPEHFKKH-RRIHTGEKPYVCEV 236
           +  +PY C  C   F  P+H   H +++HT E+P+ C+V
Sbjct: 1   SVGKPYICQSCGKGFSRPDHLNGHIKQVHTSERPHKCQV 39


>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query275
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.66
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.6
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.34
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.27
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.24
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.18
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.09
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.09
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.07
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.05
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.05
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.04
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.03
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 99.0
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.97
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.95
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.94
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.93
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.93
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.9
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.82
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.8
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.8
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.76
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.74
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.72
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.69
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.68
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.61
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.58
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.54
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.51
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.4
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.4
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.39
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.36
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.33
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.25
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.25
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.21
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.19
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.14
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.11
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.09
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 98.0
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.99
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.94
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.91
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.91
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.9
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.87
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.82
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.79
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.78
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.74
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.71
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.71
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.68
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.65
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.56
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.5
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.46
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.44
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.44
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.41
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.4
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.36
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.33
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.3
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.3
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.16
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.13
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 97.06
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.04
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 96.97
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 96.93
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.93
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.84
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.82
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.81
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.81
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 96.68
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.67
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 96.63
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.47
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 96.13
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 96.1
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.99
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.94
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.76
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.76
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 95.68
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 95.62
d1y0jb136 U-shaped transcription factor, different fingers { 95.42
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 95.32
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 95.18
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 94.87
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 94.84
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 94.43
d1y0jb136 U-shaped transcription factor, different fingers { 94.18
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 94.04
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 93.82
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 93.3
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 93.09
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 92.96
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 92.82
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 92.81
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 92.79
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 92.42
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 91.9
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 91.44
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 91.11
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 90.85
d2ghfa236 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 90.55
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 90.44
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 89.99
d2ghfa236 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 89.29
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 89.28
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 88.72
d1wjpa341 Zinc finger protein 295, ZNF295 {Human (Homo sapie 88.27
d1wjpa341 Zinc finger protein 295, ZNF295 {Human (Homo sapie 86.84
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 82.32
d1wjpa226 Zinc finger protein 295, ZNF295 {Human (Homo sapie 81.41
d1fu9a_36 U-shaped transcription factor, different fingers { 81.25
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 81.1
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.66  E-value=2e-17  Score=95.59  Aligned_cols=53  Identities=25%  Similarity=0.523  Sum_probs=37.4

Q ss_pred             CCCcccccccccCCChhHHHHHHHhhcCCCceeCcccchhhhhhhHHHhhhccc
Q psy12834        201 ERPYQCDICNATFIYPEHFKKHRRIHTGEKPYVCEVRLAVFYYVTCLFNMIQPK  254 (275)
Q Consensus       201 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~~~~~~~~~~H~~~~  254 (275)
                      ++||+|. ||++|.....|..|+++|++++||.|+.||+.|...+.|..|++.|
T Consensus         1 EK~y~C~-Cgk~F~~~~~l~~H~~~Ht~ekpy~C~~C~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           1 DKLYPCQ-CGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             CCCEECT-TSCEESSHHHHHHHHHHHSCCCSEECTTTSCEESSSHHHHHHHTTT
T ss_pred             CcCCCCC-CCCeECCHHHhHHHhhccccccCCcCCCcCCEecCHHHHHHHHhcC
Confidence            4667773 7777777777777777777777777777777777777777776543



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1wjpa3 g.37.1.1 (A:67-107) Zinc finger protein 295, ZNF295 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjpa3 g.37.1.1 (A:67-107) Zinc finger protein 295, ZNF295 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjpa2 g.37.1.1 (A:43-66) Zinc finger protein 295, ZNF295 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fu9a_ g.37.1.2 (A:) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure