Psyllid ID: psy12849


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------14
MQNVNVNQKLTADILKIFLFLQKASWFGVRTNRTTVVNTINESSILIMAKKCRVILNCVGPYTWYGEAVVKACIEAKTHHVDITGEPYFMEYMQYEYNTRAQESEVCVVSACGIETLPIDMGVLMLQDSFEGHSGKEN
ccccccccccHHHHHHHHHHHHHHcccccccccEEEEEcccHHHHHHHHHcccEEEEcccccccccHHHHHHHHHccccEEEccccHHHHHHHHHHHHHHHHHcccEEEEcccccccHHHHHHHHHHHHHHHcccccc
cccccccHHHHHHHHHHHHHHHHHHccccccccEEEEEcccHHHHHHHHHHcEEEEEcccHHHHccHHHHHHHHHccccEEEccccHHHHHHHHHHHHHHHHHcccEEEEcccccccccHHHHHEEHHHccccccccc
mqnvnvnqKLTADILKIFLFLQKaswfgvrtnrttVVNTINESSILIMAKKCRVILNCVGPYTWYGEAVVKACIEAKthhvditgepyFMEYMQYEYNTRAQESEVCVVSacgietlpidMGVLMLqdsfeghsgken
mqnvnvnqKLTADILKIFLFLQKaswfgvrtnrttvvnTINESSILIMAKKCRVILNCVGPYTWYGEAVVKACIEAKTHHVDITGEPYFMEYMQYEYNTRAQESEVCVVSACGIETLPIDMGVLMLQDsfeghsgken
MQNVNVNQKLTADILKIFLFLQKASWFGvrtnrttvvntINESSILIMAKKCRVILNCVGPYTWYGEAVVKACIEAKTHHVDITGEPYFMEYMQYEYNTRAQESEVCVVSACGIETLPIDMGVLMLQDSFEGHSGKEN
*******QKLTADILKIFLFLQKASWFGVRTNRTTVVNTINESSILIMAKKCRVILNCVGPYTWYGEAVVKACIEAKTHHVDITGEPYFMEYMQYEYNTRAQESEVCVVSACGIETLPIDMGVLMLQ***********
*QNVNVNQKLTADILKIFLF*QKA*WFGVRTNRTTVVNTINESSILIMAKKCRVILNCVGPYTWYGEAVVKACIEAKTHHVDITGEPYFMEYMQYEYNTRAQESEVCVVSACGIETLPIDMGVLMLQDS*********
MQNVNVNQKLTADILKIFLFLQKASWFGVRTNRTTVVNTINESSILIMAKKCRVILNCVGPYTWYGEAVVKACIEAKTHHVDITGEPYFMEYMQYEYNTRAQESEVCVVSACGIETLPIDMGVLMLQDSF********
**NVNVNQKLTADILKIFLFLQKASWFGVRTNRTTVVNTINESSILIMAKKCRVILNCVGPYTWYGEAVVKACIEAKTHHVDITGEPYFMEYMQYEYNTRAQESEVCVVSACGIETLPIDMGVLMLQDSFE*******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQNVNVNQKLTADILKIFLFLQKASWFGVRTNRTTVVNTINESSILIMAKKCRVILNCVGPYTWYGEAVVKACIEAKTHHVDITGEPYFMEYMQYEYNTRAQESEVCVVSACGIETLPIDMGVLMLQDSFEGHSGKEN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query138 2.2.26 [Sep-21-2011]
Q3T067 429 Saccharopine dehydrogenas yes N/A 0.702 0.226 0.422 2e-20
Q6AY30 429 Saccharopine dehydrogenas yes N/A 0.666 0.214 0.467 3e-20
Q8R127 429 Saccharopine dehydrogenas yes N/A 0.811 0.261 0.410 3e-20
Q8NBX0 429 Saccharopine dehydrogenas yes N/A 0.746 0.240 0.385 3e-20
Q5R5C9 429 Saccharopine dehydrogenas yes N/A 0.746 0.240 0.377 2e-19
Q8LGI2 454 Probable mitochondrial sa yes N/A 0.630 0.191 0.402 1e-16
Q7D745 419 Putative trans-acting eno yes N/A 0.659 0.217 0.364 2e-12
O53176 419 Putative trans-acting eno yes N/A 0.659 0.217 0.364 2e-12
P95139 418 Trans-acting enoyl reduct yes N/A 0.644 0.212 0.366 4e-10
A5U6W1 418 Trans-acting enoyl reduct no N/A 0.644 0.212 0.366 4e-10
>sp|Q3T067|SCPDL_BOVIN Saccharopine dehydrogenase-like oxidoreductase OS=Bos taurus GN=SCCPDH PE=2 SV=1 Back     alignment and function desciption
 Score = 97.4 bits (241), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 66/97 (68%)

Query: 36  VVNTINESSILIMAKKCRVILNCVGPYTWYGEAVVKACIEAKTHHVDITGEPYFMEYMQY 95
           + +  N +S+  MAK+  V+LNCVGPY +YGE V+KACIE  T  +DI+GEP F+E M +
Sbjct: 76  ICDITNPASLDEMAKQATVVLNCVGPYRFYGEPVIKACIENGTSCIDISGEPQFLELMYW 135

Query: 96  EYNTRAQESEVCVVSACGIETLPIDMGVLMLQDSFEG 132
           +Y+ +A E  V ++ + G +++P D+GV+  ++   G
Sbjct: 136 KYHEKAAEKGVYIIGSSGFDSIPADLGVIYTRNKMNG 172





Bos taurus (taxid: 9913)
EC: 1EC: .EC: -EC: .EC: -EC: .EC: -
>sp|Q6AY30|SCPDL_RAT Saccharopine dehydrogenase-like oxidoreductase OS=Rattus norvegicus GN=Sccpdh PE=2 SV=1 Back     alignment and function description
>sp|Q8R127|SCPDL_MOUSE Saccharopine dehydrogenase-like oxidoreductase OS=Mus musculus GN=Sccpdh PE=2 SV=1 Back     alignment and function description
>sp|Q8NBX0|SCPDL_HUMAN Saccharopine dehydrogenase-like oxidoreductase OS=Homo sapiens GN=SCCPDH PE=1 SV=1 Back     alignment and function description
>sp|Q5R5C9|SCPDL_PONAB Saccharopine dehydrogenase-like oxidoreductase OS=Pongo abelii GN=SCCPDH PE=2 SV=1 Back     alignment and function description
>sp|Q8LGI2|SCPDL_ARATH Probable mitochondrial saccharopine dehydrogenase-like oxidoreductase At5g39410 OS=Arabidopsis thaliana GN=At5g39410 PE=1 SV=2 Back     alignment and function description
>sp|Q7D745|Y2525_MYCTU Putative trans-acting enoyl reductase MT2525 OS=Mycobacterium tuberculosis GN=MT2525 PE=3 SV=2 Back     alignment and function description
>sp|O53176|Y2449_MYCTU Putative trans-acting enoyl reductase Rv2449c OS=Mycobacterium tuberculosis GN=Rv2449c PE=1 SV=3 Back     alignment and function description
>sp|P95139|TAER_MYCTU Trans-acting enoyl reductase OS=Mycobacterium tuberculosis GN=Rv2953 PE=1 SV=1 Back     alignment and function description
>sp|A5U6W1|TAER_MYCTA Trans-acting enoyl reductase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=MRA_2980 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query138
195451958 430 GK13975 [Drosophila willistoni] gi|19416 0.702 0.225 0.556 1e-28
195453709 434 GK14366 [Drosophila willistoni] gi|19416 0.702 0.223 0.546 2e-28
198450546 612 GA18705 [Drosophila pseudoobscura pseudo 0.702 0.158 0.536 6e-28
195055899 431 GH13859 [Drosophila grimshawi] gi|193892 0.702 0.225 0.536 1e-27
289739645 427 putative saccharopine dehydrogenase [Glo 0.702 0.227 0.536 1e-27
242018071 427 conserved hypothetical protein [Pediculu 0.724 0.234 0.554 2e-27
194742644 433 GF17952 [Drosophila ananassae] gi|190626 0.702 0.224 0.536 3e-27
158290701 430 AGAP002652-PA [Anopheles gambiae str. PE 0.666 0.213 0.565 7e-27
195144434 430 GL24001 [Drosophila persimilis] gi|19410 0.702 0.225 0.525 1e-26
125775564 430 GA15398 [Drosophila pseudoobscura pseudo 0.666 0.213 0.554 1e-26
>gi|195451958|ref|XP_002073150.1| GK13975 [Drosophila willistoni] gi|194169235|gb|EDW84136.1| GK13975 [Drosophila willistoni] Back     alignment and taxonomy information
 Score =  130 bits (328), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 54/97 (55%), Positives = 76/97 (78%)

Query: 36  VVNTINESSILIMAKKCRVILNCVGPYTWYGEAVVKACIEAKTHHVDITGEPYFMEYMQY 95
           + +  NESS+L MAK+CR+++N  GPY +YGE VVKACIEA THHVD++GEP +ME MQ 
Sbjct: 66  IADVNNESSLLEMAKRCRIVVNTAGPYRFYGEKVVKACIEAGTHHVDVSGEPQYMETMQL 125

Query: 96  EYNTRAQESEVCVVSACGIETLPIDMGVLMLQDSFEG 132
           +YN +A+E  V V+SACG +++P DMGV  ++ +F+G
Sbjct: 126 KYNYKAKEKGVYVISACGFDSIPADMGVQFIEKNFDG 162




Source: Drosophila willistoni

Species: Drosophila willistoni

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|195453709|ref|XP_002073906.1| GK14366 [Drosophila willistoni] gi|194169991|gb|EDW84892.1| GK14366 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|198450546|ref|XP_001358029.2| GA18705 [Drosophila pseudoobscura pseudoobscura] gi|198131084|gb|EAL27166.2| GA18705 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|195055899|ref|XP_001994850.1| GH13859 [Drosophila grimshawi] gi|193892613|gb|EDV91479.1| GH13859 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|289739645|gb|ADD18570.1| putative saccharopine dehydrogenase [Glossina morsitans morsitans] Back     alignment and taxonomy information
>gi|242018071|ref|XP_002429505.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212514447|gb|EEB16767.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|194742644|ref|XP_001953811.1| GF17952 [Drosophila ananassae] gi|190626848|gb|EDV42372.1| GF17952 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|158290701|ref|XP_312273.4| AGAP002652-PA [Anopheles gambiae str. PEST] gi|347968293|ref|XP_003436201.1| AGAP002652-PB [Anopheles gambiae str. PEST] gi|157018022|gb|EAA08164.4| AGAP002652-PA [Anopheles gambiae str. PEST] gi|333468072|gb|EGK96812.1| AGAP002652-PB [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|195144434|ref|XP_002013201.1| GL24001 [Drosophila persimilis] gi|194102144|gb|EDW24187.1| GL24001 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|125775564|ref|XP_001358985.1| GA15398 [Drosophila pseudoobscura pseudoobscura] gi|54638726|gb|EAL28128.1| GA15398 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query138
FB|FBgn0038038 431 CG5167 [Drosophila melanogaste 0.666 0.213 0.543 1.2e-25
FB|FBgn0037298 430 CG2604 [Drosophila melanogaste 0.666 0.213 0.532 6e-25
UNIPROTKB|Q5ZMK3 434 SCCPDH "Uncharacterized protei 0.652 0.207 0.5 2.4e-21
ZFIN|ZDB-GENE-041010-211 429 sccpdhb "saccharopine dehydrog 0.644 0.207 0.483 2.9e-21
ZFIN|ZDB-GENE-080212-12 466 zgc:174379 "zgc:174379" [Danio 0.666 0.197 0.434 6.9e-20
ZFIN|ZDB-GENE-040718-51 466 sccpdha "saccharopine dehydrog 0.666 0.197 0.434 1.1e-19
WB|WBGene00017719 426 F22F7.1 [Caenorhabditis elegan 0.666 0.215 0.5 1.4e-19
UNIPROTKB|F1MX05 429 SCCPDH "Saccharopine dehydroge 0.666 0.214 0.445 5.1e-19
UNIPROTKB|Q3T067 429 SCCPDH "Saccharopine dehydroge 0.666 0.214 0.445 5.1e-19
RGD|1311440 429 Sccpdh "saccharopine dehydroge 0.666 0.214 0.467 5.1e-19
FB|FBgn0038038 CG5167 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 291 (107.5 bits), Expect = 1.2e-25, P = 1.2e-25
 Identities = 50/92 (54%), Positives = 72/92 (78%)

Query:    41 NESSILIMAKKCRVILNCVGPYTWYGEAVVKACIEAKTHHVDITGEPYFMEYMQYEYNTR 100
             NE+S+L MAK+CR+++N  GPY ++GE VV+ACIEA THHVD++GEP +ME MQ  Y+  
Sbjct:    71 NEASLLEMAKRCRILVNTAGPYRFFGERVVRACIEAGTHHVDVSGEPQYMETMQLRYHDL 130

Query:   101 AQESEVCVVSACGIETLPIDMGVLMLQDSFEG 132
             A+E  V V+SACG +++P DMGV  ++ +F+G
Sbjct:   131 AKERGVYVISACGFDSIPADMGVTFVEKNFDG 162




GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
GO:0005811 "lipid particle" evidence=IDA
FB|FBgn0037298 CG2604 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZMK3 SCCPDH "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041010-211 sccpdhb "saccharopine dehydrogenase b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-080212-12 zgc:174379 "zgc:174379" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040718-51 sccpdha "saccharopine dehydrogenase a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
WB|WBGene00017719 F22F7.1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|F1MX05 SCCPDH "Saccharopine dehydrogenase-like oxidoreductase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q3T067 SCCPDH "Saccharopine dehydrogenase-like oxidoreductase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|1311440 Sccpdh "saccharopine dehydrogenase (putative)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query138
COG3268 382 COG3268, COG3268, Uncharacterized conserved protei 1e-25
pfam03435 380 pfam03435, Saccharop_dh, Saccharopine dehydrogenas 8e-10
COG1748 389 COG1748, LYS9, Saccharopine dehydrogenase and rela 3e-05
>gnl|CDD|225807 COG3268, COG3268, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
 Score = 99.1 bits (247), Expect = 1e-25
 Identities = 35/92 (38%), Positives = 53/92 (57%)

Query: 39  TINESSILIMAKKCRVILNCVGPYTWYGEAVVKACIEAKTHHVDITGEPYFMEYMQYEYN 98
               +++  MA + +V+LNCVGPYT YGE +V AC  A T + DITGE  F E     Y+
Sbjct: 59  LGVPAALEAMASRTQVVLNCVGPYTRYGEPLVAACAAAGTDYADITGEIMFFENSIDLYH 118

Query: 99  TRAQESEVCVVSACGIETLPIDMGVLMLQDSF 130
            +A ++   ++  CG +++P D+GV  L    
Sbjct: 119 AQAADAGARIIPGCGFDSIPSDLGVYALLKQA 150


Length = 382

>gnl|CDD|217556 pfam03435, Saccharop_dh, Saccharopine dehydrogenase Back     alignment and domain information
>gnl|CDD|224662 COG1748, LYS9, Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 138
KOG2733|consensus 423 99.97
COG3268 382 Uncharacterized conserved protein [Function unknow 99.95
PF03435 386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 99.87
COG1748 389 LYS9 Saccharopine dehydrogenase and related protei 99.82
PLN02819 1042 lysine-ketoglutarate reductase/saccharopine dehydr 99.48
KOG0172|consensus 445 98.61
PRK00048 257 dihydrodipicolinate reductase; Provisional 97.49
TIGR01921 324 DAP-DH diaminopimelate dehydrogenase. This model r 97.07
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 97.01
PF01073 280 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso 96.81
PRK13304 265 L-aspartate dehydrogenase; Reviewed 96.48
CHL00194 317 ycf39 Ycf39; Provisional 96.39
TIGR00036 266 dapB dihydrodipicolinate reductase. 96.26
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 96.14
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 95.99
PRK12548289 shikimate 5-dehydrogenase; Provisional 95.82
PF03447117 NAD_binding_3: Homoserine dehydrogenase, NAD bindi 95.79
TIGR00715 256 precor6x_red precorrin-6x reductase. This enzyme w 95.67
PLN02214 342 cinnamoyl-CoA reductase 95.66
KOG1502|consensus 327 95.48
PLN02657 390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 95.21
PRK13303 265 L-aspartate dehydrogenase; Provisional 95.12
PRK13302 271 putative L-aspartate dehydrogenase; Provisional 95.06
TIGR03855 229 NAD_NadX aspartate dehydrogenase. Members of this 94.99
TIGR01181 317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 94.92
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 94.45
PLN02427 386 UDP-apiose/xylose synthase 94.33
COG1091 281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo 94.22
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 94.12
TIGR03466 328 HpnA hopanoid-associated sugar epimerase. The sequ 93.54
TIGR03589 324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 93.53
KOG2865|consensus 391 93.52
PLN03209 576 translocon at the inner envelope of chloroplast su 93.36
PRK12549284 shikimate 5-dehydrogenase; Reviewed 93.34
TIGR03649 285 ergot_EASG ergot alkaloid biosynthesis protein, AF 93.27
PRK15181 348 Vi polysaccharide biosynthesis protein TviC; Provi 92.9
PLN02986 322 cinnamyl-alcohol dehydrogenase family protein 92.62
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 92.48
COG2910211 Putative NADH-flavin reductase [General function p 92.3
PRK08306296 dipicolinate synthase subunit A; Reviewed 92.3
TIGR01179 328 galE UDP-glucose-4-epimerase. This enzyme intercon 92.23
cd01483143 E1_enzyme_family Superfamily of activating enzymes 91.96
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 91.93
PLN02695 370 GDP-D-mannose-3',5'-epimerase 91.92
PRK09987 299 dTDP-4-dehydrorhamnose reductase; Provisional 91.77
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 91.57
PLN02989 325 cinnamyl-alcohol dehydrogenase family protein 91.56
TIGR01214 287 rmlD dTDP-4-dehydrorhamnose reductase. This enzyme 91.53
PRK11908 347 NAD-dependent epimerase/dehydratase family protein 91.52
PLN02662 322 cinnamyl-alcohol dehydrogenase family protein 91.4
PF01370236 Epimerase: NAD dependent epimerase/dehydratase fam 91.37
PRK06182 273 short chain dehydrogenase; Validated 91.07
PRK06179 270 short chain dehydrogenase; Provisional 91.07
PRK14027283 quinate/shikimate dehydrogenase; Provisional 91.07
PRK13301 267 putative L-aspartate dehydrogenase; Provisional 90.99
PLN00198 338 anthocyanidin reductase; Provisional 90.85
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 90.83
PLN02240 352 UDP-glucose 4-epimerase 90.74
PRK06270 341 homoserine dehydrogenase; Provisional 90.42
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 90.39
PRK08057248 cobalt-precorrin-6x reductase; Reviewed 90.22
PRK08374 336 homoserine dehydrogenase; Provisional 90.08
KOG1205|consensus 282 89.97
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 89.82
COG0036220 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate 89.65
PF07994295 NAD_binding_5: Myo-inositol-1-phosphate synthase; 89.6
PRK07326237 short chain dehydrogenase; Provisional 89.6
TIGR03450 351 mycothiol_INO1 inositol 1-phosphate synthase, Acti 89.49
PRK09186256 flagellin modification protein A; Provisional 89.16
PLN02725 306 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductas 89.13
TIGR01182204 eda Entner-Doudoroff aldolase. 2-deydro-3-deoxypho 89.08
PRK10217 355 dTDP-glucose 4,6-dehydratase; Provisional 88.99
PRK06349 426 homoserine dehydrogenase; Provisional 88.97
PF02571249 CbiJ: Precorrin-6x reductase CbiJ/CobK; InterPro: 88.75
PLN02686 367 cinnamoyl-CoA reductase 88.43
PF04321 286 RmlD_sub_bind: RmlD substrate binding domain; Inte 88.37
PLN02253280 xanthoxin dehydrogenase 88.16
COG1712 255 Predicted dinucleotide-utilizing enzyme [General f 87.92
PRK06552213 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 87.87
PRK09134258 short chain dehydrogenase; Provisional 87.8
PRK05865 854 hypothetical protein; Provisional 87.77
COG2099257 CobK Precorrin-6x reductase [Coenzyme metabolism] 87.68
PF01408120 GFO_IDH_MocA: Oxidoreductase family, NAD-binding R 87.67
PLN00016 378 RNA-binding protein; Provisional 87.55
PRK05884223 short chain dehydrogenase; Provisional 87.4
PRK07856252 short chain dehydrogenase; Provisional 87.38
PRK09291257 short chain dehydrogenase; Provisional 87.38
TIGR01472 343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 87.33
PRK08267260 short chain dehydrogenase; Provisional 87.23
COG0002 349 ArgC Acetylglutamate semialdehyde dehydrogenase [A 87.23
PF00389133 2-Hacid_dh: D-isomer specific 2-hydroxyacid dehydr 87.15
PRK08125 660 bifunctional UDP-glucuronic acid decarboxylase/UDP 87.07
COG0300265 DltE Short-chain dehydrogenases of various substra 87.01
PLN02650 351 dihydroflavonol-4-reductase 86.96
PRK08219227 short chain dehydrogenase; Provisional 86.94
PRK09009235 C factor cell-cell signaling protein; Provisional 86.9
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 86.9
PRK06138252 short chain dehydrogenase; Provisional 86.89
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 86.84
PRK08220252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 86.81
PRK05867253 short chain dehydrogenase; Provisional 86.81
PRK06463255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 86.76
PRK07453 322 protochlorophyllide oxidoreductase; Validated 86.68
PRK00436 343 argC N-acetyl-gamma-glutamyl-phosphate reductase; 86.68
PRK04207 341 glyceraldehyde-3-phosphate dehydrogenase; Provisio 86.67
PRK08643256 acetoin reductase; Validated 86.56
PRK10084 352 dTDP-glucose 4,6 dehydratase; Provisional 86.47
PRK11579 346 putative oxidoreductase; Provisional 86.44
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 86.39
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 86.38
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 86.36
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 86.27
PRK06482 276 short chain dehydrogenase; Provisional 86.2
PRK10675 338 UDP-galactose-4-epimerase; Provisional 86.06
PRK05866293 short chain dehydrogenase; Provisional 86.0
PLN02260 668 probable rhamnose biosynthetic enzyme 85.94
PRK12935247 acetoacetyl-CoA reductase; Provisional 85.92
PRK06180 277 short chain dehydrogenase; Provisional 85.82
PLN02896 353 cinnamyl-alcohol dehydrogenase 85.82
PRK06123248 short chain dehydrogenase; Provisional 85.8
TIGR02197 314 heptose_epim ADP-L-glycero-D-manno-heptose-6-epime 85.74
PRK07024257 short chain dehydrogenase; Provisional 85.63
PRK07454241 short chain dehydrogenase; Provisional 85.58
PLN02583 297 cinnamoyl-CoA reductase 85.52
PRK12746254 short chain dehydrogenase; Provisional 85.47
PRK06015201 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 85.43
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 85.36
PRK10206 344 putative oxidoreductase; Provisional 85.2
PLN02653 340 GDP-mannose 4,6-dehydratase 85.03
PRK14851 679 hypothetical protein; Provisional 85.03
PRK06114254 short chain dehydrogenase; Provisional 85.03
PRK07890258 short chain dehydrogenase; Provisional 84.92
PRK06181263 short chain dehydrogenase; Provisional 84.92
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 84.91
PRK07063260 short chain dehydrogenase; Provisional 84.9
PRK12937245 short chain dehydrogenase; Provisional 84.9
PRK05876 275 short chain dehydrogenase; Provisional 84.8
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 84.75
PRK09135249 pteridine reductase; Provisional 84.7
PRK08223287 hypothetical protein; Validated 84.69
TIGR02130 275 dapB_plant dihydrodipicolinate reductase. This nar 84.68
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 84.65
TIGR02415254 23BDH acetoin reductases. One member of this famil 84.5
PRK06398258 aldose dehydrogenase; Validated 84.49
PRK12550272 shikimate 5-dehydrogenase; Reviewed 84.42
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 84.36
PRK08265261 short chain dehydrogenase; Provisional 84.31
PRK07677252 short chain dehydrogenase; Provisional 84.29
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 84.29
PRK12475 338 thiamine/molybdopterin biosynthesis MoeB-like prot 84.27
PRK06947248 glucose-1-dehydrogenase; Provisional 84.27
PRK09997258 hydroxypyruvate isomerase; Provisional 84.18
PRK05597 355 molybdopterin biosynthesis protein MoeB; Validated 84.17
PRK07688 339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 83.98
PRK07370258 enoyl-(acyl carrier protein) reductase; Validated 83.97
PRK12939250 short chain dehydrogenase; Provisional 83.9
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 83.89
PRK12825249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 83.78
PRK12320 699 hypothetical protein; Provisional 83.74
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisiona 83.61
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 83.56
PRK06172253 short chain dehydrogenase; Provisional 83.48
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 83.48
PRK07877 722 hypothetical protein; Provisional 83.48
TIGR01850 346 argC N-acetyl-gamma-glutamyl-phosphate reductase, 83.46
PRK06392 326 homoserine dehydrogenase; Provisional 83.45
PRK12744257 short chain dehydrogenase; Provisional 83.44
PRK12367245 short chain dehydrogenase; Provisional 83.34
PRK07814263 short chain dehydrogenase; Provisional 83.33
TIGR00872 298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 83.18
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 83.18
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 83.15
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisiona 83.14
PRK12829264 short chain dehydrogenase; Provisional 83.04
PRK05650 270 short chain dehydrogenase; Provisional 82.95
PTZ00325 321 malate dehydrogenase; Provisional 82.95
PRK10538248 malonic semialdehyde reductase; Provisional 82.82
PRK12428 241 3-alpha-hydroxysteroid dehydrogenase; Provisional 82.78
PRK07062265 short chain dehydrogenase; Provisional 82.75
PF01081196 Aldolase: KDPG and KHG aldolase; InterPro: IPR0008 82.73
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 82.73
PRK08628258 short chain dehydrogenase; Provisional 82.67
PRK06194 287 hypothetical protein; Provisional 82.56
PRK12745256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 82.51
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 82.49
PF00809210 Pterin_bind: Pterin binding enzyme This Prosite en 82.49
PRK08340259 glucose-1-dehydrogenase; Provisional 82.46
PRK07774250 short chain dehydrogenase; Provisional 82.43
COG0673 342 MviM Predicted dehydrogenases and related proteins 82.39
PRK12827249 short chain dehydrogenase; Provisional 82.39
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 82.32
PRK07478254 short chain dehydrogenase; Provisional 82.2
cd03315265 MLE_like Muconate lactonizing enzyme (MLE) like su 82.18
PRK05875 276 short chain dehydrogenase; Provisional 82.12
PRK08277 278 D-mannonate oxidoreductase; Provisional 81.96
PRK07577234 short chain dehydrogenase; Provisional 81.95
PRK07576264 short chain dehydrogenase; Provisional 81.85
PRK07806248 short chain dehydrogenase; Provisional 81.64
PRK08264238 short chain dehydrogenase; Validated 81.63
PRK07411 390 hypothetical protein; Validated 81.62
PRK08263 275 short chain dehydrogenase; Provisional 81.55
PRK07074257 short chain dehydrogenase; Provisional 81.53
PRK08328231 hypothetical protein; Provisional 81.4
PRK06196 315 oxidoreductase; Provisional 81.36
PRK06171 266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 81.36
PRK06940 275 short chain dehydrogenase; Provisional 81.34
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 81.26
PRK05693 274 short chain dehydrogenase; Provisional 81.21
PRK05854 313 short chain dehydrogenase; Provisional 81.16
PRK06841255 short chain dehydrogenase; Provisional 81.0
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 80.97
PRK07201 657 short chain dehydrogenase; Provisional 80.93
PRK09989258 hypothetical protein; Provisional 80.81
PRK08339263 short chain dehydrogenase; Provisional 80.79
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 80.79
KOG1200|consensus256 80.79
PRK06197 306 short chain dehydrogenase; Provisional 80.78
PRK05717255 oxidoreductase; Validated 80.71
PRK08278273 short chain dehydrogenase; Provisional 80.68
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 80.66
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 80.54
PRK05993 277 short chain dehydrogenase; Provisional 80.48
PRK07825 273 short chain dehydrogenase; Provisional 80.35
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 80.35
PRK08589 272 short chain dehydrogenase; Validated 80.28
PRK08642253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 80.19
PRK06139 330 short chain dehydrogenase; Provisional 80.19
PRK07832 272 short chain dehydrogenase; Provisional 80.17
PRK07904253 short chain dehydrogenase; Provisional 80.15
PRK07523255 gluconate 5-dehydrogenase; Provisional 80.11
COG0460 333 ThrA Homoserine dehydrogenase [Amino acid transpor 80.08
>KOG2733|consensus Back     alignment and domain information
Probab=99.97  E-value=3.6e-32  Score=225.19  Aligned_cols=119  Identities=47%  Similarity=0.803  Sum_probs=107.2

Q ss_pred             HHHHHHhhhhcC---CCCcceEEeeCCCHHHHHHHHhcCcEEEecCCCccchhHHHHHHHHHcCCCeeeCCCChHHHHHH
Q psy12849         17 IFLFLQKASWFG---VRTNRTTVVNTINESSILIMAKKCRVILNCVGPYTWYGEAVVKACIEAKTHHVDITGEPYFMEYM   93 (138)
Q Consensus        17 ~~~~~~~a~~~~---~~~~~~~~~D~~d~~~L~~~~~~~dvVIn~~GPf~~~~~~v~~Aci~~g~hYvDisge~~~~~~~   93 (138)
                      +-.-|+|+.+..   .++..++.+|..|+++|.++++++.|||||+|||..+|++|++||+++|+||||++|||.|++.|
T Consensus        46 L~~vL~~~~~k~~~~ls~~~i~i~D~~n~~Sl~emak~~~vivN~vGPyR~hGE~VVkacienG~~~vDISGEP~f~E~m  125 (423)
T KOG2733|consen   46 LQEVLEKVGEKTGTDLSSSVILIADSANEASLDEMAKQARVIVNCVGPYRFHGEPVVKACIENGTHHVDISGEPQFMERM  125 (423)
T ss_pred             HHHHHHHHhhccCCCcccceEEEecCCCHHHHHHHHhhhEEEEeccccceecCcHHHHHHHHcCCceeccCCCHHHHHHH
Confidence            333444444432   24445999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhHHHHHhCCCEEEeCCCCccchHhHHHHHHHHHhhhhcC
Q psy12849         94 QYEYNTRAQESEVCVVSACGIETLPIDMGVLMLQDSFEGHSG  135 (138)
Q Consensus        94 ~~~~~~~A~~~gv~iv~~~G~d~~p~dl~~~~~~~~~~~~~~  135 (138)
                      +.+||++|+++|+.||.+|||||.|.|+++.++.+.|.+.+|
T Consensus       126 q~kYhd~A~ekGVYIVsaCGfDSIPaDlGv~f~~k~fdg~ln  167 (423)
T KOG2733|consen  126 QLKYHDLAKEKGVYIVSACGFDSIPADLGVMFLRKNFDGVLN  167 (423)
T ss_pred             HHHHHHHHHhcCeEEEeecccCCCCccceeeeehhhccccHH
Confidence            999999999999999999999999999999999999998765



>COG3268 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>KOG0172|consensus Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>TIGR01921 DAP-DH diaminopimelate dehydrogenase Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>TIGR00036 dapB dihydrodipicolinate reductase Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PF03447 NAD_binding_3: Homoserine dehydrogenase, NAD binding domain; InterPro: IPR005106 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway Back     alignment and domain information
>TIGR00715 precor6x_red precorrin-6x reductase Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>KOG1502|consensus Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>PRK13303 L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03855 NAD_NadX aspartate dehydrogenase Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>KOG2865|consensus Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>TIGR01179 galE UDP-glucose-4-epimerase Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>PRK13301 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PRK06270 homoserine dehydrogenase; Provisional Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PRK08057 cobalt-precorrin-6x reductase; Reviewed Back     alignment and domain information
>PRK08374 homoserine dehydrogenase; Provisional Back     alignment and domain information
>KOG1205|consensus Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>COG0036 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF07994 NAD_binding_5: Myo-inositol-1-phosphate synthase; InterPro: IPR002587 1L-myo-Inositol-1-phosphate synthase (5 Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03450 mycothiol_INO1 inositol 1-phosphate synthase, Actinobacterial type Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PLN02725 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase Back     alignment and domain information
>TIGR01182 eda Entner-Doudoroff aldolase Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>PRK06349 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PF02571 CbiJ: Precorrin-6x reductase CbiJ/CobK; InterPro: IPR003723 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] Back     alignment and domain information
>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05865 hypothetical protein; Provisional Back     alignment and domain information
>COG2099 CobK Precorrin-6x reductase [Coenzyme metabolism] Back     alignment and domain information
>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0002 ArgC Acetylglutamate semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PF00389 2-Hacid_dh: D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain; InterPro: IPR006139 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09009 C factor cell-cell signaling protein; Provisional Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated Back     alignment and domain information
>PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>PRK11579 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PRK06123 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK10206 putative oxidoreductase; Provisional Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PRK14851 hypothetical protein; Provisional Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>TIGR02130 dapB_plant dihydrodipicolinate reductase Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK09997 hydroxypyruvate isomerase; Provisional Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12320 hypothetical protein; Provisional Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PRK07877 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form Back     alignment and domain information
>PRK06392 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PRK12428 3-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF01081 Aldolase: KDPG and KHG aldolase; InterPro: IPR000887 4-Hydroxy-2-oxoglutarate aldolase (4 Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PF00809 Pterin_bind: Pterin binding enzyme This Prosite entry is a subset of the Pfam family; InterPro: IPR000489 The ~250-residue pterin-binding domain has been shown to adopt a (beta/alpha)8 barrel fold, which has the overall shape of a distorted cylinder Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only] Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd03315 MLE_like Muconate lactonizing enzyme (MLE) like subgroup of the enolase superfamily Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07411 hypothetical protein; Validated Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09989 hypothetical protein; Provisional Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>KOG1200|consensus Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>COG0460 ThrA Homoserine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query138
2z2v_A 365 Hypothetical protein PH1688; L-lysine dehydrogenas 9e-07
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 1e-06
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Length = 118 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query138
3abi_A 365 Putative uncharacterized protein PH1688; L-lysine 99.84
2z2v_A 365 Hypothetical protein PH1688; L-lysine dehydrogenas 99.63
4ina_A 405 Saccharopine dehydrogenase; structural genomics, P 99.56
2ph5_A 480 Homospermidine synthase; alpha-beta protein, struc 99.28
2axq_A 467 Saccharopine dehydrogenase; rossmann fold variant, 99.2
1ff9_A 450 Saccharopine reductase; lysine biosynthesis, alpha 99.11
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 98.96
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 97.17
3c1o_A 321 Eugenol synthase; phenylpropene, PIP reductase, sh 97.16
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 97.15
3e48_A 289 Putative nucleoside-diphosphate-sugar epimerase; a 97.08
2gas_A 307 Isoflavone reductase; NADPH-dependent reductase, o 97.08
1qyd_A 313 Pinoresinol-lariciresinol reductase; NADPH-depende 97.07
1qyc_A 308 Phenylcoumaran benzylic ether reductase PT1; NADPH 97.05
2r6j_A 318 Eugenol synthase 1; phenylpropene, PIP reductase, 97.03
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 96.9
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 96.85
2jl1_A 287 Triphenylmethane reductase; oxidoreductase, biorem 96.78
3i6i_A 346 Putative leucoanthocyanidin reductase 1; rossmann 96.73
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 96.69
3bio_A 304 Oxidoreductase, GFO/IDH/MOCA family; structural ge 96.68
1oc2_A 348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 96.67
2wm3_A 299 NMRA-like family domain containing protein 1; unkn 96.63
2zcu_A 286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 96.52
2dc1_A 236 L-aspartate dehydrogenase; NAD, oxidoreductase; HE 96.5
4id9_A 347 Short-chain dehydrogenase/reductase; putative dehy 96.28
4egb_A 346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 96.26
1xq6_A253 Unknown protein; structural genomics, protein stru 96.2
3ruf_A 351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 96.19
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 96.18
2x4g_A 342 Nucleoside-diphosphate-sugar epimerase; isomerase; 96.16
3slg_A 372 PBGP3 protein; structural genomics, seattle struct 96.15
2c5a_A 379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 96.12
1r6d_A 337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 96.1
1f06_A 320 MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH 96.07
4f3y_A 272 DHPR, dihydrodipicolinate reductase; structural ge 96.02
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 95.98
2yy7_A 312 L-threonine dehydrogenase; thermolabIle, flavobact 95.96
2q1w_A 333 Putative nucleotide sugar epimerase/ dehydratase; 95.94
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 95.9
3ijp_A 288 DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, 95.89
1sb8_A 352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 95.88
1xgk_A 352 Nitrogen metabolite repression regulator NMRA; ros 95.86
3rft_A 267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 95.81
2pzm_A 330 Putative nucleotide sugar epimerase/ dehydratase; 95.69
3sxp_A 362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 95.69
2gn4_A 344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 95.68
1p9l_A 245 Dihydrodipicolinate reductase; oxidoreductase, lys 95.68
3ay3_A 267 NAD-dependent epimerase/dehydratase; glucuronic ac 95.66
2hun_A 336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 95.62
3ajr_A 317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 95.61
3m2p_A 311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 95.61
2ggs_A 273 273AA long hypothetical DTDP-4-dehydrorhamnose red 95.56
1dih_A 273 Dihydrodipicolinate reductase; oxidoreductase; HET 95.55
1orr_A 347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 95.52
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 95.43
2c20_A 330 UDP-glucose 4-epimerase; carbohydrate metabolism, 95.23
1ek6_A 348 UDP-galactose 4-epimerase; short-chain dehydrogena 95.13
1gy8_A 397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 95.1
1kew_A 361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 95.09
3sc6_A 287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 95.04
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 94.98
2v6g_A 364 Progesterone 5-beta-reductase; tyrosine-dependent 94.94
2q1s_A 377 Putative nucleotide sugar epimerase/ dehydratase; 94.92
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 94.8
1n2s_A 299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 94.79
2z1m_A 345 GDP-D-mannose dehydratase; short-chain dehydrogena 94.78
1vl0_A 292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 94.77
1j5p_A 253 Aspartate dehydrogenase; TM1643, structural genomi 94.73
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 94.71
4b8w_A 319 GDP-L-fucose synthase; oxidoreductase; HET: NAP GD 94.7
2c29_D 337 Dihydroflavonol 4-reductase; flavonoids, short deh 94.68
1i24_A 404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 94.61
2ydy_A 315 Methionine adenosyltransferase 2 subunit beta; oxi 94.49
1rpn_A 335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 94.48
3c8m_A 331 Homoserine dehydrogenase; structural genomics, APC 94.47
3enk_A 341 UDP-glucose 4-epimerase; seattle structural genomi 94.47
2bll_A 345 Protein YFBG; decarboxylase, short chain dehydroge 94.45
3gpi_A 286 NAD-dependent epimerase/dehydratase; structural ge 94.4
1e6u_A 321 GDP-fucose synthetase; epimerase/reductase, SDR, R 94.35
1t2a_A 375 GDP-mannose 4,6 dehydratase; structural genomics c 94.18
2p5y_A 311 UDP-glucose 4-epimerase; TTHA0591, structural geno 94.09
2pk3_A 321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 93.88
3upl_A 446 Oxidoreductase; rossmann fold, NADPH binding; 1.50 93.85
1n7h_A 381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 93.75
1udb_A 338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 93.63
3st7_A 369 Capsular polysaccharide synthesis enzyme CAP5F; ro 93.58
1rkx_A 357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 93.5
1npy_A271 Hypothetical shikimate 5-dehydrogenase-like protei 93.42
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 93.34
2nu8_A 288 Succinyl-COA ligase [ADP-forming] subunit alpha; c 93.31
1eq2_A 310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 93.13
2ho3_A 325 Oxidoreductase, GFO/IDH/MOCA family; streptococcus 93.05
1z45_A 699 GAL10 bifunctional protein; epimerase, mutarotase, 93.02
1db3_A 372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 92.98
3e9m_A 330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, 92.89
3u9l_A 324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 92.89
3imf_A257 Short chain dehydrogenase; structural genomics, in 92.85
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 92.83
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 92.66
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 92.64
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 92.55
2yv1_A 294 Succinyl-COA ligase [ADP-forming] subunit alpha; C 92.53
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 92.51
4hkt_A 331 Inositol 2-dehydrogenase; structural genomics, nys 92.47
2rh8_A 338 Anthocyanidin reductase; flavonoids, rossmann fold 92.46
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 92.42
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 92.39
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 92.38
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 92.35
2p4h_X 322 Vestitone reductase; NADPH-dependent reductase, is 92.3
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 92.24
1y1p_A 342 ARII, aldehyde reductase II; rossmann fold, short 92.19
2p2s_A 336 Putative oxidoreductase; YP_050235.1, structural g 92.13
3e82_A 364 Putative oxidoreductase; NAD, GFO/IDH/MOCA family, 92.12
3euw_A 344 MYO-inositol dehydrogenase; protein structure init 92.11
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 92.1
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 91.99
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 91.97
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 91.87
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 91.82
3o9z_A 312 Lipopolysaccaride biosynthesis protein WBPB; oxido 91.81
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 91.79
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 91.79
1wma_A 276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 91.68
1tlt_A 319 Putative oxidoreductase (virulence factor MVIM HO; 91.68
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 91.67
3e18_A 359 Oxidoreductase; dehydrogenase, NAD-binding, struct 91.67
4dqv_A 478 Probable peptide synthetase NRP (peptide synthase; 91.65
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 91.6
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 91.58
3cea_A 346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 91.57
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 91.57
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 91.51
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 91.5
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 91.5
2x6t_A 357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 91.5
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 91.48
3evn_A 329 Oxidoreductase, GFO/IDH/MOCA family; structural ge 91.47
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 91.46
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 91.37
2glx_A 332 1,5-anhydro-D-fructose reductase; NADP(H) dependen 91.36
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 91.33
3c1a_A 315 Putative oxidoreductase; ZP_00056571.1, oxidoreduc 91.3
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 91.27
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 91.27
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 91.24
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 91.24
3pxx_A 287 Carveol dehydrogenase; structural genomics, seattl 91.22
3tjr_A 301 Short chain dehydrogenase; structural genomics, se 91.21
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 91.18
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 91.14
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 91.1
2ixa_A 444 Alpha-N-acetylgalactosaminidase; NAD, A-ECO conver 91.06
3q2i_A 354 Dehydrogenase; rossmann fold, UDP-sugar binding, N 91.06
1spx_A 278 Short-chain reductase family member (5L265); paral 91.04
2yv2_A 297 Succinyl-COA synthetase alpha chain; COA-binding d 91.02
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 90.99
3e03_A274 Short chain dehydrogenase; structural genomics, PS 90.99
4dqx_A277 Probable oxidoreductase protein; structural genomi 90.96
3moi_A 387 Probable dehydrogenase; structural genomics, PSI2, 90.96
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 90.95
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 90.94
3cxt_A291 Dehydrogenase with different specificities; rossma 90.89
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 90.84
1yxm_A 303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 90.84
4e4y_A244 Short chain dehydrogenase family protein; structur 90.84
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 90.82
3uuw_A 308 Putative oxidoreductase with NAD(P)-binding rossm 90.82
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 90.79
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 90.78
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 90.78
2hrz_A 342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 90.76
3ehe_A 313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 90.76
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 90.67
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 90.67
3m1a_A 281 Putative dehydrogenase; short, PSI, MCSG, structur 90.63
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 90.59
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 90.59
3gdo_A 358 Uncharacterized oxidoreductase YVAA; structural ge 90.53
3rc1_A 350 Sugar 3-ketoreductase; sugar biosynthesis, TDP bin 90.5
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 90.49
2dtx_A 264 Glucose 1-dehydrogenase related protein; rossmann 90.49
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 90.48
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 90.46
1z7e_A 660 Protein aRNA; rossmann fold, OB-like fold, hydrola 90.46
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 90.45
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 90.42
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 90.39
3ioy_A 319 Short-chain dehydrogenase/reductase SDR; structura 90.37
3kux_A 352 Putative oxidoreductase; oxidoreductase family, cs 90.35
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 90.34
1nff_A260 Putative oxidoreductase RV2002; directed evolution 90.32
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 90.32
3ezy_A 344 Dehydrogenase; structural genomics, unknown functi 90.31
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 90.28
3db2_A 354 Putative NADPH-dependent oxidoreductase; two domai 90.27
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 90.27
3f4l_A 345 Putative oxidoreductase YHHX; structural genomics, 90.24
2h7i_A269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 90.23
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 90.18
3tl3_A257 Short-chain type dehydrogenase/reductase; ssgcid, 90.18
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 90.17
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 90.11
3nzo_A 399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 90.1
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 90.08
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 90.08
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 90.06
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 90.06
3fhl_A 362 Putative oxidoreductase; NAD-binding domain, PSI-2 90.05
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 90.04
3o26_A 311 Salutaridine reductase; short chain dehydrogenase/ 90.02
3i23_A 349 Oxidoreductase, GFO/IDH/MOCA family; structural ge 89.98
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 89.96
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 89.96
3rd5_A 291 Mypaa.01249.C; ssgcid, structural genomics, seattl 89.92
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 89.91
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 89.89
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 89.89
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 89.88
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 89.87
3svt_A 281 Short-chain type dehydrogenase/reductase; ssgcid, 89.84
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 89.83
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 89.81
3sc4_A 285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 89.78
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 89.74
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 89.71
1w6u_A 302 2,4-dienoyl-COA reductase, mitochondrial precursor 89.69
3qy9_A 243 DHPR, dihydrodipicolinate reductase; rossmann fold 89.69
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 89.68
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 89.64
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 89.61
3ing_A 325 Homoserine dehydrogenase; NP_394635.1, structural 89.61
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 89.6
4f6c_A 427 AUSA reductase domain protein; thioester reductase 89.58
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 89.58
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 89.56
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 89.55
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 89.52
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 89.51
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 89.51
3ohs_X 334 Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; d 89.49
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 89.48
4iiu_A267 3-oxoacyl-[acyl-carrier protein] reductase; struct 89.45
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 89.45
1xkq_A 280 Short-chain reductase family member (5D234); parra 89.42
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 89.4
3dty_A 398 Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetram 89.39
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 89.39
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 89.32
1oi7_A 288 Succinyl-COA synthetase alpha chain; SCS, ligase, 89.3
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 89.3
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 89.29
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 89.28
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 89.24
1ydw_A 362 AX110P-like protein; structural genomics, protein 89.23
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 89.22
3gdg_A267 Probable NADP-dependent mannitol dehydrogenase; ro 89.22
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 89.21
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 89.1
3rih_A293 Short chain dehydrogenase or reductase; structural 89.08
3grk_A293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 89.01
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 88.98
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 88.95
3oa2_A 318 WBPB; oxidoreductase, sugar biosynthesis, dehydrog 88.93
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 88.92
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 88.92
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 88.91
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 88.88
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 88.88
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 88.88
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 88.85
3ko8_A 312 NAD-dependent epimerase/dehydratase; isomerase, UD 88.82
3v5n_A 417 Oxidoreductase; structural genomics, PSI-biology, 88.79
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 88.78
1xea_A 323 Oxidoreductase, GFO/IDH/MOCA family; structural ge 88.77
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 88.77
3edm_A259 Short chain dehydrogenase; structural genomics, ox 88.74
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 88.67
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 88.63
3mz0_A 344 Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; 88.63
3tsc_A277 Putative oxidoreductase; structural genomics, seat 88.61
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 88.59
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 88.58
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 88.54
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 88.49
1xhl_A 297 Short-chain dehydrogenase/reductase family member 88.49
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 88.46
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 88.46
2p91_A285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 88.44
2wyu_A261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 88.43
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 88.41
3tox_A 280 Short chain dehydrogenase; structural genomics, PS 88.41
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 88.31
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 88.27
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 88.22
3ngf_A269 AP endonuclease, family 2; structural genomics, se 88.22
1jtv_A 327 17 beta-hydroxysteroid dehydrogenase type 1; stero 88.2
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 88.17
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 88.09
3gem_A260 Short chain dehydrogenase; structural genomics, AP 88.07
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 88.06
4f6l_B 508 AUSA reductase domain protein; thioester reductase 88.05
1yde_A 270 Retinal dehydrogenase/reductase 3; oxidoreductase, 88.03
3vtz_A 269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 87.97
4h3v_A 390 Oxidoreductase domain protein; structural genomics 87.93
3k31_A 296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 87.85
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 87.84
1lc0_A 294 Biliverdin reductase A; oxidoreductase, tetrapyrro 87.81
1cf2_P 337 Protein (glyceraldehyde-3-phosphate dehydrogenase) 87.75
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 87.72
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 87.7
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 87.54
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 87.51
3kvo_A 346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 87.49
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 87.45
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 87.43
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 87.38
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 87.3
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 87.29
3zv4_A 281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 87.26
1lss_A140 TRK system potassium uptake protein TRKA homolog; 87.24
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 87.22
1id1_A153 Putative potassium channel protein; RCK domain, E. 87.16
4fb5_A 393 Probable oxidoreductase protein; PSI-biology, nysg 87.16
1xq1_A266 Putative tropinone reducatse; structural genomics, 87.04
1zh8_A 340 Oxidoreductase; TM0312, structural genomics, JO ce 87.01
3ius_A 286 Uncharacterized conserved protein; APC63810, silic 87.0
3oqb_A 383 Oxidoreductase; structural genomics, protein struc 86.94
4gqa_A 412 NAD binding oxidoreductase; structural genomics, P 86.93
1r0k_A 388 1-deoxy-D-xylulose 5-phosphate reductoisomerase; N 86.77
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 86.71
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 86.66
3do5_A 327 HOM, homoserine dehydrogenase; NP_069768.1, putati 86.58
3ec7_A 357 Putative dehydrogenase; alpha-beta, structural gen 86.51
2pd4_A 275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 86.37
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 86.22
3qlj_A 322 Short chain dehydrogenase; structural genomics, se 86.16
1h6d_A 433 Precursor form of glucose-fructose oxidoreductase; 85.97
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 85.94
4b79_A242 PA4098, probable short-chain dehydrogenase; oxidor 85.91
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 85.86
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 85.68
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 85.58
1gr0_A 367 Inositol-3-phosphate synthase; isomerase, oxidored 85.55
4ew6_A 330 D-galactose-1-dehydrogenase protein; nysgrc, PSI-b 85.5
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 85.46
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 85.43
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 85.27
4eso_A255 Putative oxidoreductase; NADP, structural genomics 85.24
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 85.19
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 85.15
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 85.05
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 85.03
3obe_A 305 Sugar phosphate isomerase/epimerase; structural ge 84.82
3pef_A 287 6-phosphogluconate dehydrogenase, NAD-binding; gam 84.65
3dmy_A 480 Protein FDRA; predicted actyl-COA synthetase, nysg 84.49
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 84.43
1f6y_A 262 5-methyltetrahydrofolate corrinoid/iron sulfur PR 84.38
2z5l_A511 Tylkr1, tylactone synthase starter module and modu 84.19
2b69_A 343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 84.05
1b7g_O 340 Protein (glyceraldehyde 3-phosphate dehydrogenase; 83.86
1vjp_A 394 MYO-inositol-1-phosphate synthase-related protein; 83.8
2duw_A145 Putative COA-binding protein; ligand binding prote 83.63
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 83.5
1e7w_A291 Pteridine reductase; dihydrofolate reductase, shor 83.48
3mtj_A 444 Homoserine dehydrogenase; rossmann-fold, PSI, MCSG 83.38
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 83.18
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 83.16
2ozp_A 345 N-acetyl-gamma-glutamyl-phosphate reductase; amino 83.16
4had_A 350 Probable oxidoreductase protein; structural genomi 83.13
3c85_A183 Putative glutathione-regulated potassium-efflux S 83.09
3ip3_A 337 Oxidoreductase, putative; structural genomics, PSI 82.88
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 82.85
2q02_A 272 Putative cytoplasmic protein; structural genomics, 82.65
1tx2_A 297 DHPS, dihydropteroate synthase; folate biosynthesi 82.65
2d59_A144 Hypothetical protein PH1109; COA binding, structur 82.62
2fr1_A486 Erythromycin synthase, eryai; short chain dehydrog 82.37
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 82.19
1t4b_A 367 Aspartate-semialdehyde dehydrogenase; asadh, HOSR, 82.16
3p6l_A 262 Sugar phosphate isomerase/epimerase; TIM barrel, s 82.06
2rir_A300 Dipicolinate synthase, A chain; structural genomic 81.99
4e38_A232 Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho 81.75
3h5n_A353 MCCB protein; ubiquitin-activating enzyme, microci 81.73
3dx5_A 286 Uncharacterized protein ASBF; beta-alpha barrel, p 81.71
1k77_A260 EC1530, hypothetical protein YGBM; TIM barrel, str 81.68
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 81.62
2fp4_A 305 Succinyl-COA ligase [GDP-forming] alpha-chain, mit 81.55
3m2t_A 359 Probable dehydrogenase; PSI, SGXNY, structural gen 81.54
2qhx_A328 Pteridine reductase 1; oxidoreductase, short-chain 81.47
3vni_A 294 Xylose isomerase domain protein TIM barrel; D-psic 81.34
1ooe_A236 Dihydropteridine reductase; structural genomics, P 81.33
4gkb_A258 3-oxoacyl-[acyl-carrier protein] reductase; putati 81.09
3l23_A 303 Sugar phosphate isomerase/epimerase; structural ge 80.92
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 80.81
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 80.78
3l6d_A 306 Putative oxidoreductase; structural genomics, prot 80.62
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 80.24
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
Probab=99.84  E-value=5.2e-21  Score=156.79  Aligned_cols=96  Identities=17%  Similarity=0.216  Sum_probs=88.1

Q ss_pred             CCcceEEeeCCCHHHHHHHHhcCcEEEecCCCccchhHHHHHHHHHcCCCeeeCCCChHHHHHHHHHhHHHHHhCCCEEE
Q psy12849         30 RTNRTTVVNTINESSILIMAKKCRVILNCVGPYTWYGEAVVKACIEAKTHHVDITGEPYFMEYMQYEYNTRAQESEVCVV  109 (138)
Q Consensus        30 ~~~~~~~~D~~d~~~L~~~~~~~dvVIn~~GPf~~~~~~v~~Aci~~g~hYvDisge~~~~~~~~~~~~~~A~~~gv~iv  109 (138)
                      .....+.+|+.|.++|.++++++|+||||+|||+  +.+++++|+++|+||||+|++++++    .+++++|+++|++++
T Consensus        56 ~~~~~~~~d~~d~~~l~~~~~~~DvVi~~~p~~~--~~~v~~~~~~~g~~yvD~s~~~~~~----~~l~~~a~~~g~~~i  129 (365)
T 3abi_A           56 EFATPLKVDASNFDKLVEVMKEFELVIGALPGFL--GFKSIKAAIKSKVDMVDVSFMPENP----LELRDEAEKAQVTIV  129 (365)
T ss_dssp             TTSEEEECCTTCHHHHHHHHTTCSEEEECCCGGG--HHHHHHHHHHHTCEEEECCCCSSCG----GGGHHHHHHTTCEEE
T ss_pred             ccCCcEEEecCCHHHHHHHHhCCCEEEEecCCcc--cchHHHHHHhcCcceEeeeccchhh----hhhhhhhccCCceee
Confidence            3567789999999999999999999999998874  5699999999999999999998875    467899999999999


Q ss_pred             eCCCCccchHhHHHHHHHHHhh
Q psy12849        110 SACGIETLPIDMGVLMLQDSFE  131 (138)
Q Consensus       110 ~~~G~d~~p~dl~~~~~~~~~~  131 (138)
                      ++|||||+++++++.++.++++
T Consensus       130 ~~~G~~PG~~~~~a~~~~~~~~  151 (365)
T 3abi_A          130 FDAGFAPGLSNILMGRIFQELD  151 (365)
T ss_dssp             CCCBTTTBHHHHHHHHHHHHSC
T ss_pred             ecCCCCCchHHHHHHHHHHhcc
Confidence            9999999999999999999985



>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>2ph5_A Homospermidine synthase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: NAD; 2.50A {Legionella pneumophila subsp} Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>1f06_A MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhibitor ternary complex, oxidoreductase; HET: NDP 2NP; 2.10A {Corynebacterium glutamicum} SCOP: c.2.1.3 d.81.1.3 PDB: 1dap_A* 2dap_A* 3dap_A* Back     alignment and structure
>4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae} Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Back     alignment and structure
>1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>1j5p_A Aspartate dehydrogenase; TM1643, structural genomics, JCSG, protein structure initiative, joint center for structural G oxidoreductase; HET: NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 PDB: 1h2h_A* Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>3c8m_A Homoserine dehydrogenase; structural genomics, APC89447, PS protein structure initiative, midwest center for structural genomics; HET: MSE; 1.90A {Thermoplasma volcanium GSS1} PDB: 3jsa_A* Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>3upl_A Oxidoreductase; rossmann fold, NADPH binding; 1.50A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} PDB: 3upy_A* Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>2nu8_A Succinyl-COA ligase [ADP-forming] subunit alpha; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.2.1.8 c.23.4.1 PDB: 2nu9_A* 2nu7_A* 2nua_A* 2nu6_A* 2scu_A* 1jll_A* 1scu_A* 1jkj_A* 1cqj_A* 1cqi_A* Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>2yv1_A Succinyl-COA ligase [ADP-forming] subunit alpha; COA-binding domain, structural genomics, NPPSFA; 1.70A {Methanocaldococcus jannaschii} Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>2p2s_A Putative oxidoreductase; YP_050235.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.25A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>3e82_A Putative oxidoreductase; NAD, GFO/IDH/MOCA family, PSI-2, NYSGXRC, 11136F, structural genomics, protein structure initiative; 2.04A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>3o9z_A Lipopolysaccaride biosynthesis protein WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD AKG; 1.45A {Thermus thermophilus} PDB: 3oa0_A* Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase FAM binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum} Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>2ixa_A Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, hydrolase; HET: NAD; 2.3A {Flavobacterium meningosepticum} PDB: 2ixb_A* Back     alignment and structure
>3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2yv2_A Succinyl-COA synthetase alpha chain; COA-binding domain, ligase, structural genomics, NPPSFA; 2.20A {Aeropyrum pernix} Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>3moi_A Probable dehydrogenase; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics; 2.50A {Bordetella bronchiseptica} Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>3gdo_A Uncharacterized oxidoreductase YVAA; structural genomics, putative oxidoreductase YVAA, oxidoredu PSI-2, protein structure initiative; 2.03A {Bacillus subtilis subsp} PDB: 3gfg_A Back     alignment and structure
>3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>3kux_A Putative oxidoreductase; oxidoreductase family, csgid, structural genomics, center FO structural genomics of infectious diseases; HET: MSE; 2.75A {Yersinia pestis} Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>3f4l_A Putative oxidoreductase YHHX; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Escherichia coli k-12} Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>3fhl_A Putative oxidoreductase; NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 1.93A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>3i23_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.30A {Enterococcus faecalis} PDB: 3fd8_A* 3hnp_A Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>3ing_A Homoserine dehydrogenase; NP_394635.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: NDP; 1.95A {Thermoplasma acidophilum} Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>3ohs_X Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; dimeric dihydrodiol dehydrogenase, MDD, oxidoreductase; 1.90A {Macaca fascicularis} PDB: 2o48_X 2poq_X* 2o4u_X Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>3dty_A Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetramer, PSI-2, 11131, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Pseudomonas syringae PV} Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>1oi7_A Succinyl-COA synthetase alpha chain; SCS, ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.23A {Thermus thermophilus} SCOP: c.2.1.8 c.23.4.1 Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>3oa2_A WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>3v5n_A Oxidoreductase; structural genomics, PSI-biology, protein structure initiati nysgrc, NEW YORK structural genomics research consortium; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>3ngf_A AP endonuclease, family 2; structural genomics, seattle structural genomics center for infectious disease, ssgcid, TIM barrel; 1.80A {Brucella melitensis biovar abortus} SCOP: c.1.15.0 Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>4h3v_A Oxidoreductase domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.68A {Kribbella flavida} Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>1lc0_A Biliverdin reductase A; oxidoreductase, tetrapyrrole, bIle pigment, heme, bilirubin, NADH; 1.20A {Rattus norvegicus} SCOP: c.2.1.3 d.81.1.4 PDB: 1lc3_A* 1gcu_A 2h63_A* Back     alignment and structure
>1cf2_P Protein (glyceraldehyde-3-phosphate dehydrogenase); oxydoreductase, oxidoreductase; HET: NAP; 2.10A {Methanothermus fervidus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>4fb5_A Probable oxidoreductase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, GFO/IDH/MOCA family; 2.61A {Rhizobium etli} Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>1zh8_A Oxidoreductase; TM0312, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI; HET: MSE NAP; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3oqb_A Oxidoreductase; structural genomics, protein structure INI NEW YORK structural genomix research consortium, NYSGXRC, PSI-2; 2.60A {Bradyrhizobium japonicum} Back     alignment and structure
>4gqa_A NAD binding oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: MSE; 2.42A {Klebsiella pneumoniae} Back     alignment and structure
>1r0k_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; NADPH dependent, fosmidomycin, non- mevalonate pathway, oxidoreductase; 1.91A {Zymomonas mobilis} SCOP: a.69.3.1 c.2.1.3 d.81.1.3 PDB: 1r0l_A* Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3do5_A HOM, homoserine dehydrogenase; NP_069768.1, putative homoserine dehydrogenase, structural G joint center for structural genomics, JCSG; 2.20A {Archaeoglobus fulgidus} Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>1h6d_A Precursor form of glucose-fructose oxidoreductase; protein translocation, periplasmic oxidoreductase, signal peptide, ligand binding,; HET: NDP; 2.05A {Zymomonas mobilis} SCOP: c.2.1.3 d.81.1.5 PDB: 1h6b_A* 1h6a_A* 1h6c_A* 1ryd_A* 1rye_A* 1ofg_A* 1evj_A* Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>1gr0_A Inositol-3-phosphate synthase; isomerase, oxidoreductase, PSI, protein structure initiative, TB structural genomics consortium, TB; HET: NAD; 1.95A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 Back     alignment and structure
>4ew6_A D-galactose-1-dehydrogenase protein; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium, two domain; 2.30A {Rhizobium etli} Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>3obe_A Sugar phosphate isomerase/epimerase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.70A {Parabacteroides distasonis} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>3dmy_A Protein FDRA; predicted actyl-COA synthetase, nysgrc, PSI-II, STRU genomics, protein structure initiative; 2.07A {Escherichia coli} Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>1f6y_A 5-methyltetrahydrofolate corrinoid/iron sulfur PR methyltransferase; carbon dioxide fixation, cobalamin, methyltatrahydrofolate; 2.20A {Moorella thermoacetica} SCOP: c.1.21.2 PDB: 2e7f_A* 4djd_A* 4dje_A* 4djf_A* 2ogy_A* Back     alignment and structure
>2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>1b7g_O Protein (glyceraldehyde 3-phosphate dehydrogenase; archaea, hyperthermophIle, GAPDH, hyperthermophilic dehydrog oxidoreductase; 2.05A {Sulfolobus solfataricus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1vjp_A MYO-inositol-1-phosphate synthase-related protein; TM1419, structural genomics, JCSG, PSI, protein structure initiative; HET: NAD; 1.70A {Thermotoga maritima} PDB: 3cin_A* Back     alignment and structure
>2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae} Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>3mtj_A Homoserine dehydrogenase; rossmann-fold, PSI, MCSG, structural genomics, midwest cente structural genomics; 2.15A {Thiobacillus denitrificans} Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>2ozp_A N-acetyl-gamma-glutamyl-phosphate reductase; amino acid biosynthesis, structural genomics, riken structur genomics/proteomics initiative; 2.01A {Thermus thermophilus} Back     alignment and structure
>4had_A Probable oxidoreductase protein; structural genomics, protein structure initiative, nysgrc, PSI-biology; 2.00A {Rhizobium etli} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3ip3_A Oxidoreductase, putative; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.14A {Thermotoga maritima} Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>2q02_A Putative cytoplasmic protein; structural genomics, joint CEN structural genomics, JCSG, protein structure initiative; 2.40A {Salmonella typhimurium LT2} SCOP: c.1.15.4 Back     alignment and structure
>1tx2_A DHPS, dihydropteroate synthase; folate biosynthesis, pterine, MA transferase; HET: 680; 1.83A {Bacillus anthracis} SCOP: c.1.21.1 PDB: 1tww_A* 1twz_A* 1tx0_A* 1tws_A* 3h21_A* 3h22_A* 3h23_A* 3h24_A* 3h26_A* 3h2a_A* 3h2c_A* 3h2e_A* 3h2f_A* 3h2m_A* 3h2n_A* 3h2o_A* 3tya_A* 3tyb_A* 3tyc_A* 3tyd_A* ... Back     alignment and structure
>2d59_A Hypothetical protein PH1109; COA binding, structural genomics; 1.65A {Pyrococcus horikoshii} SCOP: c.2.1.8 PDB: 2d5a_A* 2e6u_X* 3qa9_A 3q9n_A* 3q9u_A* Back     alignment and structure
>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>1t4b_A Aspartate-semialdehyde dehydrogenase; asadh, HOSR, lysine biosynthesis, NADP+ oxidoreductase (phosphorylating), domain movement; 1.60A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1t4d_A 1brm_A 1gl3_A* 1nwc_A 1ta4_A 1tb4_A 1ps8_A 1pr3_A 1oza_A 1pqu_A* 1pqp_A 1nwh_A* 1nx6_A* 1pu2_A* 1q2x_A* Back     alignment and structure
>3p6l_A Sugar phosphate isomerase/epimerase; TIM barrel, structural genomics, joint center for structural genomics, JCSG; HET: CIT; 1.85A {Parabacteroides distasonis} Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} Back     alignment and structure
>3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A Back     alignment and structure
>3dx5_A Uncharacterized protein ASBF; beta-alpha barrel, petrobactin synthesis, ASB locus, structu genomics, PSI-2, protein structure initiative; HET: MSE DHB TRS; 2.12A {Bacillus anthracis} Back     alignment and structure
>1k77_A EC1530, hypothetical protein YGBM; TIM barrel, structural genomics, PSI, structure initiative; 1.63A {Escherichia coli} SCOP: c.1.15.5 Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>2fp4_A Succinyl-COA ligase [GDP-forming] alpha-chain, mitochondrial; active site phosphohistidine residue; HET: NEP GTP; 2.08A {Sus scrofa} SCOP: c.2.1.8 c.23.4.1 PDB: 2fpg_A* 2fpi_A* 2fpp_A* 1euc_A* 1eud_A* Back     alignment and structure
>3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>3vni_A Xylose isomerase domain protein TIM barrel; D-psicose 3-epimerase, ketohexose; 1.98A {Clostridium cellulolyticum} PDB: 3vnj_A* 3vnl_A* 3vnk_A* 3vnm_A* Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>3l23_A Sugar phosphate isomerase/epimerase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.70A {Parabacteroides distasonis} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query138
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 98.08
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 97.97
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 97.5
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 96.72
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 95.06
d1orra_ 338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 93.62
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 93.39
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 92.35
d1z45a2 347 Uridine diphosphogalactose-4-epimerase (UDP-galact 92.21
d1db3a_ 357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 91.93
d1gr0a1243 Myo-inositol 1-phosphate synthase {Mycobacterium t 91.39
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 90.52
d1udca_ 338 Uridine diphosphogalactose-4-epimerase (UDP-galact 90.45
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 90.38
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 90.37
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 90.25
d2blla1 342 Polymyxin resistance protein ArnA (PrmI) {Escheric 89.91
d1vjpa1275 Hypothetical protein TM1419 {Thermotoga maritima [ 89.75
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 89.66
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 89.1
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 88.96
d1qyca_ 307 Phenylcoumaran benzylic ether reductase {Loblolly 88.5
d2q02a1 271 Putative cytoplasmic protein STM4435 {Salmonella t 88.2
d2c5aa1 363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 88.01
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 87.81
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 87.37
d1gy8a_ 383 Uridine diphosphogalactose-4-epimerase (UDP-galact 87.3
d1qyda_ 312 Pinoresinol-lariciresinol reductase {Giant arborvi 86.97
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 86.9
d1oc2a_ 346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 86.89
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 86.37
d1ygya2130 Phosphoglycerate dehydrogenase {Mycobacterium tube 86.31
d1n2sa_ 298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 85.82
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 85.65
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 85.42
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 85.13
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 85.1
d1i24a_ 393 Sulfolipid biosynthesis protein SQD1 {Thale cress 85.02
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 84.73
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 84.62
d1gqna_252 Type I 3-dehydroquinate dehydratase {Salmonella ty 84.59
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 84.44
d1wmaa1 275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 84.27
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 83.98
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 83.85
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 83.79
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 83.57
d1rkxa_ 356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 82.77
d1xhla_ 274 Hypothetical protein F25D1.5 {Caenorhabditis elega 82.74
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 82.36
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 82.26
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 82.23
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 82.07
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 82.03
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 81.31
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 81.29
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 81.07
d1kewa_ 361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 81.06
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 81.0
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 80.98
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 80.94
d1u8xx1167 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 80.79
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 80.77
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 80.34
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 80.1
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 80.05
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain
domain: Saccharopine reductase
species: Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]
Probab=98.08  E-value=2.3e-05  Score=54.13  Aligned_cols=89  Identities=19%  Similarity=0.334  Sum_probs=73.0

Q ss_pred             CCcceEEeeCCCHHHHHHHHhcCcEEEecCCCccchhHHHHHHHHHcCCCeeeCCCChHHHHHHHHHhHHHHHhCCCEEE
Q psy12849         30 RTNRTTVVNTINESSILIMAKKCRVILNCVGPYTWYGEAVVKACIEAKTHHVDITGEPYFMEYMQYEYNTRAQESEVCVV  109 (138)
Q Consensus        30 ~~~~~~~~D~~d~~~L~~~~~~~dvVIn~~GPf~~~~~~v~~Aci~~g~hYvDisge~~~~~~~~~~~~~~A~~~gv~iv  109 (138)
                      ........+..+...+...+...++++++. |+... ..++..|.+.++||+|++...+.+    ..++++++.++..++
T Consensus        46 ~~~~~~~~~~~~~~~~~~~i~~~~~~i~~~-~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~----~~l~~~~~~~~~~~~  119 (182)
T d1e5qa1          46 QHSTPISLDVNDDAALDAEVAKHDLVISLI-PYTFH-ATVIKSAIRQKKHVVTTSYVSPAM----MELDQAAKDAGITVM  119 (182)
T ss_dssp             TTEEEEECCTTCHHHHHHHHTTSSEEEECS-CGGGH-HHHHHHHHHHTCEEECSSCCCHHH----HHTHHHHHHTTCEEE
T ss_pred             cccccccccccchhhhHhhhhccceeEeec-cchhh-hHHHHHHHhhccceeecccCcHHH----HHHHHHhccccceee
Confidence            344555567778889999999999999988 76644 588999999999999998876654    367789999999999


Q ss_pred             eCCCCccchHhHHHH
Q psy12849        110 SACGIETLPIDMGVL  124 (138)
Q Consensus       110 ~~~G~d~~p~dl~~~  124 (138)
                      ..+|..+.+...+..
T Consensus       120 ~~~~~~~~~~~~~~~  134 (182)
T d1e5qa1         120 NEIGYSAMAKLVGVP  134 (182)
T ss_dssp             CSCBCCHHHHHHHHH
T ss_pred             hhhhcchhhhhhcch
Confidence            999998877776664



>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gr0a1 c.2.1.3 (A:14-200,A:312-367) Myo-inositol 1-phosphate synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vjpa1 c.2.1.3 (A:0-209,A:317-381) Hypothetical protein TM1419 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d2q02a1 c.1.15.4 (A:1-271) Putative cytoplasmic protein STM4435 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ygya2 c.23.12.1 (A:3-98,A:283-316) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gqna_ c.1.10.1 (A:) Type I 3-dehydroquinate dehydratase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure