Psyllid ID: psy12891


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------
MLQQNSGKLRETPLHIAARVKDGDRCALMLLKSGAGPNLTNIAARVKDGDRCALMLLKSGAGPNLTTDDGQTPVHAAAKYGNLVTLQLLLEDGGDPMYKNKIGETPLHLASRNCKAEVVDLLIQFVQNISQEKVLEYVNSVNEDGASALHYACQVTKAELIPITSKEDQKTVKLLLEAGADVSLQTKQNHETAFHYCAVAGNNDVLTGMLEQMSGTEISKALNKQTSIGWTPLLIACNRGHMELVNTMLNNHARVDVFDQEGRSALHLAAEHGYLKVSSGKSLKHSVMSFRLPPHNIIPNGFLVHDHAAVIDILTLRKQTPLHLAAEAGQLQVCKLLLDLGASIDATDDQGQKPIHVAAQNNFPEVAQIFLRAHPSLVTATTKDGNTCAHIAAMQGSVGVIEELMKFDRSGVISARNRVTEATPLQLAAEGGHANVVRVLVKAGASCTDENKTGFTAVHLAAQNGHNQVLEEMRSSKALNVYSKKLGVTALHVAAYFGQADTVRELLSHVPGTVKSDPPTGASFLGELGSESGMTPLHLAAYSGNENVVRLLLNSAGVQVDAQTQEN
ccccccccccccHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHHHcccccccccccccHHHHHHHHcccHHHHHHHHHcccccccccccccHHHHHHHHHccHHHHHHHHHcccccccHHHHHcccccccccccHHHHHHHcccccccHHcccccHHHHHHHHHcccccccccccccccHHHHHHHHccHHHHHHHHHccccccHHHHHcccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHccccccccccccccHHHHHHHHcHHHHcccccccccccccccHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHHcccccccccccccHHHHHHHHcccHHHHHHHHccccccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccHHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccc
ccccccccccccHHHHHHHcccHHHHHHHHHHccccccHHHHHHHcccHHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccccccccccHHHHHHHccccHHHHHHHHccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHcccccHHcccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHccHHHHHHHHHHcccccccccccccHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHccHHHHHHHHHccccccccccccc
mlqqnsgklretplhIAARVKDGDRCALMLLksgagpnltNIAARVKDGDRCALMLLksgagpnlttddgqtpvHAAAKYGNLVTLQLLLedggdpmyknkigetplhlasrNCKAEVVDLLIQFVQNISQEKVLEYVNSVNEDGASALHYACQVTkaelipitskeDQKTVKLLLEAGadvslqtkqNHETAFHYCAVAGNNDVLTGMLEQMSGTEISKALNkqtsigwtplLIACNRGHMELVNTMLNNHARVDVFDQEGRSALHLAAEHGylkvssgkslkhsvmsfrlpphniipngflvhDHAAVIDILTLRKQTPLHLAAEAGQLQVCKLLLDLgasidatddqgqkpihvaaQNNFPEVAQIFLRahpslvtattkdgntcAHIAAMQGSVGVIEELMKFDRSGVIsarnrvteatplqlaaegghANVVRVLVKAGasctdenktgFTAVHLAAQNGHNQVLEEMRSSKALNVYSKKLGVTALHVAAYFGQADTVRELLshvpgtvksdpptgasflgelgsesgmtplhlaaysGNENVVRLLLNSagvqvdaqtqen
mlqqnsgklretplhiaarvkDGDRCALMLLksgagpnltNIAARVKDGDRCALMLLKSGAGPNLTTDDGQTPVHAAAKYGNLVTLQLLLEDGGDPMYKNKIGETPLHLASRNCKAEVVDLLIQFVQNISQEKVLEYVNSVNEDGASALHYACQVTKAELIPITSKEDQKTVKLLLEAGADVSLQTKQNHETAFHYCAVAGNNDVLTGMLEQMSGTEISKALNKQTSIGWTPLLIACNRGHMELVNTMLNNHARVDVFDQEGRSALHLAAEHGYLKVSSGKSLKHSVMSFRLPPHNIIPNGFLVHDHAAVIDILTLRKQTPLHLAAEAGQLQVCKLLLDLGASIDATDDQGQKPIHVAAQNNFPEVAQIFLRAHPSLVTATTKDGNTCAHIAAMQGSVGVIEELMKFDRSGVISARNRVTEATPlqlaaegghaNVVRVLVKAGASCTDENKTGFTAVHLAAQNGHNQVLEEMRSSKALNVYSKKLGVTALHVAAYFGQADTVRELLSHvpgtvksdppTGASFLGELGSESGMTPLHLAAYSGNENVVRLLLNSagvqvdaqtqen
MLQQNSGKLRETPLHIAARVKDGDRCALMLLKSGAGPNLTNIAARVKDGDRCALMLLKSGAGPNLTTDDGQTPVHAAAKYGNLVTLQLLLEDGGDPMYKNKIGETPLHLASRNCKAEVVDLLIQFVQNISQEKVLEYVNSVNEDGASALHYACQVTKAELIPITSKEDQKTVKLLLEAGADVSLQTKQNHETAFHYCAVAGNNDVLTGMLEQMSGTEISKALNKQTSIGWTPLLIACNRGHMELVNTMLNNHARVDVFDQEGRSALHLAAEHGYLKVSSGKSLKHSVMSFRLPPHNIIPNGFLVHDHAAVIDILTLRKQTPLHLAAEAGQLQVCKLLLDLGASIDATDDQGQKPIHVAAQNNFPEVAQIFLRAHPSLVTATTKDGNTCAHIAAMQGSVGVIEELMKFDRSGVISARNRVTEATPLQLAAEGGHANVVRVLVKAGASCTDENKTGFTAVHLAAQNGHNQVLEEMRSSKALNVYSKKLGVTALHVAAYFGQADTVRELLSHVPGTVKSDPPTGASFLGELGSESGMTPLHLAAYSGNENVVRLLLNSAGVQVDAQTQEN
**************HIAARVKDGDRCALMLLKSGAGPNLTNIAARVKDGDRCALMLLKSGAGPNLTT**GQTPVHAAAKYGNLVTLQLLLEDGGDPMYKNKIGETPLHLASRNCKAEVVDLLIQFVQNISQEKVLEYVNSVNEDGASALHYACQVTKAELIPITSKEDQKTVKLLLEAGADVSLQTKQNHETAFHYCAVAGNNDVLTGMLEQMSGTEISKALNKQTSIGWTPLLIACNRGHMELVNTMLNNHARVDVFDQEGRSALHLAAEHGYLKVSSGKSLKHSVMSFRLPPHNIIPNGFLVHDHAAVIDILTLRKQTPLHLAAEAGQLQVCKLLLDLGASIDATDDQGQKPIHVAAQNNFPEVAQIFLRAHPSLVTATTKDGNTCAHIAAMQGSVGVIEELMKFDRSGVISARNRVTEATPLQLAAEGGHANVVRVLVKAGASCTDENKTGFTAVHLAAQNGHNQVLEE***SKALNVYSKKLGVTALHVAAYFGQADTVRELLSHV*************************PLHLAAYSGNENVVRLLLNSAG**********
MLQQNSGKLRETPLHIAARVKDGDRCALMLLKSGAGPNLTNIAARVKDGDRCALMLLKSGAGPNLTTDDGQTPVHAAAKYGNLVTLQLLLEDGGDPMYKNKIGETPLHLASRNCKAEVVDLLIQFVQNISQEKVLEYVNSVNEDGASALHYACQVTKAELIPITSKEDQKTVKLLLEAGADVSLQTKQNHETAFHYCAVAGNNDVLTGMLEQMSGTEISKALNKQTSIGWTPLLIACNRGHMELVNTMLNNHARVDVFDQEGRSALHLAAEHGYLKVSSGKSLKHSVMSFRLPPHNIIPNGFLVHDHAAVIDILTLRKQTPLHLAAEAGQLQVCKLLLDLGASIDATDDQGQKPIHVAAQNNFPEVAQIFLRAHPSLVTATTKDGNTCAHIAAMQGSVGVIEELMKFDRSGVISARNRVTEATPLQLAAEGGHANVVRVLVKAGASCTDENKTGFTAVHLAAQNGHNQVLEEMRSSKALNVYSKKLGVTALHVAAYFGQADTVRELLSHVPGTVKSDPPTGASFLGELGSESGMTPLHLAAYSGNENVVRLLLNSAGVQVD******
********LRETPLHIAARVKDGDRCALMLLKSGAGPNLTNIAARVKDGDRCALMLLKSGAGPNLTTDDGQTPVHAAAKYGNLVTLQLLLEDGGDPMYKNKIGETPLHLASRNCKAEVVDLLIQFVQNISQEKVLEYVNSVNEDGASALHYACQVTKAELIPITSKEDQKTVKLLLEAGADVSLQTKQNHETAFHYCAVAGNNDVLTGMLEQMSGTEISKALNKQTSIGWTPLLIACNRGHMELVNTMLNNHARVDVFDQEGRSALHLAAEHGYLKVSSGKSLKHSVMSFRLPPHNIIPNGFLVHDHAAVIDILTLRKQTPLHLAAEAGQLQVCKLLLDLGASIDATDDQGQKPIHVAAQNNFPEVAQIFLRAHPSLVTATTKDGNTCAHIAAMQGSVGVIEELMKFDRSGVISARNRVTEATPLQLAAEGGHANVVRVLVKAGASCTDENKTGFTAVHLAAQNGHNQVLEEMRSSKALNVYSKKLGVTALHVAAYFGQADTVRELLSHVPGTVKSDPPTGASFLGELGSESGMTPLHLAAYSGNENVVRLLLNSAGVQVDAQTQEN
*L***SGKLRETPLHIAARVKDGDRCALMLLKSGAGPNLTNIAARVKDGDRCALMLLKSGAGPNLTTDDGQTPVHAAAKYGNLVTLQLLLEDGGDPMYKNKIGETPLHLASRNCKAEVVDLLIQFVQNISQEKVLEYVNSVNEDGASALHYACQVTKAELIPITSKEDQKTVKLLLEAGADVSLQTKQNHETAFHYCAVAGNNDVLTGMLEQMSGTEISKALNKQTSIGWTPLLIACNRGHMELVNTMLNNHARVDVFDQEGRSALHLAAEHGYLKVSSGKSLKHSVMSFRLPPHNIIPNGFLVHDHAAVIDILTLRKQTPLHLAAEAGQLQVCKLLLDLGASIDATDDQGQKPIHVAAQNNFPEVAQIFLRAHPSLVTATTKDGNTCAHIAAMQGSVGVIEELMKFDRSGVISARNRVTEATPLQLAAEGGHANVVRVLVKAGASCTDENKTGFTAVHLAAQNGHNQVLEEMRSSKALNVYSKKLGVTALHVAAYFGQADTVRELLSHVPGTVKSDPPTGASFLGELGSESGMTPLHLAAYSGNENVVRLLLNSA***********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLQQNSGKLRETPLHIAARVKDGDRCALMLLKSGAGPNLTNIAARVKDGDRCALMLLKSGAGPNLTTDDGQTPVHAAAKYGNLVTLQLLLEDGGDPMYKNKIGETPLHLASRNCKAEVVDLLIQFVQNISQEKVLEYVNSVNEDGASALHYACQVTKAELIPITSKEDQKTVKLLLEAGADVSLQTKQNHETAFHYCAVAGNNDVLTGMLEQMSGTEISKALNKQTSIGWTPLLIACNRGHMELVNTMLNNHARVDVFDQEGRSALHLAAEHGYLKVSSGKSLKHSVMSFRLPPHNIIPNGFLVHDHAAVIDILTLRKQTPLHLAAEAGQLQVCKLLLDLGASIDATDDQGQKPIHVAAQNNFPEVAQIFLRAHPSLVTATTKDGNTCAHIAAMQGSVGVIEELMKFDRSGVISARNRVTEATPLQLAAEGGHANVVRVLVKAGASCTDENKTGFTAVHLAAQNGHNQVLEEMRSSKALNVYSKKLGVTALHVAAYFGQADTVRELLSHVPGTVKSDPPTGASFLGELGSESGMTPLHLAAYSGNENVVRLLLNSAGVQVDAQTQEN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query567 2.2.26 [Sep-21-2011]
P16157 1881 Ankyrin-1 OS=Homo sapiens yes N/A 0.899 0.271 0.309 2e-47
Q02357 1862 Ankyrin-1 OS=Mus musculus yes N/A 0.892 0.271 0.303 6e-46
Q01484 3957 Ankyrin-2 OS=Homo sapiens no N/A 0.834 0.119 0.301 2e-44
Q8C8R3 3898 Ankyrin-2 OS=Mus musculus no N/A 0.834 0.121 0.305 4e-44
Q12955 4377 Ankyrin-3 OS=Homo sapiens no N/A 0.895 0.116 0.297 1e-42
G5E8K5 1961 Ankyrin-3 OS=Mus musculus no N/A 0.911 0.263 0.289 2e-40
B2RXR6993 Serine/threonine-protein no N/A 0.915 0.522 0.285 4e-37
Q54KA7 986 Ankyrin repeat, PH and SE yes N/A 0.791 0.455 0.286 6e-36
Q5F478990 Serine/threonine-protein no N/A 0.922 0.528 0.283 6e-36
Q4UMH61179 Putative ankyrin repeat p yes N/A 0.841 0.404 0.293 6e-36
>sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 Back     alignment and function desciption
 Score =  191 bits (484), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 179/579 (30%), Positives = 277/579 (47%), Gaps = 69/579 (11%)

Query: 7   GKLRETPLHIAARVKDGDRCALMLLKSGAGPNLTN--------IAARVKDGDRCALMLLK 58
           GK+R   LHIAAR  D  R A +LL++   P++ +        IAA  ++ +  A +LL 
Sbjct: 170 GKVRLPALHIAAR-NDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLN-VAQLLLN 227

Query: 59  SGAGPNLTTDDGQTPVHAAAKYGNLVTLQLLLEDGGDPMYKNKIGETPLHLASRNCKAEV 118
            GA  N T  +G TP+H A++ GN++ ++LLL+ G     K K   TPLH A+RN    +
Sbjct: 228 RGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRI 287

Query: 119 VDLLIQFVQNISQEKVLEYVNSVNEDGASALHYACQVTKAELIPITSKEDQKTVKLLLEA 178
            ++L+     I  +          ++G S +H A Q            +    V+LLL+ 
Sbjct: 288 SEILLDHGAPIQAK---------TKNGLSPIHMAAQ-----------GDHLDCVRLLLQY 327

Query: 179 GADVSLQTKQNHETAFHYCAVAGNNDVLTGMLEQMSGTEISKALNKQTSIGWTPLLIACN 238
            A++   T  +H T  H  A  G++ V   +L++ +    S+ALN     G+TPL IAC 
Sbjct: 328 DAEIDDIT-LDHLTPLHVAAHCGHHRVAKVLLDKGAKPN-SRALN-----GFTPLHIACK 380

Query: 239 RGHMELVNTMLNNHARVDVFDQEGRSALHLAAEHGYLKV-----SSGKSLKHSVMSFRLP 293
           + H+ ++  +L   A +D   + G + LH+A+  G+L +       G S   S +    P
Sbjct: 381 KNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETP 440

Query: 294 PHNIIPNG------FLVHDHAAVIDILTLRKQTPLHLAAEAGQLQVCKLLLDLGASIDAT 347
            H     G      +L+ + A V +      QTPLH AA  G   + KLLL+  A+ +  
Sbjct: 441 LHMAARAGHTEVAKYLLQNKAKV-NAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLA 499

Query: 348 DDQGQKPIHVAAQNNFPEVAQIFLRAHPSLVTATTKDGNTCAHIAAMQGSVGVIEELMKF 407
              G  P+H+AA+    E     L    S     TK G T  H+AA  G V V E L++ 
Sbjct: 500 TTAGHTPLHIAAREGHVETVLALLEKEASQA-CMTKKGFTPLHVAAKYGKVRVAELLLER 558

Query: 408 DRSGVISARNRVTEATPLQLAAEGGHANVVRVLVKAGASCTDENKTGFTAVHLAAQNGHN 467
           D     + +N +   TPL +A    + ++V++L+  G S       G+T +H+AA+    
Sbjct: 559 DAHPNAAGKNGL---TPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQV 615

Query: 468 QVLEE-MRSSKALNVYSKKLGVTALHVAAYFGQADTVRELLSHVPGTVKSDPPTGASFLG 526
           +V    ++   + N  S + GVT LH+AA  G A+ V  LLS                 G
Sbjct: 616 EVARSLLQYGGSANAESVQ-GVTPLHLAAQEGHAEMVALLLSKQAN-------------G 661

Query: 527 ELGSESGMTPLHLAAYSGNENVVRLLLNSAGVQVDAQTQ 565
            LG++SG+TPLHL A  G+  V  +L+   GV VDA T+
Sbjct: 662 NLGNKSGLTPLHLVAQEGHVPVADVLIKH-GVMVDATTR 699




Isoform Mu17 together with obscurin in skeletal muscle may provide a molecular link between the sarcoplasmic reticulum and myofibrils.
Homo sapiens (taxid: 9606)
>sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 Back     alignment and function description
>sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 Back     alignment and function description
>sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 Back     alignment and function description
>sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 Back     alignment and function description
>sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 Back     alignment and function description
>sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=2 SV=1 Back     alignment and function description
>sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 Back     alignment and function description
>sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 Back     alignment and function description
>sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=4 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query567
328718834 1716 PREDICTED: serine/threonine-protein phos 0.943 0.311 0.687 0.0
383850421 1711 PREDICTED: serine/threonine-protein phos 0.940 0.311 0.705 0.0
380011932 1711 PREDICTED: LOW QUALITY PROTEIN: serine/t 0.940 0.311 0.701 0.0
48095512 1711 PREDICTED: serine/threonine-protein phos 0.940 0.311 0.701 0.0
307185525 1504 Ankyrin-1 [Camponotus floridanus] 0.940 0.354 0.696 0.0
340728307 1712 PREDICTED: serine/threonine-protein phos 0.938 0.310 0.705 0.0
350403217 1712 PREDICTED: serine/threonine-protein phos 0.938 0.310 0.705 0.0
345488328 1635 PREDICTED: serine/threonine-protein phos 0.940 0.325 0.691 0.0
340728311 1479 PREDICTED: serine/threonine-protein phos 0.938 0.359 0.705 0.0
350403222 1479 PREDICTED: serine/threonine-protein phos 0.938 0.359 0.705 0.0
>gi|328718834|ref|XP_001945728.2| PREDICTED: serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  796 bits (2057), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/573 (68%), Positives = 457/573 (79%), Gaps = 38/573 (6%)

Query: 7   GKLRETPLHIAARVKDGDRCALMLLKSGAGPNLTNIAARVKDGDRCALMLLKSGAGPNLT 66
           GKLRETPLHIAARV                          KDGDRCALMLLKSGAGPNL 
Sbjct: 453 GKLRETPLHIAARV--------------------------KDGDRCALMLLKSGAGPNLA 486

Query: 67  TDDGQTPVHAAAKYGNLVTLQLLLEDGGDPMYKNKIGETPLHLASRNCKAEVVDLLIQFV 126
            DDGQTPVH AA+YGNL+TLQLLL+DGGDP++KNK+GETPLHLA R+C+A++V  L+ FV
Sbjct: 487 MDDGQTPVHVAAQYGNLITLQLLLDDGGDPLFKNKVGETPLHLACRSCQADIVGQLVNFV 546

Query: 127 QNISQEKVL-EYVNSVNEDGASALHYACQVTKAELIPITSKEDQKTVKLLLEAGADVSLQ 185
           ++   ++V   YVNSVNEDGASALHYA  + + E+    S  D K +KLL E GAD++L+
Sbjct: 547 KSKQGDEVANSYVNSVNEDGASALHYAANIKQTEVNESKSNNDAKVIKLLFEGGADINLR 606

Query: 186 TKQNHETAFHYCAVAGNNDVLTGMLEQMSGTEISKALNKQTSIGWTPLLIACNRGHMELV 245
           TK +HETA H+CAVAGNNDVLT ML  MS TE+ +++N+Q+S+GWTPLLIAC+RGHM LV
Sbjct: 607 TKLHHETALHFCAVAGNNDVLTAMLNGMSPTEVQQSMNRQSSVGWTPLLIACHRGHMSLV 666

Query: 246 NTMLNNHARVDVFDQEGRSALHLAAEHGYLKVSSGKSLKHSVMSFR-----LPPHNIIPN 300
           NTMLNNHARVDVFD EGRSALHLAAE GYLKV        + ++ +        H    N
Sbjct: 667 NTMLNNHARVDVFDNEGRSALHLAAERGYLKVCDALLTHKAFINSKSRVGWTALHLAAMN 726

Query: 301 GF------LVHDHAAVIDILTLRKQTPLHLAAEAGQLQVCKLLLDLGASIDATDDQGQKP 354
           GF      L+HDH AVIDILTLRKQTPLHLAA AGQL+VC+LLLDLGA+IDATDDQGQKP
Sbjct: 727 GFADLCRFLIHDHNAVIDILTLRKQTPLHLAASAGQLEVCRLLLDLGANIDATDDQGQKP 786

Query: 355 IHVAAQNNFPEVAQIFLRAHPSLVTATTKDGNTCAHIAAMQGSVGVIEELMKFDRSGVIS 414
           IH+A+QNN+PEV  +FL+ HP LV A+TKDGNTCAHIAAMQGSV VI ELMKFD++GVIS
Sbjct: 787 IHIASQNNYPEVVHLFLQQHPQLVLASTKDGNTCAHIAAMQGSVTVIIELMKFDKNGVIS 846

Query: 415 ARNRVTEATPLQLAAEGGHANVVRVLVKAGASCTDENKTGFTAVHLAAQNGHNQVLEEMR 474
           ARNR+TEATPLQLAAEGGHA VV+VLV+AGASC+DENK GFTAVHLAAQNGH  VLE +R
Sbjct: 847 ARNRITEATPLQLAAEGGHAQVVKVLVRAGASCSDENKAGFTAVHLAAQNGHLAVLEVLR 906

Query: 475 SSKALNVYSKKLGVTALHVAAYFGQADTVRELLSHVPGTVKSDPPTGASFLGELGSESGM 534
           SS++L + SK+LG+TALH+AAY GQ DTVRELLSH+P TVKSDPP+G S LG LG+ESGM
Sbjct: 907 SSQSLKISSKRLGMTALHMAAYCGQTDTVRELLSHIPATVKSDPPSGVSVLGVLGNESGM 966

Query: 535 TPLHLAAYSGNENVVRLLLNSAGVQVDAQTQEN 567
           TPLH AAYSGNENVVRLLLNSAGVQVDA T E+
Sbjct: 967 TPLHFAAYSGNENVVRLLLNSAGVQVDASTVES 999




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|383850421|ref|XP_003700794.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|380011932|ref|XP_003690046.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B-like [Apis florea] Back     alignment and taxonomy information
>gi|48095512|ref|XP_392309.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C [Apis mellifera] Back     alignment and taxonomy information
>gi|307185525|gb|EFN71501.1| Ankyrin-1 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|340728307|ref|XP_003402467.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C-like isoform 1 [Bombus terrestris] Back     alignment and taxonomy information
>gi|350403217|ref|XP_003486733.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C-like isoform 1 [Bombus impatiens] Back     alignment and taxonomy information
>gi|345488328|ref|XP_001605939.2| PREDICTED: serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|340728311|ref|XP_003402469.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C-like isoform 3 [Bombus terrestris] Back     alignment and taxonomy information
>gi|350403222|ref|XP_003486734.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C-like isoform 2 [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query567
FB|FBgn0016920 1726 nompC "no mechanoreceptor pote 0.924 0.303 0.698 3.5e-194
ZFIN|ZDB-GENE-030728-7 1614 trpn1 "transient receptor pote 0.918 0.322 0.471 1.1e-121
WB|WBGene00006616 1924 trp-4 [Caenorhabditis elegans 0.925 0.272 0.429 1.1e-108
ZFIN|ZDB-GENE-081104-19 1929 si:ch211-173b16.3 "si:ch211-17 0.925 0.272 0.305 4e-47
UNIPROTKB|F1MY81 1136 ANK1 "Uncharacterized protein" 0.878 0.438 0.315 8.2e-47
UNIPROTKB|F1PRD8 1857 ANK1 "Uncharacterized protein" 0.878 0.268 0.318 1e-46
UNIPROTKB|F1PRC8 1916 ANK1 "Uncharacterized protein" 0.878 0.259 0.318 1.1e-46
UNIPROTKB|F1SE30 1885 ANK1 "Uncharacterized protein" 0.878 0.264 0.313 2.2e-46
MGI|MGI:88024 1862 Ank1 "ankyrin 1, erythroid" [M 0.878 0.267 0.311 6.6e-45
RGD|1309620 1864 Ank1 "ankyrin 1, erythrocytic" 0.878 0.267 0.311 1.4e-44
FB|FBgn0016920 nompC "no mechanoreceptor potential C" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 1881 (667.2 bits), Expect = 3.5e-194, P = 3.5e-194
 Identities = 377/540 (69%), Positives = 442/540 (81%)

Query:    41 NIAARVKDGDRCALMLLKSGAGPNLTTDDGQTPVHAAAKYGNLVTLQLLLEDGGDPMYKN 100
             +IAARVKDGDRCALMLLKSGA PNLTTDD  TPVH AA++GNL TL  LLED GDP+YK+
Sbjct:   473 HIAARVKDGDRCALMLLKSGASPNLTTDDCLTPVHVAARHGNLATLMQLLEDEGDPLYKS 532

Query:   101 KIGETPLHLASRNCKAEVVDLLIQFV-QNISQEKVLEYVNSVNEDGASALHYACQVTKAE 159
               GETPLH+A R C  ++V  LI+ V +    +K   Y+NSVNEDGA+ALHY CQ+TK E
Sbjct:   533 NTGETPLHMACRACHPDIVRHLIETVKEKHGPDKATTYINSVNEDGATALHYTCQITKEE 592

Query:   160 L-IPITSKEDQKTVKLLLEAGADVSLQTKQNHETAFHYCAVAGNNDVLTGMLEQMSGTEI 218
             + IP   + D++ V++LLE GADV+LQTK   ETAFHYCAVAGNNDVL  M+  M+ T+I
Sbjct:   593 VKIP---ESDKQIVRMLLENGADVTLQTKTALETAFHYCAVAGNNDVLMEMISHMNPTDI 649

Query:   219 SKALNKQTSIGWTPLLIACNRGHMELVNTMLNNHARVDVFDQEGRSALHLAAEHGYLKVS 278
              KA+N+Q+S+GWTPLLIAC+RGHMELVN +L NHARVDVFD EGRSALHLAAE GYL V 
Sbjct:   650 QKAMNRQSSVGWTPLLIACHRGHMELVNNLLANHARVDVFDTEGRSALHLAAERGYLHVC 709

Query:   279 ----SGKSLKHSVMSF-RLPPHNIIPNGF------LVHDHAAVIDILTLRKQTPLHLAAE 327
                 + K+  +S     R   H    NGF      L+ DH AVIDILTLRKQTPLHLAA 
Sbjct:   710 DALLTNKAFINSKSRVGRTALHLAAMNGFTHLVKFLIKDHNAVIDILTLRKQTPLHLAAA 769

Query:   328 AGQLQVCKLLLDLGASIDATDDQGQKPIHVAAQNNFPEVAQIFLRAHPSLVTATTKDGNT 387
             +GQ++VC+LLL+LGA+IDATDD GQKPIHVAAQNN+ EVA++FL+ HPSLV AT+KDGNT
Sbjct:   770 SGQMEVCQLLLELGANIDATDDLGQKPIHVAAQNNYSEVAKLFLQQHPSLVNATSKDGNT 829

Query:   388 CAHIAAMQGSVGVIEELMKFDRSGVISARNRVTEATPLQLAAEGGHANVVRVLVKAGASC 447
             CAHIAAMQGSV VIEELMKFDRSGVISARN++T+ATPLQLAAEGGHA+VV+ LV+AGASC
Sbjct:   830 CAHIAAMQGSVKVIEELMKFDRSGVISARNKLTDATPLQLAAEGGHADVVKALVRAGASC 889

Query:   448 TDENKTGFTAVHLAAQNGHNQVLEEMRSSKALNVYSKKLGVTALHVAAYFGQADTVRELL 507
             T+ENK GFTAVHLAAQNGH QVL+ ++S+ +L + SKKLG+T LHVAAY+GQADTVRELL
Sbjct:   890 TEENKAGFTAVHLAAQNGHGQVLDVLKSTNSLRINSKKLGLTPLHVAAYYGQADTVRELL 949

Query:   508 SHVPGTVKSDPPTGASFLGELGSESGMTPLHLAAYSGNENVVRLLLNSAGVQVDAQTQEN 567
             + VP TVKS+ PTG S  G+LG+ESGMTPLHLAA+SGNENVVRLLLNSAGVQVDA T EN
Sbjct:   950 TSVPATVKSETPTGQSLFGDLGTESGMTPLHLAAFSGNENVVRLLLNSAGVQVDAATIEN 1009


GO:0005262 "calcium channel activity" evidence=IEA;ISS
GO:0006816 "calcium ion transport" evidence=ISS
GO:0007638 "mechanosensory behavior" evidence=IMP
GO:0005216 "ion channel activity" evidence=ISS
GO:0008381 "mechanically-gated ion channel activity" evidence=NAS;TAS
GO:0050954 "sensory perception of mechanical stimulus" evidence=NAS
GO:0007605 "sensory perception of sound" evidence=IMP
GO:0008092 "cytoskeletal protein binding" evidence=ISS
GO:0030506 "ankyrin binding" evidence=NAS
GO:0050974 "detection of mechanical stimulus involved in sensory perception" evidence=TAS
GO:0070588 "calcium ion transmembrane transport" evidence=IEA
GO:0016020 "membrane" evidence=IEA
GO:0005929 "cilium" evidence=IDA
GO:0040011 "locomotion" evidence=IMP
GO:0050975 "sensory perception of touch" evidence=IMP
ZFIN|ZDB-GENE-030728-7 trpn1 "transient receptor potential cation channel, subfamily N, member 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
WB|WBGene00006616 trp-4 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-081104-19 si:ch211-173b16.3 "si:ch211-173b16.3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1MY81 ANK1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PRD8 ANK1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1PRC8 ANK1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1SE30 ANK1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:88024 Ank1 "ankyrin 1, erythroid" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1309620 Ank1 "ankyrin 1, erythrocytic" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query567
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 5e-28
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-25
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 5e-25
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 9e-25
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 9e-22
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-21
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 3e-21
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 2e-18
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-17
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 3e-16
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 9e-16
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-14
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 1e-13
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-13
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-13
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 4e-13
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 5e-13
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 6e-13
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-12
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 3e-12
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 4e-12
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 7e-12
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 8e-12
PHA03100 422 PHA03100, PHA03100, ankyrin repeat protein; Provis 1e-11
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 2e-11
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-11
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 2e-11
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 3e-11
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 5e-11
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 6e-11
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 1e-10
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-10
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 2e-10
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 3e-10
PTZ00322664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 3e-10
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 5e-10
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 6e-10
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 6e-10
PHA02946446 PHA02946, PHA02946, ankyin-like protein; Provision 1e-09
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 4e-09
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 4e-09
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 1e-08
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 2e-08
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 2e-08
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 3e-08
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 4e-08
PHA02736154 PHA02736, PHA02736, Viral ankyrin protein; Provisi 7e-08
PHA02875 413 PHA02875, PHA02875, ankyrin repeat protein; Provis 1e-07
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 1e-07
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 1e-07
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 2e-07
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 3e-07
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 4e-07
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 6e-07
pfam0002333 pfam00023, Ank, Ankyrin repeat 6e-07
TIGR00870 743 TIGR00870, trp, transient-receptor-potential calci 7e-07
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 1e-06
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 2e-06
PHA02878 477 PHA02878, PHA02878, ankyrin repeat protein; Provis 3e-06
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 3e-06
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 1e-05
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 1e-05
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 1e-05
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 2e-05
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 2e-05
pfam0002333 pfam00023, Ank, Ankyrin repeat 2e-05
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 3e-05
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 5e-05
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 5e-05
PHA02875 413 PHA02875, PHA02875, ankyrin repeat protein; Provis 6e-05
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-04
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 1e-04
pfam0002333 pfam00023, Ank, Ankyrin repeat 1e-04
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 3e-04
PTZ00322664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 4e-04
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 5e-04
smart0024830 smart00248, ANK, ankyrin repeats 5e-04
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 7e-04
smart0024830 smart00248, ANK, ankyrin repeats 7e-04
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 0.001
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 0.001
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 0.001
pfam0002333 pfam00023, Ank, Ankyrin repeat 0.001
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 0.001
PHA02859209 PHA02859, PHA02859, ankyrin repeat protein; Provis 0.001
PHA02859209 PHA02859, PHA02859, ankyrin repeat protein; Provis 0.001
PHA02875 413 PHA02875, PHA02875, ankyrin repeat protein; Provis 0.002
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 0.002
TIGR00870743 TIGR00870, trp, transient-receptor-potential calci 0.002
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 0.003
TIGR00870 743 TIGR00870, trp, transient-receptor-potential calci 0.003
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 0.004
pfam0002333 pfam00023, Ank, Ankyrin repeat 0.004
PHA02741169 PHA02741, PHA02741, hypothetical protein; Provisio 0.004
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
 Score =  108 bits (272), Expect = 5e-28
 Identities = 54/149 (36%), Positives = 81/149 (54%), Gaps = 23/149 (15%)

Query: 223 NKQTSIGWTPLLIACNRGHMELVNTMLNNHARVDVFDQEGRSALHLAAEHGYLKVSSGKS 282
           N +   G TPL +A + GH+E+V  +L N A V+  D +GR+ LHLAA++G+L++     
Sbjct: 1   NARDEDGRTPLHLAASNGHLEVVKLLLENGADVNAKDNDGRTPLHLAAKNGHLEI----- 55

Query: 283 LKHSVMSFRLPPHNIIPNGFLVHDHAAVIDILTLRKQTPLHLAAEAGQLQVCKLLLDLGA 342
           +K                  L+ +  A ++       TPLHLAA  G L V KLLL  GA
Sbjct: 56  VK-----------------LLL-EKGADVNARDKDGNTPLHLAARNGNLDVVKLLLKHGA 97

Query: 343 SIDATDDQGQKPIHVAAQNNFPEVAQIFL 371
            ++A D  G+ P+H+AA+N   EV ++ L
Sbjct: 98  DVNARDKDGRTPLHLAAKNGHLEVVKLLL 126


The number of ANK repeats in a protein can range from 2 to over 20 (ankyrins, for example). ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two antiparallel helices and a beta-hairpin, repeats are stacked in a superhelical arrangement; this alignment contains 4 consecutive repeats. Length = 126

>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|165256 PHA02946, PHA02946, ankyin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|165103 PHA02736, PHA02736, Viral ankyrin protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|165195 PHA02859, PHA02859, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165195 PHA02859, PHA02859, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|165108 PHA02741, PHA02741, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 567
KOG4177|consensus 1143 100.0
KOG4177|consensus 1143 100.0
PHA02876 682 ankyrin repeat protein; Provisional 100.0
PHA02876 682 ankyrin repeat protein; Provisional 100.0
PHA02917 661 ankyrin-like protein; Provisional 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
PHA02917661 ankyrin-like protein; Provisional 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
PHA02730672 ankyrin-like protein; Provisional 100.0
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA02730 672 ankyrin-like protein; Provisional 100.0
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 100.0
KOG0510|consensus 929 100.0
KOG0510|consensus 929 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
PHA03095471 ankyrin-like protein; Provisional 100.0
PHA03100480 ankyrin repeat protein; Provisional 100.0
PHA03095 471 ankyrin-like protein; Provisional 100.0
PHA03100 480 ankyrin repeat protein; Provisional 100.0
PHA02878477 ankyrin repeat protein; Provisional 100.0
PHA02989494 ankyrin repeat protein; Provisional 100.0
PHA02792 631 ankyrin-like protein; Provisional 100.0
PHA02878 477 ankyrin repeat protein; Provisional 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA02989494 ankyrin repeat protein; Provisional 100.0
KOG0508|consensus615 100.0
PHA02792631 ankyrin-like protein; Provisional 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA02875 413 ankyrin repeat protein; Provisional 100.0
KOG4412|consensus226 100.0
PHA02875 413 ankyrin repeat protein; Provisional 100.0
PHA02798 489 ankyrin-like protein; Provisional 100.0
KOG0508|consensus615 100.0
PHA02798 489 ankyrin-like protein; Provisional 100.0
KOG4412|consensus226 100.0
KOG0509|consensus600 99.97
KOG0509|consensus 600 99.97
PHA02795 437 ankyrin-like protein; Provisional 99.97
PHA02795 437 ankyrin-like protein; Provisional 99.96
KOG4369|consensus 2131 99.96
KOG4369|consensus 2131 99.96
PHA02859209 ankyrin repeat protein; Provisional 99.96
PHA02859209 ankyrin repeat protein; Provisional 99.96
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.94
KOG0502|consensus296 99.94
KOG0502|consensus296 99.93
KOG0507|consensus 854 99.92
KOG0507|consensus 854 99.92
PLN03192823 Voltage-dependent potassium channel; Provisional 99.92
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.91
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.91
KOG0505|consensus527 99.9
KOG0514|consensus452 99.9
PHA02743166 Viral ankyrin protein; Provisional 99.89
KOG0514|consensus452 99.87
PHA02741169 hypothetical protein; Provisional 99.87
PHA02743166 Viral ankyrin protein; Provisional 99.86
KOG0505|consensus 527 99.86
PHA02884 300 ankyrin repeat protein; Provisional 99.86
PHA02884300 ankyrin repeat protein; Provisional 99.86
PHA02741169 hypothetical protein; Provisional 99.86
PHA02736154 Viral ankyrin protein; Provisional 99.84
PHA02736154 Viral ankyrin protein; Provisional 99.83
KOG0512|consensus228 99.82
KOG3676|consensus 782 99.81
KOG0512|consensus228 99.8
KOG0195|consensus 448 99.77
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.76
KOG3676|consensus 782 99.76
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.74
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.73
KOG0195|consensus 448 99.71
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.7
KOG4214|consensus117 99.67
KOG4214|consensus117 99.64
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.6
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.56
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.54
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.5
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.5
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.47
KOG0515|consensus752 99.46
PTZ00322664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.44
KOG0515|consensus752 99.41
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.41
KOG1710|consensus 396 99.4
KOG1710|consensus 396 99.38
PF1360630 Ank_3: Ankyrin repeat 99.07
PF1360630 Ank_3: Ankyrin repeat 99.07
KOG0818|consensus669 99.03
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.97
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.96
KOG0506|consensus622 98.91
KOG0783|consensus 1267 98.85
KOG0506|consensus622 98.84
KOG0783|consensus 1267 98.82
KOG0522|consensus560 98.72
KOG0818|consensus 669 98.69
KOG0782|consensus1004 98.64
KOG2384|consensus223 98.62
KOG0782|consensus1004 98.58
KOG3609|consensus 822 98.56
KOG0705|consensus749 98.52
KOG2384|consensus223 98.49
KOG0522|consensus 560 98.46
KOG0705|consensus749 98.46
KOG0511|consensus516 98.39
KOG3609|consensus 822 98.35
KOG0511|consensus 516 98.34
KOG0521|consensus785 98.18
KOG0521|consensus785 98.16
KOG0520|consensus 975 97.95
KOG0520|consensus 975 97.79
KOG2505|consensus591 97.5
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.29
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.19
KOG2505|consensus591 96.93
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 96.73
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 96.64
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 96.57
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 96.28
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 95.37
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 95.11
PLN03077 857 Protein ECB2; Provisional 93.79
PLN032181060 maturation of RBCL 1; Provisional 92.77
PLN03077 857 Protein ECB2; Provisional 91.95
PLN03218 1060 maturation of RBCL 1; Provisional 90.92
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 90.05
>KOG4177|consensus Back     alignment and domain information
Probab=100.00  E-value=3.2e-59  Score=463.24  Aligned_cols=486  Identities=31%  Similarity=0.441  Sum_probs=401.6

Q ss_pred             cCCCCCChhhHHhhcCChhHHHHHHhhcCCCCChhh------------------------------hHhhhcCchHHHHH
Q psy12891          6 SGKLRETPLHIAARVKDGDRCALMLLKSGAGPNLTN------------------------------IAARVKDGDRCALM   55 (567)
Q Consensus         6 ~~~~~~t~L~~A~~~g~~~~v~~~L~~~g~~~~~~~------------------------------~~a~~~~~~~~~~~   55 (567)
                      .+..|.||||.|++.|+.+ +..+|+..|++++...                              ..++.+.+.++.++
T Consensus       116 ~~~~~lTpLh~aa~~g~~~-~~~~ll~~~a~~~~k~~~g~t~l~~a~~~~~~~ll~~~~~~d~l~~~~~~~~~~~~~~~l  194 (1143)
T KOG4177|consen  116 RDRDGLTPLHCAARKGHVQ-VIELLLQHGAPINIKTKNGLSPLHMAAQVACARLLLEYKAPDYLRLHVAAHCGHARVAKL  194 (1143)
T ss_pred             cccCCCcchhhhcccccHH-HHHHHHHccCCCcccccCCCCchhhhcchhhhHHhhhcccchhhhhhHHhhcchHHHHhh
Confidence            4566777777777777766 4445666666555332                              24555666677777


Q ss_pred             HHhcCCCCCCCCCCCChHHHHHHHhCCHHHHHHHHHcCCCCCCCCCCCCChhHHHHhcCchhHHHHHHHhhhhhhhhHHh
Q psy12891         56 LLKSGAGPNLTTDDGQTPVHAAAKYGNLVTLQLLLEDGGDPMYKNKIGETPLHLASRNCKAEVVDLLIQFVQNISQEKVL  135 (567)
Q Consensus        56 Ll~~g~~~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~ga~~~~~~~~g~t~L~~A~~~~~~~iv~~Ll~~~~~~~~~~~~  135 (567)
                      |+...++++..+.+|.||||.||..+.++++++++.+|+++...|..|.||||.|+..|+.+++.+|+++|+.       
T Consensus       195 l~~~~~~~~a~~~~~~tpl~~a~~~nri~~~eLll~~gadv~a~d~~gl~~lh~a~~~g~~~i~~~l~~~ga~-------  267 (1143)
T KOG4177|consen  195 LLDKKADPNASALNGFTPLHIACKKNRIKVVELLLKHGADVSAKDESGLTPLHVAAFMGHLDIVKLLLQHGAS-------  267 (1143)
T ss_pred             hhcccCCccccccCCCCchhhhccccccceeeeeeeccCcCCcccccCccHHHHHHhccchhHHHHHHhcccc-------
Confidence            7777777777777777777777777777777777777777777777777777777777777777777777776       


Q ss_pred             hhhcccccccccHHHHHHHhCCcccccccccccHHHHHHHHHcCCCccccccCCCccHHHHHHhcCCHHHHHHHHHhccC
Q psy12891        136 EYVNSVNEDGASALHYACQVTKAELIPITSKEDQKTVKLLLEAGADVSLQTKQNHETAFHYCAVAGNNDVLTGMLEQMSG  215 (567)
Q Consensus       136 ~~~~~~~~~~~t~L~~a~~~~~~~~~~~~~~~~~~~v~~Ll~~g~~~~~~~~~~~~~~l~~a~~~~~~~~~~~Ll~~~~~  215 (567)
                        ++..+..+.||+|.|+.           .+..++.++|+++|+++....... .+|+|.|...|..++++.+++.+..
T Consensus       268 --~~~~~vr~~tplh~AA~-----------~~~~e~~~~ll~~ga~~~~~~~~~-kt~l~~a~~~g~~~i~~~~l~~~~~  333 (1143)
T KOG4177|consen  268 --VNVSTVRGETPLHMAAR-----------AGQVEVCKLLLQNGADVLAKARDD-QTPLHIASRLGHEEIVHLLLQAGAT  333 (1143)
T ss_pred             --cCcccccccCcchhhhc-----------cchhhhHhhhhccCcccccccccc-cChhhhhcccchHHHHHHHhhccCC
Confidence              56667777777777776           344555777777777777666554 7777777777777777777776554


Q ss_pred             cchhhhhhcCCCCCChHHHHHHhcCcHHHHHHHHhCCCCCCccCCCCCCHHHHHHHcCCeeeeccccccccccccCCCCC
Q psy12891        216 TEISKALNKQTSIGWTPLLIACNRGHMELVNTMLNNHARVDVFDQEGRSALHLAAEHGYLKVSSGKSLKHSVMSFRLPPH  295 (567)
Q Consensus       216 ~~~~~~~~~~~~~~~~~L~~A~~~~~~~~v~~Ll~~g~~~~~~~~~~~t~l~~a~~~~~~~~~~~~~~~~~~~~~~~~~~  295 (567)
                      .      +..+..+.+|+|.++..++.++..++...+..-...+..+.+|++.|+.+|..++++                
T Consensus       334 ~------~aar~~g~t~lHlaa~~~~~~~~~~l~~~~~~~~~a~~k~~~pl~la~~~g~~~~v~----------------  391 (1143)
T KOG4177|consen  334 P------NAARTAGYTPLHLAAKEGQVEVAGALLEHGAQRRQAEEKGFTPLHLAVKSGRVSVVE----------------  391 (1143)
T ss_pred             c------cccCcCCcccccHhhhhhhHHHHHHhhccccccCcccccCCcchhhhcccCchhHHH----------------
Confidence            3      456667778888888888777777777777777777777788888888888777776                


Q ss_pred             CCCCCCccccchhhhhhhhhhcCCCHHHHHHHcCcHHHHHHHHHcCCCCCCcCcCCCCHHHHHHHcC-CHHHHHHHHHhC
Q psy12891        296 NIIPNGFLVHDHAAVIDILTLRKQTPLHLAAEAGQLQVCKLLLDLGASIDATDDQGQKPIHVAAQNN-FPEVAQIFLRAH  374 (567)
Q Consensus       296 ~~~~~~~ll~~~~~~~~~~~~~~~t~L~~a~~~~~~~~v~~Ll~~g~~~~~~~~~g~t~L~~A~~~~-~~~~~~~Ll~~~  374 (567)
                             ++...+..++.....|.||||.|+..++.++++.++++|++++..+..|.|++|+|+..+ ..++...++..+
T Consensus       392 -------Lll~~ga~~~~~gk~gvTplh~aa~~~~~~~v~l~l~~gA~~~~~~~lG~T~lhvaa~~g~~~~~~~~l~~~g  464 (1143)
T KOG4177|consen  392 -------LLLEAGADPNSAGKNGVTPLHVAAHYGNPRVVKLLLKRGASPNAKAKLGYTPLHVAAKKGRYLQIARLLLQYG  464 (1143)
T ss_pred             -------hhhhccCCcccCCCCCcceeeehhhccCcceEEEEeccCCChhhHhhcCCChhhhhhhcccHhhhhhhHhhcC
Confidence                   888888889999999999999999999999999999999999999999999999999999 777887777776


Q ss_pred             CCCccccCCCCCcHHHHHHHcCCHHHHHHHHhcCCCcccccCCCCCCCCHHHHHHHcCcHHHHHHHHHcCCCCCCccCcC
Q psy12891        375 PSLVTATTKDGNTCAHIAAMQGSVGVIEELMKFDRSGVISARNRVTEATPLQLAAEGGHANVVRVLVKAGASCTDENKTG  454 (567)
Q Consensus       375 ~~~~~~~~~~~~~~l~~a~~~~~~~~~~~ll~~~~~~~~~~~~~~~~~t~L~~A~~~~~~~~v~~Ll~~g~~~~~~~~~g  454 (567)
                      .+ .+.....|.||||.|+..|+.+++..+++.+..   .......+.++||.|...+...+++.++++|++++.++..|
T Consensus       465 ~~-~n~~s~~G~T~Lhlaaq~Gh~~~~~llle~~~~---~~~~~~~~l~~lhla~~~~~v~~~~~l~~~ga~v~~~~~r~  540 (1143)
T KOG4177|consen  465 AD-PNAVSKQGFTPLHLAAQEGHTEVVQLLLEGGAN---DNLDAKKGLTPLHLAADEDTVKVAKILLEHGANVDLRTGRG  540 (1143)
T ss_pred             CC-cchhccccCcchhhhhccCCchHHHHhhhcCCc---cCccchhccchhhhhhhhhhHHHHHHHhhcCCceehhcccc
Confidence            66 788899999999999999999999999997633   33334478899999999999999999999999999999999


Q ss_pred             CcHHHHHHHcCcHHHHHHHHhcccccccccccCCcHHHHHHHcCCHHHHHHHHhcCCCCCCCCCCCCcccccccCCCCCC
Q psy12891        455 FTAVHLAAQNGHNQVLEEMRSSKALNVYSKKLGVTALHVAAYFGQADTVRELLSHVPGTVKSDPPTGASFLGELGSESGM  534 (567)
Q Consensus       455 ~t~l~~A~~~~~~~~v~~Ll~~~~~~~~~~~~g~t~l~~A~~~~~~~~~~~Ll~~~~~~~~~~~~~~~~~~~~~~~~~g~  534 (567)
                      .||||.|+.+|++++|++|+++|++.+.+++.|+||||.|+..|+.+++.+|++++++.             +..|.+|.
T Consensus       541 ~TpLh~A~~~g~v~~VkfLLe~gAdv~ak~~~G~TPLH~Aa~~G~~~i~~LLlk~GA~v-------------na~d~~g~  607 (1143)
T KOG4177|consen  541 YTPLHVAVHYGNVDLVKFLLEHGADVNAKDKLGYTPLHQAAQQGHNDIAELLLKHGASV-------------NAADLDGF  607 (1143)
T ss_pred             cchHHHHHhcCCchHHHHhhhCCccccccCCCCCChhhHHHHcChHHHHHHHHHcCCCC-------------CcccccCc
Confidence            99999999999999999999999999999999999999999999999999999998876             78899999


Q ss_pred             CHHHHHHHcCCHHHHHHHHhccCCcc
Q psy12891        535 TPLHLAAYSGNENVVRLLLNSAGVQV  560 (567)
Q Consensus       535 t~l~~A~~~~~~~~v~~Ll~~~g~~~  560 (567)
                      |||++|++.|+++++++|+.. |+++
T Consensus       608 TpL~iA~~lg~~~~~k~l~~~-~~~~  632 (1143)
T KOG4177|consen  608 TPLHIAVRLGYLSVVKLLKVV-TATP  632 (1143)
T ss_pred             chhHHHHHhcccchhhHHHhc-cCcc
Confidence            999999999999999999985 8885



>KOG4177|consensus Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4412|consensus Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4412|consensus Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query567
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 1e-32
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 2e-30
1n11_A 437 D34 Region Of Human Ankyrin-R And Linker Length = 4 1e-20
1n11_A 437 D34 Region Of Human Ankyrin-R And Linker Length = 4 3e-08
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 3e-19
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 2e-14
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 6e-19
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 8e-08
2xeh_A157 Structural Determinants For Improved Thermal Stabil 1e-18
2xeh_A157 Structural Determinants For Improved Thermal Stabil 9e-13
2xee_A157 Structural Determinants For Improved Thermal Stabil 2e-18
2xee_A157 Structural Determinants For Improved Thermal Stabil 3e-13
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 5e-18
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 3e-11
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 4e-17
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 5e-07
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 7e-17
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 4e-09
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 2e-16
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 2e-10
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 9e-16
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 2e-08
3utm_A351 Crystal Structure Of A Mouse Tankyrase-Axin Complex 1e-15
3utm_A351 Crystal Structure Of A Mouse Tankyrase-Axin Complex 5e-05
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 1e-15
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 2e-15
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 7e-11
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 2e-15
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 7e-14
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 4e-15
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 2e-10
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 7e-15
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 1e-08
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 1e-14
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 4e-09
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 1e-14
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 7e-12
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 3e-14
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 8e-09
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 7e-14
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 4e-13
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 6e-12
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 7e-14
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 6e-10
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 8e-14
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 7e-13
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 2e-11
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 9e-14
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 1e-10
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 1e-13
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 4e-10
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 7e-06
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 1e-13
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 7e-13
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 2e-13
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 2e-11
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 2e-13
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 1e-11
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 1e-12
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 2e-04
1uoh_A226 Human Gankyrin Length = 226 2e-12
1uoh_A226 Human Gankyrin Length = 226 2e-04
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 9e-12
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 3e-11
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 8e-11
1awc_B153 Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 7e-11
1awc_B153 Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 4e-10
1awc_B153 Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 2e-05
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 7e-11
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 1e-04
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 1e-10
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 2e-10
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 1e-04
1nfi_E213 I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 3e-10
1wdy_A285 Crystal Structure Of Ribonuclease Length = 285 3e-10
1wdy_A285 Crystal Structure Of Ribonuclease Length = 285 5e-04
2dzn_A228 Crystal Structure Analysis Of Yeast Nas6p Complexed 4e-10
1ixv_A231 Crystal Structure Analysis Of Homolog Of Oncoprotei 4e-10
1wg0_A243 Structural Comparison Of Nas6p Protein Structures I 4e-10
1ikn_D236 IkappabalphaNF-Kappab Complex Length = 236 5e-10
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 7e-10
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 5e-06
4g8k_A337 Intact Sensor Domain Of Human Rnase L In The Inacti 9e-10
4g8k_A337 Intact Sensor Domain Of Human Rnase L In The Inacti 7e-04
3eu9_A240 The Ankyrin Repeat Domain Of Huntingtin Interacting 2e-09
3eu9_A240 The Ankyrin Repeat Domain Of Huntingtin Interacting 2e-07
1s70_B299 Complex Between Protein Ser/thr Phosphatase-1 (delt 3e-09
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 3e-09
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 1e-05
2he0_A253 Crystal Structure Of A Human Notch1 Ankyrin Domain 4e-09
2he0_A253 Crystal Structure Of A Human Notch1 Ankyrin Domain 1e-04
2f8y_A223 Crystal Structure Of Human Notch1 Ankyrin Repeats T 6e-09
2f8y_A223 Crystal Structure Of Human Notch1 Ankyrin Repeats T 3e-05
2f8x_K256 Crystal Structure Of Activated Notch, Csl And Maml 6e-09
2f8x_K256 Crystal Structure Of Activated Notch, Csl And Maml 4e-05
1k1b_A241 Crystal Structure Of The Ankyrin Repeat Domain Of B 6e-09
1yyh_A253 Crystal Structure Of The Human Notch 1 Ankyrin Doma 7e-09
1yyh_A253 Crystal Structure Of The Human Notch 1 Ankyrin Doma 4e-05
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 1e-08
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 2e-07
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 4e-05
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 1e-08
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 3e-08
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 3e-07
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 1e-08
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 1e-07
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 6e-07
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 7e-06
1ap7_A168 P19-Ink4d From Mouse, Nmr, 20 Structures Length = 1 1e-08
1ap7_A168 P19-Ink4d From Mouse, Nmr, 20 Structures Length = 1 6e-04
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 1e-08
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 8e-08
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 3e-06
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 8e-06
1blx_B166 P19ink4dCDK6 COMPLEX Length = 166 1e-08
1blx_B166 P19ink4dCDK6 COMPLEX Length = 166 5e-04
2qc9_A210 Mouse Notch 1 Ankyrin Repeat Intracellular Domain L 2e-08
2qc9_A210 Mouse Notch 1 Ankyrin Repeat Intracellular Domain L 4e-05
2rfm_A192 Structure Of A Thermophilic Ankyrin Repeat Protein 2e-08
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 4e-08
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 4e-08
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 4e-06
1bd8_A156 Structure Of Cdk Inhibitor P19ink4d Length = 156 5e-08
1bd8_A156 Structure Of Cdk Inhibitor P19ink4d Length = 156 1e-05
1bi8_B166 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 5e-08
1bi8_B166 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 1e-05
4b93_B269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 7e-08
4b93_B269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 4e-05
2rfa_A232 Crystal Structure Of The Mouse Trpv6 Ankyrin Repeat 7e-08
3twq_A175 Crystal Structure Of Arc4 From Human Tankyrase 2 (A 1e-07
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 1e-07
3twr_A165 Crystal Structure Of Arc4 From Human Tankyrase 2 In 2e-07
3twu_A167 Crystal Structure Of Arc4 From Human Tankyrase 2 In 2e-07
3f6q_A179 Crystal Structure Of Integrin-Linked Kinase Ankyrin 2e-07
3f6q_A179 Crystal Structure Of Integrin-Linked Kinase Ankyrin 1e-05
3f6q_A179 Crystal Structure Of Integrin-Linked Kinase Ankyrin 2e-05
2kbx_A171 Solution Structure Of Ilk-Pinch Complex Length = 17 2e-07
2kbx_A171 Solution Structure Of Ilk-Pinch Complex Length = 17 2e-05
3c5r_A137 Crystal Structure Of The Bard1 Ankyrin Repeat Domai 4e-07
3c5r_A137 Crystal Structure Of The Bard1 Ankyrin Repeat Domai 1e-04
2fo1_E373 Crystal Structure Of The Csl-Notch-Mastermind Terna 6e-07
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 1e-06
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 2e-05
3v2x_A167 Crystal Structure Of The Peptide Bound Complex Of T 2e-06
3v2x_A167 Crystal Structure Of The Peptide Bound Complex Of T 7e-05
3so8_A162 Crystal Structure Of Ankra Length = 162 2e-06
3so8_A162 Crystal Structure Of Ankra Length = 162 6e-05
3v2o_A183 Crystal Structure Of The Peptide Bound Complex Of T 2e-06
3v2o_A183 Crystal Structure Of The Peptide Bound Complex Of T 7e-05
1ot8_A239 Structure Of The Ankyrin Domain Of The Drosophila N 2e-06
1mx6_A168 Structure Of P18ink4c (F92n) Length = 168 6e-06
1mx2_A168 Structure Of F71n Mutant Of P18ink4c Length = 168 9e-06
1mx4_A168 Structure Of P18ink4c (F82q) Length = 168 1e-05
1mx4_A168 Structure Of P18ink4c (F82q) Length = 168 1e-04
3ehq_A222 Crystal Structure Of Human Osteoclast Stimulating F 1e-05
1ihb_A162 Crystal Structure Of P18-Ink4c(Ink6) Length = 162 1e-05
3zkj_A261 Crystal Structure Of Ankyrin Repeat And Socs Box-co 2e-05
1bu9_A168 Solution Structure Of P18-Ink4c, 21 Structures Leng 2e-05
3d9h_A285 Crystal Structure Of The Splice Variant Of Human As 2e-05
2zgg_A92 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 5e-05
2zgg_A92 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 3e-04
1ymp_A135 The Crystal Structure Of A Partial Mouse Notch-1 An 8e-05
3hra_A201 Crystal Structure Of Ef0377 An Ankyrin Repeat Prote 8e-05
2xen_A91 Structural Determinants For Improved Thermal Stabil 1e-04
2zgd_A110 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 1e-04
2zgd_A110 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 1e-04
3v30_A172 Crystal Structure Of The Peptide Bound Complex Of T 3e-04
4a63_B239 Crystal Structure Of The P73-Aspp2 Complex At 2.6a 4e-04
1ycs_B239 P53-53bp2 Complex Length = 239 4e-04
3ljn_A364 Ankyrin Repeat Protein From Leishmania Major Length 5e-04
3uxg_A172 Crystal Structure Of Rfxank Length = 172 5e-04
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure

Iteration: 1

Score = 137 bits (346), Expect = 1e-32, Method: Compositional matrix adjust. Identities = 127/433 (29%), Positives = 199/433 (45%), Gaps = 66/433 (15%) Query: 72 TPVHAAAKYGNLVTLQLLLEDGGDPMYKNKIGETPLHLASRNCKAEVVDLLIQFVQNISQ 131 TP+H A+ G+L ++ LL+ G P N ETPLH+A+R EV L+Q ++ Sbjct: 16 TPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQ-----NK 70 Query: 132 EKVLEYVNSVNEDGASALHYACQVTKAELIPITSKEDQKTVKLLLEAGADVSLQTKQNHE 191 K VN+ +D + LH A ++ + VKLLLE A+ +L T H Sbjct: 71 AK----VNAKAKDDQTPLHCAARIGHTNM-----------VKLLLENNANPNLATTAGH- 114 Query: 192 TAFHYCAVAGNNDVLTGMLEQMSGTEISKALNKQTSIGWTPLLIACNRGHMELVNTMLNN 251 T H A G+ + + +LE+ E S+A T G+TPL +A G + + +L Sbjct: 115 TPLHIAAREGHVETVLALLEK----EASQAC--MTKKGFTPLHVAAKYGKVRVAELLLER 168 Query: 252 HARVDVFDQEGRSALHLAAEHGYLKVSSGKSLKHSVMSFRLP----PHNIIPNGFLVHDH 307 A + + G + LH+A H L ++ LP PH+ NG+ Sbjct: 169 DAHPNAAGKNGLTPLHVAVHHNNL----------DIVKLLLPRGGSPHSPAWNGY----- 213 Query: 308 AAVIDILTLRKQTPLHLAAEAGQLQVCKLLLDLGASIDATDDQGQKPIHVAAQNNFPEVA 367 TPLH+AA+ Q++V + LL G S +A QG P+H+AAQ E+ Sbjct: 214 ------------TPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMV 261 Query: 368 QIFL--RAHPSLVTATTKDGNTCAHIAAMQGSVGVIEELMKFDRSGVISARNRVTEATPL 425 + L +A+ +L K G T H+ A +G V V + L+K GV+ TPL Sbjct: 262 ALLLSKQANGNL---GNKSGLTPLHLVAQEGHVPVADVLIKH---GVMVDATTRMGYTPL 315 Query: 426 QLAAEGGHANVVRVLVKAGASCTDENKTGFTAVHLAAQNGHNQVLEEMRSSKALNVYSKK 485 +A+ G+ +V+ L++ A + K G++ +H AAQ GH ++ + + A Sbjct: 316 HVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSS 375 Query: 486 LGVTALHVAAYFG 498 G T L +A G Sbjct: 376 DGTTPLAIAKRLG 388
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 Back     alignment and structure
>pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 Back     alignment and structure
>pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 Back     alignment and structure
>pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|1NFI|E Chain E, I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 Back     alignment and structure
>pdb|1WDY|A Chain A, Crystal Structure Of Ribonuclease Length = 285 Back     alignment and structure
>pdb|1WDY|A Chain A, Crystal Structure Of Ribonuclease Length = 285 Back     alignment and structure
>pdb|2DZN|A Chain A, Crystal Structure Analysis Of Yeast Nas6p Complexed With The Proteasome Subunit, Rpt3 Length = 228 Back     alignment and structure
>pdb|1IXV|A Chain A, Crystal Structure Analysis Of Homolog Of Oncoprotein Gankyrin, An Interactor Of Rb And Cdk46 Length = 231 Back     alignment and structure
>pdb|1WG0|A Chain A, Structural Comparison Of Nas6p Protein Structures In Two Different Crystal Forms Length = 243 Back     alignment and structure
>pdb|1IKN|D Chain D, IkappabalphaNF-Kappab Complex Length = 236 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|4G8K|A Chain A, Intact Sensor Domain Of Human Rnase L In The Inactive Signaling State Length = 337 Back     alignment and structure
>pdb|4G8K|A Chain A, Intact Sensor Domain Of Human Rnase L In The Inactive Signaling State Length = 337 Back     alignment and structure
>pdb|3EU9|A Chain A, The Ankyrin Repeat Domain Of Huntingtin Interacting Protein 14 Length = 240 Back     alignment and structure
>pdb|3EU9|A Chain A, The Ankyrin Repeat Domain Of Huntingtin Interacting Protein 14 Length = 240 Back     alignment and structure
>pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|2HE0|A Chain A, Crystal Structure Of A Human Notch1 Ankyrin Domain Mutant Length = 253 Back     alignment and structure
>pdb|2HE0|A Chain A, Crystal Structure Of A Human Notch1 Ankyrin Domain Mutant Length = 253 Back     alignment and structure
>pdb|2F8Y|A Chain A, Crystal Structure Of Human Notch1 Ankyrin Repeats To 1.55a Resolution. Length = 223 Back     alignment and structure
>pdb|2F8Y|A Chain A, Crystal Structure Of Human Notch1 Ankyrin Repeats To 1.55a Resolution. Length = 223 Back     alignment and structure
>pdb|2F8X|K Chain K, Crystal Structure Of Activated Notch, Csl And Maml On Hes-1 Promoter Dna Sequence Length = 256 Back     alignment and structure
>pdb|2F8X|K Chain K, Crystal Structure Of Activated Notch, Csl And Maml On Hes-1 Promoter Dna Sequence Length = 256 Back     alignment and structure
>pdb|1K1B|A Chain A, Crystal Structure Of The Ankyrin Repeat Domain Of Bcl-3: A Unique Member Of The Ikappab Protein Family Length = 241 Back     alignment and structure
>pdb|1YYH|A Chain A, Crystal Structure Of The Human Notch 1 Ankyrin Domain Length = 253 Back     alignment and structure
>pdb|1YYH|A Chain A, Crystal Structure Of The Human Notch 1 Ankyrin Domain Length = 253 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|1AP7|A Chain A, P19-Ink4d From Mouse, Nmr, 20 Structures Length = 168 Back     alignment and structure
>pdb|1AP7|A Chain A, P19-Ink4d From Mouse, Nmr, 20 Structures Length = 168 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|1BLX|B Chain B, P19ink4dCDK6 COMPLEX Length = 166 Back     alignment and structure
>pdb|1BLX|B Chain B, P19ink4dCDK6 COMPLEX Length = 166 Back     alignment and structure
>pdb|2QC9|A Chain A, Mouse Notch 1 Ankyrin Repeat Intracellular Domain Length = 210 Back     alignment and structure
>pdb|2QC9|A Chain A, Mouse Notch 1 Ankyrin Repeat Intracellular Domain Length = 210 Back     alignment and structure
>pdb|2RFM|A Chain A, Structure Of A Thermophilic Ankyrin Repeat Protein Length = 192 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|1BD8|A Chain A, Structure Of Cdk Inhibitor P19ink4d Length = 156 Back     alignment and structure
>pdb|1BD8|A Chain A, Structure Of Cdk Inhibitor P19ink4d Length = 156 Back     alignment and structure
>pdb|1BI8|B Chain B, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 166 Back     alignment and structure
>pdb|1BI8|B Chain B, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 166 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure
>pdb|2RFA|A Chain A, Crystal Structure Of The Mouse Trpv6 Ankyrin Repeat Domain Length = 232 Back     alignment and structure
>pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 Back     alignment and structure
>pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 Back     alignment and structure
>pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 Back     alignment and structure
>pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 Back     alignment and structure
>pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 Back     alignment and structure
>pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 Back     alignment and structure
>pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 Back     alignment and structure
>pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 Back     alignment and structure
>pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 Back     alignment and structure
>pdb|2FO1|E Chain E, Crystal Structure Of The Csl-Notch-Mastermind Ternary Complex Bound To Dna Length = 373 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|3V2X|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 167 Back     alignment and structure
>pdb|3V2X|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 167 Back     alignment and structure
>pdb|3SO8|A Chain A, Crystal Structure Of Ankra Length = 162 Back     alignment and structure
>pdb|3SO8|A Chain A, Crystal Structure Of Ankra Length = 162 Back     alignment and structure
>pdb|3V2O|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 183 Back     alignment and structure
>pdb|3V2O|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 183 Back     alignment and structure
>pdb|1OT8|A Chain A, Structure Of The Ankyrin Domain Of The Drosophila Notch Receptor Length = 239 Back     alignment and structure
>pdb|1MX6|A Chain A, Structure Of P18ink4c (F92n) Length = 168 Back     alignment and structure
>pdb|1MX2|A Chain A, Structure Of F71n Mutant Of P18ink4c Length = 168 Back     alignment and structure
>pdb|1MX4|A Chain A, Structure Of P18ink4c (F82q) Length = 168 Back     alignment and structure
>pdb|1MX4|A Chain A, Structure Of P18ink4c (F82q) Length = 168 Back     alignment and structure
>pdb|3EHQ|A Chain A, Crystal Structure Of Human Osteoclast Stimulating Factor Length = 222 Back     alignment and structure
>pdb|1IHB|A Chain A, Crystal Structure Of P18-Ink4c(Ink6) Length = 162 Back     alignment and structure
>pdb|3ZKJ|A Chain A, Crystal Structure Of Ankyrin Repeat And Socs Box-containing Protein 9 (asb9) In Complex With Elonginb And Elonginc Length = 261 Back     alignment and structure
>pdb|1BU9|A Chain A, Solution Structure Of P18-Ink4c, 21 Structures Length = 168 Back     alignment and structure
>pdb|3D9H|A Chain A, Crystal Structure Of The Splice Variant Of Human Asb9 (Hasb9-2), An Ankyrin Repeat Protein Length = 285 Back     alignment and structure
>pdb|2ZGG|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 92 Back     alignment and structure
>pdb|2ZGG|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 92 Back     alignment and structure
>pdb|1YMP|A Chain A, The Crystal Structure Of A Partial Mouse Notch-1 Ankyrin Domain: Repeats 4 Through 7 Preserve An Ankyrin Fold Length = 135 Back     alignment and structure
>pdb|3HRA|A Chain A, Crystal Structure Of Ef0377 An Ankyrin Repeat Protein Length = 201 Back     alignment and structure
>pdb|2XEN|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module Length = 91 Back     alignment and structure
>pdb|2ZGD|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 110 Back     alignment and structure
>pdb|2ZGD|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 110 Back     alignment and structure
>pdb|3V30|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Rfxank Length = 172 Back     alignment and structure
>pdb|4A63|B Chain B, Crystal Structure Of The P73-Aspp2 Complex At 2.6a Resolution Length = 239 Back     alignment and structure
>pdb|1YCS|B Chain B, P53-53bp2 Complex Length = 239 Back     alignment and structure
>pdb|3LJN|A Chain A, Ankyrin Repeat Protein From Leishmania Major Length = 364 Back     alignment and structure
>pdb|3UXG|A Chain A, Crystal Structure Of Rfxank Length = 172 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query567
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 7e-88
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 7e-84
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 8e-68
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 7e-67
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-55
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-50
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-40
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-65
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 5e-60
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-56
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 4e-48
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 3e-41
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-08
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-58
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 6e-58
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 5e-54
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 4e-23
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-13
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-04
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-53
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-45
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-45
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 9e-45
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 7e-44
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 8e-36
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-35
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-18
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-52
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 6e-43
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 4e-42
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 9e-42
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 9e-40
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-32
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-25
3d9h_A 285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-20
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 5e-18
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-51
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-48
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-48
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-44
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-41
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 6e-29
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-50
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-48
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 6e-48
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 5e-47
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-40
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-25
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-24
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-10
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-48
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-47
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 5e-45
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 4e-43
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 8e-25
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 8e-16
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 6e-05
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 5e-48
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 7e-39
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-34
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 3e-31
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-23
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-47
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 8e-46
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-43
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 4e-43
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-40
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-34
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 4e-31
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-30
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-08
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 6e-46
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-44
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 5e-43
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 8e-39
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-37
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-36
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-26
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-20
3eu9_A 240 Huntingtin-interacting protein 14; epigenetics, an 1e-10
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-09
3eu9_A 240 Huntingtin-interacting protein 14; epigenetics, an 8e-04
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-45
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-43
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-43
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 8e-42
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 6e-37
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-34
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 6e-31
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-19
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 8e-08
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 3e-43
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 5e-41
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 7e-36
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 9e-36
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-34
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 3e-34
2dzn_A 228 Probable 26S proteasome regulatory subunit P28; an 6e-08
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 6e-43
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 7e-39
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-32
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-31
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-23
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-09
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 3e-42
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 9e-42
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-36
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-35
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-32
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-30
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-08
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 9e-42
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 7e-41
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 9e-38
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-37
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-28
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 5e-22
1yyh_A 253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-13
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-09
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-41
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 8e-41
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 3e-40
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 9e-39
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-33
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 3e-31
1ikn_D 236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-15
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 6e-13
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-38
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-38
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-36
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-33
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 5e-33
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 4e-30
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-24
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-20
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-08
2pnn_A273 Transient receptor potential cation channel subfa 1e-37
2pnn_A273 Transient receptor potential cation channel subfa 2e-27
2pnn_A273 Transient receptor potential cation channel subfa 6e-27
2pnn_A273 Transient receptor potential cation channel subfa 1e-24
2pnn_A273 Transient receptor potential cation channel subfa 4e-20
2pnn_A273 Transient receptor potential cation channel subfa 2e-15
2rfa_A232 Transient receptor potential cation channel subfa 1e-36
2rfa_A232 Transient receptor potential cation channel subfa 1e-36
2rfa_A232 Transient receptor potential cation channel subfa 5e-30
2rfa_A232 Transient receptor potential cation channel subfa 8e-29
2rfa_A232 Transient receptor potential cation channel subfa 7e-28
2rfa_A232 Transient receptor potential cation channel subfa 4e-20
2rfa_A 232 Transient receptor potential cation channel subfa 5e-07
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 6e-35
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-33
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 4e-33
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 9e-31
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-30
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 9e-29
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 6e-21
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 3e-19
3aji_A 231 26S proteasome non-ATPase regulatory subunit 10; g 9e-12
2etb_A256 Transient receptor potential cation channel subfam 2e-34
2etb_A256 Transient receptor potential cation channel subfam 4e-28
2etb_A256 Transient receptor potential cation channel subfam 3e-27
2etb_A256 Transient receptor potential cation channel subfam 1e-20
2etb_A256 Transient receptor potential cation channel subfam 4e-16
2etb_A256 Transient receptor potential cation channel subfam 3e-14
3hra_A201 Ankyrin repeat family protein; structural protein; 3e-34
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-32
3hra_A201 Ankyrin repeat family protein; structural protein; 5e-31
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-29
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-23
3hra_A201 Ankyrin repeat family protein; structural protein; 8e-17
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-15
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-04
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-33
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-31
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-31
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-30
3v31_A167 Ankyrin repeat family A protein 2; structural geno 5e-28
3v31_A167 Ankyrin repeat family A protein 2; structural geno 7e-28
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-19
3v31_A167 Ankyrin repeat family A protein 2; structural geno 8e-10
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 3e-33
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 3e-33
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 8e-32
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 5e-28
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-23
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 6e-23
3ui2_A 244 Signal recognition particle 43 kDa protein, chlor; 5e-06
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-32
1sw6_A327 Regulatory protein SWI6; transcription regulation, 1e-24
1sw6_A327 Regulatory protein SWI6; transcription regulation, 5e-23
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-19
1sw6_A327 Regulatory protein SWI6; transcription regulation, 4e-17
1sw6_A 327 Regulatory protein SWI6; transcription regulation, 1e-05
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 7e-32
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-29
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 3e-29
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-27
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 5e-26
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 4e-25
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 9e-25
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 3e-21
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 6e-18
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-31
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-31
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-30
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-30
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-28
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-28
3v30_A172 DNA-binding protein rfxank; structural genomics co 4e-28
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-19
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-31
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 3e-30
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-27
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 4e-27
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-24
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-24
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 3e-22
1ycs_B 239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 4e-18
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-31
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-28
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 5e-26
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 6e-25
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 8e-24
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 3e-23
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 3e-21
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-31
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 5e-30
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 8e-30
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-28
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 7e-28
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 5e-27
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-26
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 9e-25
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-20
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 7e-17
3f6q_A 179 Integrin-linked protein kinase; ILK, integrin-link 5e-05
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 3e-31
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-28
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-25
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-24
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 9e-24
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-19
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-16
2vge_A 229 RELA-associated inhibitor; iaspp, nucleus, apoptos 5e-16
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-12
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 6e-31
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 5e-30
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-28
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-27
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 5e-27
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 7e-25
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-24
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 6e-23
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 3e-17
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 8e-14
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 3e-05
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 5e-30
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 6e-26
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-25
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-23
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-21
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-19
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 5e-19
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 8e-16
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 7e-10
3deo_A183 Signal recognition particle 43 kDa protein; chloro 3e-29
3deo_A183 Signal recognition particle 43 kDa protein; chloro 4e-29
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-27
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-24
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-23
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-23
3deo_A183 Signal recognition particle 43 kDa protein; chloro 4e-23
3deo_A183 Signal recognition particle 43 kDa protein; chloro 3e-21
3deo_A183 Signal recognition particle 43 kDa protein; chloro 7e-19
3jxi_A260 Vanilloid receptor-related osmotically activated p 1e-28
3jxi_A260 Vanilloid receptor-related osmotically activated p 7e-20
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-19
3jxi_A260 Vanilloid receptor-related osmotically activated p 9e-19
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-16
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-28
1awc_B153 Protein (GA binding protein beta 1); complex (tran 5e-28
1awc_B153 Protein (GA binding protein beta 1); complex (tran 3e-27
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-26
1awc_B153 Protein (GA binding protein beta 1); complex (tran 3e-23
1awc_B153 Protein (GA binding protein beta 1); complex (tran 3e-21
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-20
1awc_B153 Protein (GA binding protein beta 1); complex (tran 5e-18
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-14
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 3e-28
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 3e-28
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-27
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 3e-27
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-24
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-24
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 4e-24
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 8e-22
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-20
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 8e-15
1bd8_A 156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-04
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-27
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 7e-26
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 1e-24
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-12
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-11
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 6e-06
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 1e-26
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 5e-26
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-25
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 8e-25
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 1e-22
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 5e-22
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 5e-22
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 7e-17
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 4e-26
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-25
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-24
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 3e-24
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 5e-21
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-19
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-19
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 5e-18
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 4e-17
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 4e-11
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-08
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-25
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 4e-25
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 7e-25
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-23
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-20
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-19
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 4e-17
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-11
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 4e-08
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 4e-05
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-25
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 7e-24
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-22
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-22
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-20
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-19
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-19
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 6e-19
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 5e-18
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-15
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-11
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 5e-25
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 4e-23
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 6e-22
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 9e-22
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-20
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-18
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-17
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 3e-17
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 3e-17
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 9e-13
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-05
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 5e-24
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 8e-21
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 8e-21
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-20
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 5e-20
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 5e-15
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-09
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 3e-23
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 5e-19
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 7e-19
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 3e-18
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 7e-18
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 6e-17
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 1e-16
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-15
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 6e-12
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 5e-10
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 6e-05
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-22
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 7e-22
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-21
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 5e-20
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-19
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-17
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 5e-17
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 6e-16
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 6e-13
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 9e-13
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 7e-06
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 8e-19
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 1e-16
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 1e-15
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 1e-15
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 4e-15
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 3e-14
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 4e-13
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 1e-12
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 5e-12
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 1e-18
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 3e-18
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 4e-18
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-16
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 5e-16
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 1e-15
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 8e-15
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 7e-13
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 5e-12
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 3e-11
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 9e-09
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 5e-05
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 9e-14
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 1e-13
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 6e-09
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 1e-08
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 3e-08
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 1e-07
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-07
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 7e-12
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 8e-11
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 3e-08
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 2e-07
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 9e-06
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 2e-04
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 9e-11
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 1e-09
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 1e-09
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 6e-09
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 3e-08
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 3e-04
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 1e-09
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 4e-09
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 4e-08
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 6e-05
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 8e-05
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 3e-04
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
 Score =  277 bits (712), Expect = 7e-88
 Identities = 130/507 (25%), Positives = 195/507 (38%), Gaps = 104/507 (20%)

Query: 60  GAGPNLTTDDGQTPVHAAAKYGNLVTLQLLLEDGGDPMYKNKIGETPLHLASRNCKAEVV 119
           G       + G TP+H A+  G+L  ++ LL+ G  P   N   ETPLH+A+R    EV 
Sbjct: 4   GISGGGGGESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVA 63

Query: 120 DLLIQFVQNISQEKVLEYVNSVNEDGASALHYACQVTKAELIPITSKEDQKTVKLLLEAG 179
             L+Q             VN+  +D  + LH A +                 VKLLLE  
Sbjct: 64  KYLLQ--NKAK-------VNAKAKDDQTPLHCAAR-----------IGHTNMVKLLLENN 103

Query: 180 ADVSLQTKQNHETAFHYCAVAGNNDVLTGMLEQMSGTEISKALNKQTSIGWTPLLIACNR 239
           A+ +L T     T  H  A  G+ + +  +LE+             T  G+TPL +A   
Sbjct: 104 ANPNLATT-AGHTPLHIAAREGHVETVLALLEK--EASQ----ACMTKKGFTPLHVAAKY 156

Query: 240 GHMELVNTMLNNHARVDVFDQEGRSALHLAAEHGYLKVSSGKSLKHSVMSFRLPPHNIIP 299
           G + +   +L   A  +   + G + LH+A  H  L +                      
Sbjct: 157 GKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVK-------------------- 196

Query: 300 NGFLVHDHAAVIDILTLRKQTPLHLAAEAGQLQVCKLLLDLGASIDATDDQGQKPIHVAA 359
              L+               TPLH+AA+  Q++V + LL  G S +A   QG  P+H+AA
Sbjct: 197 --LLL-PRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAA 253

Query: 360 QNNFPEVAQIFLRAHPSLVTATTKDGNTCAHIAAMQGSVGVIEELMKFDRSGVISARNRV 419
           Q    E+  + L +  +      K G T                                
Sbjct: 254 QEGHAEMVALLL-SKQANGNLGNKSGLT-------------------------------- 280

Query: 420 TEATPLQLAAEGGHANVVRVLVKAGASCTDENKTGFTAVHLAAQNGHNQVLEEMRSSKAL 479
               PL L A+ GH  V  VL+K G       + G+T +H+A+  G+ ++++ +   +A 
Sbjct: 281 ----PLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQA- 335

Query: 480 NVYSK-KLGVTALHVAAYFGQADTVRELLSHVPGTVKSDPPTGASFLGELGSESGMTPLH 538
           +V +K KLG + LH AA  G  D V  LL +           GAS      S  G TPL 
Sbjct: 336 DVNAKTKLGYSPLHQAAQQGHTDIVTLLLKN-----------GASP--NEVSSDGTTPLA 382

Query: 539 LAAYSGNENVVRLLLN--SAGVQVDAQ 563
           +A   G  +V  +L         V   
Sbjct: 383 IAKRLGYISVTDVLKVVTDETSFVLVS 409


>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query567
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
1sw6_A327 Regulatory protein SWI6; transcription regulation, 100.0
1sw6_A327 Regulatory protein SWI6; transcription regulation, 100.0
3hra_A201 Ankyrin repeat family protein; structural protein; 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
2pnn_A273 Transient receptor potential cation channel subfa 100.0
4gpm_A169 Engineered protein OR264; de novo protein, structu 100.0
3hra_A201 Ankyrin repeat family protein; structural protein; 100.0
2etb_A256 Transient receptor potential cation channel subfam 100.0
2etb_A256 Transient receptor potential cation channel subfam 100.0
4gpm_A169 Engineered protein OR264; de novo protein, structu 100.0
2pnn_A273 Transient receptor potential cation channel subfa 99.98
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.98
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.98
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.97
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.97
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.97
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.97
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.97
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.97
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.97
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.96
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.96
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.96
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.96
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.96
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.96
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.96
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.96
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.96
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.96
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.96
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.96
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.96
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.95
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.95
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.95
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.95
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.95
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.95
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.94
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.94
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.94
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.93
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.93
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.93
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.93
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.92
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.92
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.92
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.91
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.9
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.9
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.9
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.9
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.89
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.89
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.89
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.89
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.88
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.88
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.88
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.88
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.88
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.87
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.87
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.86
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.85
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.84
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.84
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.84
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.83
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.78
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.76
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 81.02
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
Probab=100.00  E-value=2e-66  Score=507.51  Aligned_cols=397  Identities=31%  Similarity=0.437  Sum_probs=312.7

Q ss_pred             hcCCCCCCCCCCCChHHHHHHHhCCHHHHHHHHHcCCCCCCCCCCCCChhHHHHhcCchhHHHHHHHhhhhhhhhHHhhh
Q psy12891         58 KSGAGPNLTTDDGQTPVHAAAKYGNLVTLQLLLEDGGDPMYKNKIGETPLHLASRNCKAEVVDLLIQFVQNISQEKVLEY  137 (567)
Q Consensus        58 ~~g~~~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~ga~~~~~~~~g~t~L~~A~~~~~~~iv~~Ll~~~~~~~~~~~~~~  137 (567)
                      +.|++++..+..|+||||+||..|+.++|++|+++|++++..+..|.||||+|+..|+.+++++|++.|++         
T Consensus         2 ~~g~~~~~~~~~g~t~L~~Aa~~g~~~~v~~Ll~~g~~~~~~~~~~~t~L~~A~~~g~~~~v~~Ll~~g~~---------   72 (437)
T 1n11_A            2 SPGISGGGGGESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAK---------   72 (437)
T ss_dssp             -------------CCHHHHHHHHTCHHHHHHHHHTTCCSCCSSSCCCCHHHHHHHHTCHHHHHHHHHHTCC---------
T ss_pred             CCCCCccccCCCCCCHHHHHHHCCCHHHHHHHHHcCCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHhCCCC---------
Confidence            46899999999999999999999999999999999999999999999999999999999999999999987         


Q ss_pred             hcccccccccHHHHHHHhCCcccccccccccHHHHHHHHHcCCCccccccCCCccHHHHHHhcCCHHHHHHHHHhccCcc
Q psy12891        138 VNSVNEDGASALHYACQVTKAELIPITSKEDQKTVKLLLEAGADVSLQTKQNHETAFHYCAVAGNNDVLTGMLEQMSGTE  217 (567)
Q Consensus       138 ~~~~~~~~~t~L~~a~~~~~~~~~~~~~~~~~~~v~~Ll~~g~~~~~~~~~~~~~~l~~a~~~~~~~~~~~Ll~~~~~~~  217 (567)
                      ++.++..|.||||+|+..           ++.+++++|+++|++++..+.. +.||||+|+..|+.+++++|++.+... 
T Consensus        73 ~~~~~~~g~t~L~~A~~~-----------g~~~~v~~Ll~~ga~~~~~~~~-g~t~L~~A~~~g~~~~v~~Ll~~~~~~-  139 (437)
T 1n11_A           73 VNAKAKDDQTPLHCAARI-----------GHTNMVKLLLENNANPNLATTA-GHTPLHIAAREGHVETVLALLEKEASQ-  139 (437)
T ss_dssp             SSCCCTTSCCHHHHHHHH-----------TCHHHHHHHHHHTCCTTCCCTT-CCCHHHHHHHHTCHHHHHHHHHTTCCS-
T ss_pred             CCCCCCCCCCHHHHHHHC-----------CCHHHHHHHHhCCCCCCCCCCC-CCcHHHHHHHcCCHHHHHHHHhCCCCC-
Confidence            788899999999999985           4667799999999999876654 599999999999999999999986653 


Q ss_pred             hhhhhhcCCCCCChHHHHHHhcCcHHHHHHHHhCCCCCCccCCCCCCHHHHHHHcCCeeeeccccccccccccCCCCCCC
Q psy12891        218 ISKALNKQTSIGWTPLLIACNRGHMELVNTMLNNHARVDVFDQEGRSALHLAAEHGYLKVSSGKSLKHSVMSFRLPPHNI  297 (567)
Q Consensus       218 ~~~~~~~~~~~~~~~L~~A~~~~~~~~v~~Ll~~g~~~~~~~~~~~t~l~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~  297 (567)
                           +..+..|.||||+|+..|+.+++++|+++|++++..+..|.|||++                             
T Consensus       140 -----~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~g~~~~~~~~~g~t~L~~-----------------------------  185 (437)
T 1n11_A          140 -----ACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHV-----------------------------  185 (437)
T ss_dssp             -----CCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCSSCCCHHHH-----------------------------
T ss_pred             -----cCCCCCCCCHHHHHHHcCCHHHHHHHHhCCCCCCCCCCCCCCHHHH-----------------------------
Confidence                 4567789999999999999999999999999988877666555555                             


Q ss_pred             CCCCccccchhhhhhhhhhcCCCHHHHHHHcCcHHHHHHHHHcCCCCCCcCcCCCCHHHHHHHcCCHHHHHHHHHhCCCC
Q psy12891        298 IPNGFLVHDHAAVIDILTLRKQTPLHLAAEAGQLQVCKLLLDLGASIDATDDQGQKPIHVAAQNNFPEVAQIFLRAHPSL  377 (567)
Q Consensus       298 ~~~~~ll~~~~~~~~~~~~~~~t~L~~a~~~~~~~~v~~Ll~~g~~~~~~~~~g~t~L~~A~~~~~~~~~~~Ll~~~~~~  377 (567)
                                                 |+..|+.+++++|+++|++++..+..|.||||+|+..++.+++++|++.+.+ 
T Consensus       186 ---------------------------A~~~~~~~~v~~Ll~~g~~~~~~~~~g~t~L~~A~~~~~~~~~~~Ll~~g~~-  237 (437)
T 1n11_A          186 ---------------------------AVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGS-  237 (437)
T ss_dssp             ---------------------------HHHTTCHHHHHHHGGGTCCSCCCCTTCCCHHHHHHHTTCHHHHHHHHHTTCC-
T ss_pred             ---------------------------HHHcCCHHHHHHHHhCCCCCCCcCCCCCCHHHHHHHcCCHHHHHHHHHcCCC-
Confidence                                       5555667777777777777777777777777777777777777777777665 


Q ss_pred             ccccCCCCCcHHHHHHHcCCHHHHHHHHhcCCCcccccCCCCCCCCHHHHHHHcCcHHHHHHHHHcCCCCCCccCcCCcH
Q psy12891        378 VTATTKDGNTCAHIAAMQGSVGVIEELMKFDRSGVISARNRVTEATPLQLAAEGGHANVVRVLVKAGASCTDENKTGFTA  457 (567)
Q Consensus       378 ~~~~~~~~~~~l~~a~~~~~~~~~~~ll~~~~~~~~~~~~~~~~~t~L~~A~~~~~~~~v~~Ll~~g~~~~~~~~~g~t~  457 (567)
                      .+..+..|.||||+|+..++.+++++|++.+.+..   ..+..|.||||+|+..|+.+++++|+++|++++.++..|+||
T Consensus       238 ~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~~~~~~---~~~~~g~t~L~~A~~~~~~~~~~~Ll~~g~~~~~~~~~g~t~  314 (437)
T 1n11_A          238 ANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGN---LGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTP  314 (437)
T ss_dssp             TTCCCTTCCCHHHHHHHTTCHHHHHHHHTTTCCTT---CCCTTCCCHHHHHHHHTCHHHHHHHHHHTCCTTCCCSSCCCH
T ss_pred             CCCCCCCCCCHHHHHHHCCCHHHHHHHHhcCCCCC---CCCCCCCCHHHHHHHcCCHHHHHHHHhCCccCCCCCCCCCCH
Confidence            56666777777777777777777777777655432   334467777777777777777777777777777777777777


Q ss_pred             HHHHHHcCcHHHHHHHHhcccccccccccCCcHHHHHHHcCCHHHHHHHHhcCCCCCCCCCCCCcccccccCCCCCCCHH
Q psy12891        458 VHLAAQNGHNQVLEEMRSSKALNVYSKKLGVTALHVAAYFGQADTVRELLSHVPGTVKSDPPTGASFLGELGSESGMTPL  537 (567)
Q Consensus       458 l~~A~~~~~~~~v~~Ll~~~~~~~~~~~~g~t~l~~A~~~~~~~~~~~Ll~~~~~~~~~~~~~~~~~~~~~~~~~g~t~l  537 (567)
                      ||+|+..|+.+++++|+++|++++.+|..|+||||+|+..|+.+++++|++++++.             +.+|..|.|||
T Consensus       315 L~~A~~~g~~~~v~~Ll~~gad~n~~~~~g~t~L~~A~~~g~~~iv~~Ll~~ga~~-------------~~~~~~g~t~l  381 (437)
T 1n11_A          315 LHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASP-------------NEVSSDGTTPL  381 (437)
T ss_dssp             HHHHHHSSCSHHHHHHHHTTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCS-------------CCCCSSSCCHH
T ss_pred             HHHHHHcCcHHHHHHHHhcCCCCCCCCCCCCCHHHHHHHCChHHHHHHHHHCcCCC-------------CCCCCCCCCHH
Confidence            77777777777777777777777777777777777777777777777777776654             45567777777


Q ss_pred             HHHHHcCCHHHHHHHHh
Q psy12891        538 HLAAYSGNENVVRLLLN  554 (567)
Q Consensus       538 ~~A~~~~~~~~v~~Ll~  554 (567)
                      ++|.+.|+.+++++|..
T Consensus       382 ~~A~~~g~~~~~~~l~~  398 (437)
T 1n11_A          382 AIAKRLGYISVTDVLKV  398 (437)
T ss_dssp             HHHHHTTCHHHHHHHHH
T ss_pred             HHHHHcCcHHHHHHHHh
Confidence            77777777777777754



>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 567
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 8e-55
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 9e-48
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-35
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-04
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 9e-33
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 4e-21
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 6e-18
d2ajaa1 346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 8e-12
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 4e-11
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-26
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 6e-19
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 3e-18
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 3e-16
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-15
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-14
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 4e-13
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 5e-05
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 4e-26
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-25
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 3e-24
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 3e-18
d1wdya_ 285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 7e-18
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 5e-08
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 5e-22
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 9e-21
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 5e-19
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 9e-19
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-16
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-08
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 5e-06
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-05
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 5e-22
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-20
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 4e-20
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-17
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-16
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-14
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 6e-22
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 9e-20
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 5e-18
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 7e-18
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 3e-12
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 9e-12
d1s70b_ 291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-06
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 1e-19
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 9e-18
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 3e-16
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 9e-14
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 8e-12
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-19
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 8e-19
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-18
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 6e-17
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 7e-09
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 4e-06
d1k1aa_ 228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 3e-05
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 5e-04
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 4e-18
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-16
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-13
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-12
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 7e-12
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-08
d1ixva_ 229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-04
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 4e-04
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 0.003
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 3e-16
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 3e-14
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 3e-12
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 8e-12
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 1e-11
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 8e-10
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 3e-08
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 4e-07
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 6e-07
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 4e-15
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 5e-15
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 6e-15
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 2e-13
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 3e-07
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 4e-06
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 2e-05
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 3e-05
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 4e-11
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 4e-09
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 3e-07
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 1e-06
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 1e-05
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 5e-05
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 3e-04
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 1e-10
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 6e-08
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 6e-07
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 3e-06
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 3e-05
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 0.002
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 0.004
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 2e-08
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 2e-08
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 1e-06
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 2e-05
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 2e-05
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 2e-05
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 4e-05
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 3e-04
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 2e-08
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 3e-07
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 2e-05
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 9e-05
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 0.004
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 6e-08
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 3e-07
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 2e-06
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 6e-05
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 9e-05
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 2e-04
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 2e-04
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 4e-04
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 2e-07
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 8e-06
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 8e-05
d1myoa_118 d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) 3e-04
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  188 bits (478), Expect = 8e-55
 Identities = 108/432 (25%), Positives = 185/432 (42%), Gaps = 44/432 (10%)

Query: 72  TPVHAAAKYGNLVTLQLLLEDGGDPMYKNKIGETPLHLASRNCKAEVVDLLIQFVQNISQ 131
           TP+H A+  G+L  ++ LL+ G  P   N   ETPLH+A+R    EV   L+Q       
Sbjct: 2   TPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAK--- 58

Query: 132 EKVLEYVNSVNEDGASALHYACQVTKAELIPITSKEDQKTVKLLLEAGADVSLQTKQNHE 191
                 VN+  +D  + LH A +                 VKLLLE  A+ +L T   H 
Sbjct: 59  ------VNAKAKDDQTPLHCAAR-----------IGHTNMVKLLLENNANPNLATTAGHT 101

Query: 192 TAFHYCAVAGNNDVLTGMLEQMSGTEISKALNKQTSIGWTPLLIACNRGHMELVNTMLNN 251
                            +   ++  E   +    T  G+TPL +A   G + +   +L  
Sbjct: 102 PLHIAARE-------GHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLER 154

Query: 252 HARVDVFDQEGRSALHLAAEHGYLKV-----SSGKSLKHSVMSFRLPPHNIIPNGFLVH- 305
            A  +   + G + LH+A  H  L +       G S      +   P H       +   
Sbjct: 155 DAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVA 214

Query: 306 ----DHAAVIDILTLRKQTPLHLAAEAGQLQVCKLLLDLGASIDATDDQGQKPIHVAAQN 361
                +    +  +++  TPLHLAA+ G  ++  LLL   A+ +  +  G  P+H+ AQ 
Sbjct: 215 RSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQE 274

Query: 362 NFPEVAQIFLRAHPSLVTATTKDGNTCAHIAAMQGSVGVIEELMKFDRSGVISARNRVTE 421
               VA + ++ H  +V ATT+ G T  H+A+  G++ +++ L++         +     
Sbjct: 275 GHVPVADVLIK-HGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLG--- 330

Query: 422 ATPLQLAAEGGHANVVRVLVKAGASCTDENKTGFTAVHLAAQNGHNQV---LEEMRSSKA 478
            +PL  AA+ GH ++V +L+K GAS  + +  G T + +A + G+  V   L+ +    +
Sbjct: 331 YSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVLKVVTDETS 390

Query: 479 LNVYSKKLGVTA 490
             + S K  ++ 
Sbjct: 391 FVLVSDKHRMSF 402


>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 118 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query567
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 100.0
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 100.0
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 100.0
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 100.0
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 100.0
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.97
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.97
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.97
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.97
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.97
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.96
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.96
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.95
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.94
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.94
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.94
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.94
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.93
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.93
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.93
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.93
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.91
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.91
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.91
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.9
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.89
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.89
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.88
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.87
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=3.9e-54  Score=415.62  Aligned_cols=394  Identities=32%  Similarity=0.436  Sum_probs=342.1

Q ss_pred             ChHHHHHHHhCCHHHHHHHHHcCCCCCCCCCCCCChhHHHHhcCchhHHHHHHHhhhhhhhhHHhhhhcccccccccHHH
Q psy12891         71 QTPVHAAAKYGNLVTLQLLLEDGGDPMYKNKIGETPLHLASRNCKAEVVDLLIQFVQNISQEKVLEYVNSVNEDGASALH  150 (567)
Q Consensus        71 ~t~L~~A~~~g~~~~v~~Ll~~ga~~~~~~~~g~t~L~~A~~~~~~~iv~~Ll~~~~~~~~~~~~~~~~~~~~~~~t~L~  150 (567)
                      .||||+||..|+.++|++|+++|++++..|..|.||||+|+..|+.+++++|+++|++         ++.++..|.|||+
T Consensus         1 ~TpL~~Aa~~g~~~~v~~Ll~~g~~in~~d~~g~TpL~~A~~~g~~~iv~~Ll~~gad---------i~~~~~~g~t~L~   71 (408)
T d1n11a_           1 LTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAK---------VNAKAKDDQTPLH   71 (408)
T ss_dssp             CCHHHHHHHHTCHHHHHHHHHTTCCSCCSSSCCCCHHHHHHHHTCHHHHHHHHHHTCC---------SSCCCTTSCCHHH
T ss_pred             CChHHHHHHCcCHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHHCcCC---------CCCCCCCCCCHHH
Confidence            4899999999999999999999999999999999999999999999999999999988         6888999999999


Q ss_pred             HHHHhCCcccccccccccHHHHHHHHHcCCCccccccCCCccHHHHHHhcCCHHHHHHHHHhccCcchhhhhhcCCCCCC
Q psy12891        151 YACQVTKAELIPITSKEDQKTVKLLLEAGADVSLQTKQNHETAFHYCAVAGNNDVLTGMLEQMSGTEISKALNKQTSIGW  230 (567)
Q Consensus       151 ~a~~~~~~~~~~~~~~~~~~~v~~Ll~~g~~~~~~~~~~~~~~l~~a~~~~~~~~~~~Ll~~~~~~~~~~~~~~~~~~~~  230 (567)
                      +|+..+           +.+++++|+..+.++....... .+++..+...+...........+..      ....+..+.
T Consensus        72 ~A~~~g-----------~~~~~~~Ll~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~------~~~~~~~~~  133 (408)
T d1n11a_          72 CAARIG-----------HTNMVKLLLENNANPNLATTAG-HTPLHIAAREGHVETVLALLEKEAS------QACMTKKGF  133 (408)
T ss_dssp             HHHHHT-----------CHHHHHHHHHHTCCTTCCCTTC-CCHHHHHHHHTCHHHHHHHHHTTCC------SCCCCTTSC
T ss_pred             HHHHcC-----------CHHHHHHHHHhhhccccccccc-cchhhhhhhhccccccccccccccc------ccccccccc
Confidence            999854           5667999999998776655444 7889999888888877776665433      355677899


Q ss_pred             hHHHHHHhcCcHHHHHHHHhCCCCCCccCCCCCCHHHHHHHcCCeeeeccccccccccccCCCCCCCCCCCccccchhhh
Q psy12891        231 TPLLIACNRGHMELVNTMLNNHARVDVFDQEGRSALHLAAEHGYLKVSSGKSLKHSVMSFRLPPHNIIPNGFLVHDHAAV  310 (567)
Q Consensus       231 ~~L~~A~~~~~~~~v~~Ll~~g~~~~~~~~~~~t~l~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ll~~~~~~  310 (567)
                      ++++.|+..++.+++++|+++|.+++..+..|.                                               
T Consensus       134 ~~l~~a~~~~~~~~v~~ll~~~~~~~~~~~~~~-----------------------------------------------  166 (408)
T d1n11a_         134 TPLHVAAKYGKVRVAELLLERDAHPNAAGKNGL-----------------------------------------------  166 (408)
T ss_dssp             CHHHHHHHTTCHHHHHHHHHTTCCTTCCCSSCC-----------------------------------------------
T ss_pred             hHHHHHHHcCCHHHHHHHHHcCCCCCcCCCcCc-----------------------------------------------
Confidence            999999999999999999999998887665544                                               


Q ss_pred             hhhhhhcCCCHHHHHHHcCcHHHHHHHHHcCCCCCCcCcCCCCHHHHHHHcCCHHHHHHHHHhCCCCccccCCCCCcHHH
Q psy12891        311 IDILTLRKQTPLHLAAEAGQLQVCKLLLDLGASIDATDDQGQKPIHVAAQNNFPEVAQIFLRAHPSLVTATTKDGNTCAH  390 (567)
Q Consensus       311 ~~~~~~~~~t~L~~a~~~~~~~~v~~Ll~~g~~~~~~~~~g~t~L~~A~~~~~~~~~~~Ll~~~~~~~~~~~~~~~~~l~  390 (567)
                               +||+.|+..|+.+++++|+++|++++..+..|.||++.+......+....++..... ....+..+.||++
T Consensus       167 ---------~~L~~A~~~~~~~~~~~Ll~~g~~~~~~~~~~~t~l~~~~~~~~~~~~~~l~~~~~~-~~~~~~~~~t~l~  236 (408)
T d1n11a_         167 ---------TPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGS-ANAESVQGVTPLH  236 (408)
T ss_dssp             ---------CHHHHHHHTTCHHHHHHHGGGTCCSCCCCTTCCCHHHHHHHTTCHHHHHHHHHTTCC-TTCCCTTCCCHHH
T ss_pred             ---------hHHHHHHHcCCHHHHHHHHhcCCcccccCCCCCCcchhhhccchhhhhhhhhhcccc-ccccCCCCCCHHH
Confidence                     455666667788999999999999999999999999999999999999999887666 5567778999999


Q ss_pred             HHHHcCCHHHHHHHHhcCCCcccccCCCCCCCCHHHHHHHcCcHHHHHHHHHcCCCCCCccCcCCcHHHHHHHcCcHHHH
Q psy12891        391 IAAMQGSVGVIEELMKFDRSGVISARNRVTEATPLQLAAEGGHANVVRVLVKAGASCTDENKTGFTAVHLAAQNGHNQVL  470 (567)
Q Consensus       391 ~a~~~~~~~~~~~ll~~~~~~~~~~~~~~~~~t~L~~A~~~~~~~~v~~Ll~~g~~~~~~~~~g~t~l~~A~~~~~~~~v  470 (567)
                      .|+..+..++++++........   ..+..|.|||+.|++.++.+++++|+++|++++..+..+.|||+.|+..++.+++
T Consensus       237 ~a~~~~~~~~~~~~~~~~~~~~---~~~~~g~~~l~~a~~~~~~~i~~~Ll~~g~~~~~~~~~~~t~L~~~~~~~~~~~~  313 (408)
T d1n11a_         237 LAAQEGHAEMVALLLSKQANGN---LGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLV  313 (408)
T ss_dssp             HHHHTTCHHHHHHHHTTTCCTT---CCCTTCCCHHHHHHHHTCHHHHHHHHHHTCCTTCCCSSCCCHHHHHHHSSCSHHH
T ss_pred             HHHHhCcHhHhhhhhccccccc---cccCCCCChhhhhhhcCcHHHHHHHHHCCCccccccccccccchhhcccCcceee
Confidence            9999999999999998765433   3445788999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhcccccccccccCCcHHHHHHHcCCHHHHHHHHhcCCCCCCCCCCCCcccccccCCCCCCCHHHHHHHcCCHHHHH
Q psy12891        471 EEMRSSKALNVYSKKLGVTALHVAAYFGQADTVRELLSHVPGTVKSDPPTGASFLGELGSESGMTPLHLAAYSGNENVVR  550 (567)
Q Consensus       471 ~~Ll~~~~~~~~~~~~g~t~l~~A~~~~~~~~~~~Ll~~~~~~~~~~~~~~~~~~~~~~~~~g~t~l~~A~~~~~~~~v~  550 (567)
                      +++++.|++++.+|..|+||||+|++.|+.++|++|+++|++.             +.+|..|.||||+|+++|+.++|+
T Consensus       314 ~~ll~~g~~in~~d~~G~T~Lh~A~~~g~~~iv~~Ll~~GAd~-------------n~~d~~G~t~L~~A~~~~~~~iv~  380 (408)
T d1n11a_         314 KFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASP-------------NEVSSDGTTPLAIAKRLGYISVTD  380 (408)
T ss_dssp             HHHHHTTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCS-------------CCCCSSSCCHHHHHHHTTCHHHHH
T ss_pred             eeeccccccccccCCCCCCHHHHHHHcCCHHHHHHHHHCCCCC-------------CCCCCCCCCHHHHHHHcCCHHHHH
Confidence            9999999999999999999999999999999999999998865             677899999999999999999998


Q ss_pred             HHHh--ccCCcccccc
Q psy12891        551 LLLN--SAGVQVDAQT  564 (567)
Q Consensus       551 ~Ll~--~~g~~~~~~~  564 (567)
                      +|..  ..+.+..+.+
T Consensus       381 ~L~~~~~~~~~~~~~~  396 (408)
T d1n11a_         381 VLKVVTDETSFVLVSD  396 (408)
T ss_dssp             HHHHHCCCCSSCC---
T ss_pred             HHHHHHhccccccccc
Confidence            6533  1255555443



>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure