Psyllid ID: psy12959

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------24
MRRRSESRPGALQLLHTRLHSLIPLFSYFPFCAVVLKLDQNEKEIGIAAGGLYNYYILDSIHFHWGGSEHTFNGQRLATEVHLVHYNSQYESLTEAKDEPRGLAVIAVIIHETPEDNPILAPLVSSLDHVTPWLRCFCTRLLIYTILLQMSSHFQETPEDNPILAPLVSSLGETIDDPGESTSLPIPLAPSDLLPANRSAFFRYSGSLTTPPCSESVEWTVLYRTVGASRTQVSNPIGS
ccccccccccccccccEEEcccccEEEEccccEEEEEEccccccEEEEcccccccEEEEEEEEEEccccccccccccccEEEEEEEccccccHHHHHcccccEEEEEEEEEEccccccccHHHHHHcccccccccccEEcHHHHHHHHHcccccccccccccccHHHHHcccccccccccEEEcccccccccccccccccccEEEEccccccccccEEEEEccccEEccHHHHHccccc
ccccccccccEEEcccccccccccEEEEEcccEEEEEEcccccccEEEcccccccEEEEEEEEEccccccEEccEcccEEEEEEEEcHHHccHHHHccccccEEEEEEEEEEcccccHHHHHHHHHHHHHHccccEEEcccccHHHccccccccccccccccHHHHHHHHHcccccccccEEEccccccHHHHcccccccEEEEEEccccccccccEEEEEEcccEEEcHHHHHHHccc
mrrrsesrpgaLQLLHTRLHsliplfsyfPFCAVVLKLDQNEKEIGIAAGGLYNYYILDSihfhwggsehtfngqrLATEVHLVHYNSqyeslteakdeprgLAVIAVIIhetpednpilaplvssldhvtpwLRCFCTRLLIYTILLQMSshfqetpednpilaplvsslgetiddpgestslpiplapsdllpanrsaffrysgslttppcsesveWTVLYRTVgasrtqvsnpigs
mrrrsesrpgALQLLHTRLHSLIPLFSYFPFCAVVLKLDQNEKEIGIAAGGLYNYYILDSIHFHWGGSEHTFNGQRLATEVHLVHYNSQYEslteakdepRGLAVIAVIIHETPEDNPILAPLVSSLDHVTPWLRCFCTRLLIYTILLQMSSHFQETPEDNPILAPLVSSLGETIDDPGESTSLPIPLAPSDLLPANRSAFFRYSGslttppcsesveWTVLYRTvgasrtqvsnpigs
MRRRSESRPGALQLLHTRLHSLIPLFSYFPFCAVVLKLDQNEKEIGIAAGGLYNYYILDSIHFHWGGSEHTFNGQRLATEVHLVHYNSQYESLTEAKDEPRGLAVIAVIIHETPEDNPILAPLVSSLDHVTPWLRCFCTRLLIYTILLQMSSHFQETPEDNPILAPLVSSLGETIDDPGESTSLPIPLAPSDLLPANRSAFFRYSGSLTTPPCSESVEWTVLYRTVGASRTQVSNPIGS
***********LQLLHTRLHSLIPLFSYFPFCAVVLKLDQNEKEIGIAAGGLYNYYILDSIHFHWGGSEHTFNGQRLATEVHLVHYNSQYESLTEAKDEPRGLAVIAVIIHETPEDNPILAPLVSSLDHVTPWLRCFCTRLLIYTILLQMSSH********************************************RSAFFRYSGSLTTPPCSESVEWTVLYRTVG************
******S***ALQLLHTRLHSLIPLFSYFPFCAVVLKLDQNEKEIGIAAGGLYNYYILDSIHFHWGGSEHTFNGQRLATEVHLVHYNSQYESLTEAKDEPRGLAVIAVIIHETPEDNPILAPLVSSLDHVTPWLRCFCTRLLIYTILLQMSSHFQETPEDNPILAPLVSSLGETIDDPGESTSLPIPLAPSDLLPANRSAFFRYSGSLTTPPCSESVEWTVLYRTVGASRTQVSNPI**
**********ALQLLHTRLHSLIPLFSYFPFCAVVLKLDQNEKEIGIAAGGLYNYYILDSIHFHWGGSEHTFNGQRLATEVHLVHYNSQYESLTEAKDEPRGLAVIAVIIHETPEDNPILAPLVSSLDHVTPWLRCFCTRLLIYTILLQMSSHFQETPEDNPILAPLVSSLGETIDDPGESTSLPIPLAPSDLLPANRSAFFRYSGSLTTPPCSESVEWTVLYRTVGASRTQVSNPIGS
******SRPGALQLLHTRLHSLIPLFSYFPFCAVVLKLDQNEKEIGIAAGGLYNYYILDSIHFHWGGSEHTFNGQRLATEVHLVHYNSQYESLTEAKDEPRGLAVIAVIIHETPEDNPILAPLVSSLDHVTPWLRCFCTRLLIYTILLQMSSHFQETPEDNPILAPLVSSLGETIDDPGESTSLPIPLAPSDLLPANRSAFFRYSGSLTTPPCSESVEWTVLYRTVGASRTQVSNPI**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRRRSESRPGALQLLHTRLHSLIPLFSYFPFCAVVLKLDQNEKEIGIAAGGLYNYYILDSIHFHWGGSEHTFNGQRLATEVHLVHYNSQYESLTEAKDEPRGLAVIAVIIHETPEDNPILAPLVSSLDHVTPWLRCFCTRLLIYTILLQMSSHFQETPEDNPILAPLVSSLGETIDDPGESTSLPIPLAPSDLLPANRSAFFRYSGSLTTPPCSESVEWTVLYRTVGASRTQVSNPIGS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query239 2.2.26 [Sep-21-2011]
P08060307 Carbonic anhydrase 6 OS=O N/A N/A 0.556 0.433 0.362 1e-20
P23280308 Carbonic anhydrase 6 OS=H yes N/A 0.556 0.431 0.356 2e-20
Q8VHB5437 Carbonic anhydrase 9 OS=M yes N/A 0.594 0.324 0.345 5e-20
Q865C0320 Carbonic anhydrase 6 OS=C no N/A 0.548 0.409 0.340 4e-19
Q9WVT6337 Carbonic anhydrase 14 OS= no N/A 0.585 0.415 0.341 4e-19
P18915319 Carbonic anhydrase 6 OS=B no N/A 0.556 0.416 0.345 5e-19
Q9ULX7337 Carbonic anhydrase 14 OS= no N/A 0.602 0.427 0.335 2e-18
P18761317 Carbonic anhydrase 6 OS=M no N/A 0.556 0.419 0.318 4e-18
Q16790459 Carbonic anhydrase 9 OS=H no N/A 0.585 0.305 0.328 5e-17
Q8UWA5260 Carbonic anhydrase 2 OS=T N/A N/A 0.619 0.569 0.301 2e-16
>sp|P08060|CAH6_SHEEP Carbonic anhydrase 6 OS=Ovis aries GN=CA6 PE=1 SV=1 Back     alignment and function desciption
 Score =  100 bits (248), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 67/185 (36%), Positives = 87/185 (47%), Gaps = 52/185 (28%)

Query: 56  YILDSIHFHWGG-------SEHTFNGQRLATEVHLVHYNSQYESLTEAKDEPRGLAVIAV 108
           Y+   +HFHWGG       SEHT +G R   E+H+VHYNS+Y S  EA+ EP GLAV   
Sbjct: 88  YLAKQMHFHWGGASSEISGSEHTVDGMRYVIEIHVVHYNSKYNSYEEAQKEPDGLAV--- 144

Query: 109 IIHETPEDNPILAPLVSSLDHVTPWLRCFCTRLLIYTILLQMSSHFQETPEDNPILAPLV 168
                      LA LV   D+                              +N   +  +
Sbjct: 145 -----------LAALVEVKDYT-----------------------------ENAYYSKFI 164

Query: 169 SSLGETIDDPGESTSLPIPLAPSDLLPANRSAFFRYSGSLTTPPCSESVEWTVLYRTVGA 228
           S L E I   G+ST L   L   D+LP +   ++ Y GSLTTPPC+E+V W V+  TV  
Sbjct: 165 SHL-EDIRYAGQSTVLR-GLDIEDMLPGDLRYYYSYLGSLTTPPCTENVHWFVVADTVKL 222

Query: 229 SRTQV 233
           S+TQV
Sbjct: 223 SKTQV 227
Reversible hydration of carbon dioxide. Its role in saliva is unknown.
Ovis aries (taxid: 9940)
EC: 4EC: .EC: 2EC: .EC: 1EC: .EC: 1
>sp|P23280|CAH6_HUMAN Carbonic anhydrase 6 OS=Homo sapiens GN=CA6 PE=1 SV=3 Back     alignment and function description
>sp|Q8VHB5|CAH9_MOUSE Carbonic anhydrase 9 OS=Mus musculus GN=Ca9 PE=2 SV=2 Back     alignment and function description
>sp|Q865C0|CAH6_CANFA Carbonic anhydrase 6 OS=Canis familiaris GN=CA6 PE=2 SV=1 Back     alignment and function description
>sp|Q9WVT6|CAH14_MOUSE Carbonic anhydrase 14 OS=Mus musculus GN=Ca14 PE=1 SV=1 Back     alignment and function description
>sp|P18915|CAH6_BOVIN Carbonic anhydrase 6 OS=Bos taurus GN=CA6 PE=1 SV=2 Back     alignment and function description
>sp|Q9ULX7|CAH14_HUMAN Carbonic anhydrase 14 OS=Homo sapiens GN=CA14 PE=1 SV=1 Back     alignment and function description
>sp|P18761|CAH6_MOUSE Carbonic anhydrase 6 OS=Mus musculus GN=Ca6 PE=1 SV=3 Back     alignment and function description
>sp|Q16790|CAH9_HUMAN Carbonic anhydrase 9 OS=Homo sapiens GN=CA9 PE=1 SV=2 Back     alignment and function description
>sp|Q8UWA5|CAH2_TRIHK Carbonic anhydrase 2 OS=Tribolodon hakonensis GN=ca2 PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query239
321470708307 alpha-carbonic anhydrase [Daphnia pulex] 0.585 0.456 0.352 6e-23
18462989298 carbonic anhydrase [Aedes aegypti] 0.640 0.513 0.338 2e-22
442769035308 glycosyl-phosphatidylinositol-linked car 0.585 0.454 0.357 8e-22
260813110322 hypothetical protein BRAFLDRAFT_127510 [ 0.656 0.487 0.308 3e-21
33521206309 carbonic anhydrase [Anopheles gambiae] 0.640 0.495 0.323 3e-21
118785890309 AGAP004895-PA [Anopheles gambiae str. PE 0.640 0.495 0.323 3e-21
157122827297 carbonic anhydrase precursor [Aedes aegy 0.640 0.515 0.343 4e-21
170057980320 carbonic anhydrase [Culex quinquefasciat 0.640 0.478 0.333 1e-20
449275460281 Carbonic anhydrase 9, partial [Columba l 0.581 0.494 0.342 1e-20
157122829315 carbonic anhydrase II, putative [Aedes a 0.640 0.485 0.348 2e-20
>gi|321470708|gb|EFX81683.1| alpha-carbonic anhydrase [Daphnia pulex] Back     alignment and taxonomy information
 Score =  113 bits (283), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 67/190 (35%), Positives = 85/190 (44%), Gaps = 50/190 (26%)

Query: 50  GGLYNYYILDSIHFHWG-----GSEHTFNGQRLATEVHLVHYNSQYESLTEAKDEPRGLA 104
           GGL N ++   +HFHWG     GSEHT N +  A E+H VH+N +Y SL  A   P GLA
Sbjct: 109 GGLTNQFVFAQVHFHWGAEGVRGSEHTVNNKHYAAELHFVHFNKKYGSLGNATSHPDGLA 168

Query: 105 VIAVIIHETPEDNPILAPLVSSLDHVTPWLRCFCTRLLIYTILLQMSSHFQETPEDNPIL 164
           V+ V +  + EDNP   P+ S LDHV                                  
Sbjct: 169 VLGVFVETSKEDNPAFDPITSVLDHVV--------------------------------- 195

Query: 165 APLVSSLGETIDDPGESTSLPIPLAPSDLLPANRSAFFRYSGSLTTPPCSESVEWTVLYR 224
                         G    L   L+  DLLP + S F+RY GSLTTP C E V WTV   
Sbjct: 196 ------------HEGHEWELNETLSLRDLLPESLSKFYRYMGSLTTPGCQEIVVWTVFAD 243

Query: 225 TVGASRTQVS 234
            + AS +Q++
Sbjct: 244 PITASESQLA 253

Source: Daphnia pulex

Species: Daphnia pulex

Genus: Daphnia

Family: Daphniidae

Order: Diplostraca

Class: Branchiopoda

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|18462989|gb|AAL72625.1|AF395662_1 carbonic anhydrase [Aedes aegypti] Back     alignment and taxonomy information
>gi|442769035|gb|AGC70493.1| glycosyl-phosphatidylinositol-linked carbonic anhydrase [Litopenaeus vannamei] Back     alignment and taxonomy information
>gi|260813110|ref|XP_002601262.1| hypothetical protein BRAFLDRAFT_127510 [Branchiostoma floridae] gi|229286555|gb|EEN57274.1| hypothetical protein BRAFLDRAFT_127510 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|33521206|gb|AAQ21365.1| carbonic anhydrase [Anopheles gambiae] Back     alignment and taxonomy information
>gi|118785890|ref|XP_314980.3| AGAP004895-PA [Anopheles gambiae str. PEST] gi|116127622|gb|EAA10356.3| AGAP004895-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|157122827|ref|XP_001659933.1| carbonic anhydrase precursor [Aedes aegypti] gi|108874594|gb|EAT38819.1| AAEL009323-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|170057980|ref|XP_001864720.1| carbonic anhydrase [Culex quinquefasciatus] gi|167877230|gb|EDS40613.1| carbonic anhydrase [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|449275460|gb|EMC84323.1| Carbonic anhydrase 9, partial [Columba livia] Back     alignment and taxonomy information
>gi|157122829|ref|XP_001659934.1| carbonic anhydrase II, putative [Aedes aegypti] gi|108874595|gb|EAT38820.1| AAEL009330-PA [Aedes aegypti] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query239
ZFIN|ZDB-GENE-051030-57373 ca14 "carbonic anhydrase XIV" 0.288 0.184 0.435 1.6e-21
UNIPROTKB|Q9ULX7337 CA14 "Carbonic anhydrase 14" [ 0.338 0.240 0.386 8.1e-21
UNIPROTKB|H0YBE2178 CA1 "Carbonic anhydrase 1" [Ho 0.393 0.528 0.356 8.4e-21
ZFIN|ZDB-GENE-980526-39260 cahz "carbonic anhydrase" [Dan 0.347 0.319 0.393 1.5e-20
ZFIN|ZDB-GENE-040426-1786306 ca7 "carbonic anhydrase VII" [ 0.384 0.300 0.4 1.4e-19
UNIPROTKB|F1RXC2262 CA2 "Uncharacterized protein" 0.389 0.354 0.376 1.4e-19
MGI|MGI:1923709354 Car12 "carbonic anyhydrase 12" 0.317 0.214 0.428 2.6e-19
FB|FBgn0040628235 CG18672 [Drosophila melanogast 0.397 0.404 0.34 8.3e-19
ZFIN|ZDB-GENE-080818-5384 ca9 "carbonic anhydrase IX" [D 0.338 0.210 0.413 9.2e-19
UNIPROTKB|D4A4I0321 Car12 "Protein Car12" [Rattus 0.309 0.230 0.439 1.4e-18
ZFIN|ZDB-GENE-051030-57 ca14 "carbonic anhydrase XIV" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 164 (62.8 bits), Expect = 1.6e-21, Sum P(2) = 1.6e-21
 Identities = 34/78 (43%), Positives = 50/78 (64%)

Query:    47 IAAGGLYNYYILDSIHFHWG-------GSEHTFNGQRLATEVHLVHYNSQ-YESLTEAKD 98
             +  GGL ++Y    +H HWG       GSEHT NGQ  + E+H+VHYN++ Y +L+EA  
Sbjct:    98 MGVGGLPSHYSAVQLHLHWGNGVGIATGSEHTINGQSTSAELHIVHYNTEVYANLSEAMM 157

Query:    99 EPRGLAVIAVIIHETPED 116
             +  GLAV+ ++I ET E+
Sbjct:   158 QKNGLAVLGILI-ETGEE 174
GO:0005575 "cellular_component" evidence=ND
UNIPROTKB|Q9ULX7 CA14 "Carbonic anhydrase 14" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|H0YBE2 CA1 "Carbonic anhydrase 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-980526-39 cahz "carbonic anhydrase" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1786 ca7 "carbonic anhydrase VII" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1RXC2 CA2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1923709 Car12 "carbonic anyhydrase 12" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
FB|FBgn0040628 CG18672 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-080818-5 ca9 "carbonic anhydrase IX" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|D4A4I0 Car12 "Protein Car12" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer4.2.1LOW CONFIDENCE prediction!
4th Layer4.2.1.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query239
smart01057247 smart01057, Carb_anhydrase, Eukaryotic-type carbon 3e-47
cd00326227 cd00326, alpha_CA, Carbonic anhydrase alpha (verte 2e-44
cd03123248 cd03123, alpha_CA_VI_IX_XII_XIV, Carbonic anhydras 3e-39
cd03117234 cd03117, alpha_CA_IV_XV_like, Carbonic anhydrase a 1e-37
pfam00194238 pfam00194, Carb_anhydrase, Eukaryotic-type carboni 5e-36
cd03125249 cd03125, alpha_CA_VI, Carbonic anhydrase alpha, is 2e-32
cd03122253 cd03122, alpha_CARP_receptor_like, Carbonic anhydr 4e-32
cd03126249 cd03126, alpha_CA_XII_XIV, Carbonic anhydrase alph 3e-29
cd03150247 cd03150, alpha_CA_IX, Carbonic anhydrase alpha, is 1e-25
cd03124216 cd03124, alpha_CA_prokaryotic_like, Carbonic anhyd 2e-24
cd03119259 cd03119, alpha_CA_I_II_III_XIII, Carbonic anhydras 9e-23
cd03149236 cd03149, alpha_CA_VII, Carbonic anhydrase alpha, C 2e-20
cd03118236 cd03118, alpha_CA_V, Carbonic anhydrase alpha, CA 5e-20
COG3338250 COG3338, Cah, Carbonic anhydrase [Inorganic ion tr 5e-18
cd03121256 cd03121, alpha_CARP_X_XI_like, Carbonic anhydrase 2e-17
cd03120256 cd03120, alpha_CARP_VIII, Carbonic anhydrase alpha 3e-15
PLN02202284 PLN02202, PLN02202, carbonate dehydratase 3e-07
PLN02179235 PLN02179, PLN02179, carbonic anhydrase 5e-05
>gnl|CDD|215000 smart01057, Carb_anhydrase, Eukaryotic-type carbonic anhydrase Back     alignment and domain information 
 Score =  156 bits (396), Expect = 3e-47
 Identities = 71/228 (31%), Positives = 96/228 (42%), Gaps = 60/228 (26%)

Query: 20  HSLIPL-FSYFPFCAVVLK-------LDQNEKEIGIAAGGLYNYYILDSIHFHWG----- 66
            SL PL  SY    A  +        ++ ++    ++ G L   Y L   HFHWG     
Sbjct: 39  PSLKPLKLSYDQPTAKRILNNGHTVQVNFDDDGSTLSGGPLPGRYRLKQFHFHWGGSDSE 98

Query: 67  GSEHTFNGQRLATEVHLVHYNSQYESLTEAKDEPRGLAVIAVIIHETPEDNPILAPLVSS 126
           GSEHT +G+R   E+HLVHYNS+  S +EA  +P GLAV+AV      E+NP L  ++  
Sbjct: 99  GSEHTIDGKRFPLELHLVHYNSK-GSFSEAVSKPGGLAVVAVFFKVGAEENPALQAILDH 157

Query: 127 LDHVTPWLRCFCTRLLIYTILLQMSSHFQETPEDNPILAPLVSSLGETIDDPGESTSLPI 186
           L  +                                                G+ T L  
Sbjct: 158 LPLIKY---------------------------------------------KGQETELT- 171

Query: 187 PLAPSDLLPANRSAFFRYSGSLTTPPCSESVEWTVLYRTVGASRTQVS 234
           P   S LLPA+   ++ Y+GSLTTPPCSE V W V    +  S  Q+ 
Sbjct: 172 PFDLSSLLPASTRHYYTYNGSLTTPPCSEGVTWIVFKEPITISTEQLE 219

Carbonic anhydrases are zinc metalloenzymes which catalyse the reversible hydration of carbon dioxide to bicarbonate.. CAs have essential roles in facilitating the transport of carbon dioxide and protons in the intracellular space, across biological membranes and in the layers of the extracellular space; they are also involved in many other processes, from respiration and photosynthesis in eukaryotes to cyanate degradation in prokaryotes. There are five known evolutionarily distinct CA families (alpha, beta, gamma, delta and epsilon) that have no significant sequence identity and have structurally distinct overall folds. Some CAs are membrane-bound, while others act in the cytosol; there are several related proteins that lack enzymatic activity. The active site of alpha-CAs is well described, consisting of a zinc ion coordinated through 3 histidine residues and a water molecule/hydroxide ion that acts as a potent nucleophile. The enzyme employs a two-step mechanism: in the first step, there is a nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide; in the second step, the active site is regenerated by the ionisation of the zinc-bound water molecule and the removal of a proton from the active site. Beta- and gamma-CAs also employ a zinc hydroxide mechanism, although at least some beta-class enzymes do not have water directly coordinated to the metal ion. Length = 247
>gnl|CDD|238200 cd00326, alpha_CA, Carbonic anhydrase alpha (vertebrate-like) group Back     alignment and domain information
>gnl|CDD|239397 cd03123, alpha_CA_VI_IX_XII_XIV, Carbonic anhydrase alpha, isozymes VI, IX, XII and XIV Back     alignment and domain information
>gnl|CDD|239391 cd03117, alpha_CA_IV_XV_like, Carbonic anhydrase alpha, CA_IV, CA_XV, like isozymes Back     alignment and domain information
>gnl|CDD|201071 pfam00194, Carb_anhydrase, Eukaryotic-type carbonic anhydrase Back     alignment and domain information
>gnl|CDD|239399 cd03125, alpha_CA_VI, Carbonic anhydrase alpha, isozyme VI Back     alignment and domain information
>gnl|CDD|239396 cd03122, alpha_CARP_receptor_like, Carbonic anhydrase alpha related protein, receptor_like subfamily Back     alignment and domain information
>gnl|CDD|239400 cd03126, alpha_CA_XII_XIV, Carbonic anhydrase alpha, isozymes XII and XIV Back     alignment and domain information
>gnl|CDD|239403 cd03150, alpha_CA_IX, Carbonic anhydrase alpha, isozyme IX Back     alignment and domain information
>gnl|CDD|239398 cd03124, alpha_CA_prokaryotic_like, Carbonic anhydrase alpha, prokaryotic-like subfamily Back     alignment and domain information
>gnl|CDD|239393 cd03119, alpha_CA_I_II_III_XIII, Carbonic anhydrase alpha, isozymes I, II, and III and XIII Back     alignment and domain information
>gnl|CDD|239402 cd03149, alpha_CA_VII, Carbonic anhydrase alpha, CA isozyme VII_like subgroup Back     alignment and domain information
>gnl|CDD|239392 cd03118, alpha_CA_V, Carbonic anhydrase alpha, CA isozyme V_like subgroup Back     alignment and domain information
>gnl|CDD|225875 COG3338, Cah, Carbonic anhydrase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|239395 cd03121, alpha_CARP_X_XI_like, Carbonic anhydrase alpha related protein: groups X, XI and related proteins Back     alignment and domain information
>gnl|CDD|239394 cd03120, alpha_CARP_VIII, Carbonic anhydrase alpha related protein, group VIII Back     alignment and domain information
>gnl|CDD|177853 PLN02202, PLN02202, carbonate dehydratase Back     alignment and domain information
>gnl|CDD|177835 PLN02179, PLN02179, carbonic anhydrase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 239
cd03149236 alpha_CA_VII Carbonic anhydrase alpha, CA isozyme 100.0
cd03118236 alpha_CA_V Carbonic anhydrase alpha, CA isozyme V_ 100.0
cd03119259 alpha_CA_I_II_III_XIII Carbonic anhydrase alpha, i 100.0
KOG0382|consensus262 100.0
cd03121256 alpha_CARP_X_XI_like Carbonic anhydrase alpha rela 100.0
cd03117234 alpha_CA_IV_XV_like Carbonic anhydrase alpha, CA_I 100.0
cd03122253 alpha_CARP_receptor_like Carbonic anhydrase alpha 100.0
cd03150247 alpha_CA_IX Carbonic anhydrase alpha, isozyme IX. 100.0
cd03126249 alpha_CA_XII_XIV Carbonic anhydrase alpha, isozyme 100.0
cd03120256 alpha_CARP_VIII Carbonic anhydrase alpha related p 100.0
cd03125249 alpha_CA_VI Carbonic anhydrase alpha, isozyme VI. 100.0
PF00194256 Carb_anhydrase: Eukaryotic-type carbonic anhydrase 100.0
cd03123248 alpha_CA_VI_IX_XII_XIV Carbonic anhydrase alpha, i 100.0
cd00326227 alpha_CA Carbonic anhydrase alpha (vertebrate-like 100.0
cd03124216 alpha_CA_prokaryotic_like Carbonic anhydrase alpha 100.0
PLN02202284 carbonate dehydratase 100.0
PLN02179235 carbonic anhydrase 100.0
COG3338250 Cah Carbonic anhydrase [Inorganic ion transport an 100.0
>cd03149 alpha_CA_VII Carbonic anhydrase alpha, CA isozyme VII_like subgroup Back     alignment and domain information 
Probab=100.00  E-value=4e-51  Score=360.72  Aligned_cols=182  Identities=37%  Similarity=0.631  Sum_probs=152.2

Q ss_pred             Cccchhhhhhhh-cCCCCc-ccccCCce---------EEEEEcCCCCeeEEeccCCCCceeeeEEEEeec-----CCccc
Q psy12959          8 RPGALQLLHTRL-HSLIPL-FSYFPFCA---------VVLKLDQNEKEIGIAAGGLYNYYILDSIHFHWG-----GSEHT   71 (239)
Q Consensus         8 ~~~~~~~~~~~~-~~~~~~-~~y~~~~~---------~~~~~~~~~~~~~i~gg~l~~~Y~l~q~HfHwG-----gSEHt   71 (239)
                      +|+.|....... ..+.|+ +.|.+...         +.+.+.++...+.++||+|..+|+|.|||||||     ||||+
T Consensus         5 SPInI~~~~~~~~~~l~~l~~~y~~~~~~~~~N~Ghtv~v~~~~~~~~~~~~gg~l~~~Y~l~q~HfHwG~~~~~gSEH~   84 (236)
T cd03149           5 SPIDIVSSEAVYDPKLKPLSLSYDPCTSLSISNNGHSVMVEFDDSDDKTVITGGPLENPYRLKQFHFHWGAKHGSGSEHT   84 (236)
T ss_pred             CCeeEccCceEECCCCCceEeecCCCcceEEEECCEEEEEEecCCCCceEEecCCCCCcEEEEEEEEecCCCCCCCCcee
Confidence            455554443322 345666 78875423         224444434568999999999999999999998     99999


Q ss_pred             ccCccccceEEEEEeec-CCCChhhhhcCCCceEEEEEEEeeCCCCCCCccccccccCCCCcccccccchhhhhHHHhhh
Q psy12959         72 FNGQRLATEVHLVHYNS-QYESLTEAKDEPRGLAVIAVIIHETPEDNPILAPLVSSLDHVTPWLRCFCTRLLIYTILLQM  150 (239)
Q Consensus        72 idG~~~~~E~HiVh~~~-~y~~~~eA~~~~~glaVlavf~~~~~~~n~~l~~~~~~~~~~~~~~~~~c~r~~~~~~~~~~  150 (239)
                      |||++|||||||||++. +|.++++|...++|+||||||++++. +|+.++                             
T Consensus        85 idg~~yp~E~HlVH~n~~~y~~~~~A~~~~~glaVlgv~~~~g~-~n~~l~-----------------------------  134 (236)
T cd03149          85 VDGKTFPSELHLVHWNAKKYKSFGEAAAAPDGLAVLGVFLETGD-EHPGLN-----------------------------  134 (236)
T ss_pred             ecCeeccceeeeeEecccccCCHHHHhhccCCcEEEEEEEEecC-CCccHH-----------------------------
Confidence            99999999999999998 79999999999999999999999994 577776                             


Q ss_pred             cccccCCCCCCCchhhHHHHhcccCCCCCCeeEcCCCCCCCCcCCCCCCCcEEEeecccCCCCCCceEEEEeCeeeecCH
Q psy12959        151 SSHFQETPEDNPILAPLVSSLGETIDDPGESTSLPIPLAPSDLLPANRSAFFRYSGSLTTPPCSESVEWTVLYRTVGASR  230 (239)
Q Consensus       151 ~~~~~~~~~~~~~l~~i~~~l~~~i~~~g~~~~i~~~~~l~~Llp~~~~~yy~Y~GSLTTPPCsE~V~WiV~~~pi~IS~  230 (239)
                                     .|++.+ ..+..+++...+.. |++.+|||.+. +||+|.||||||||+|+|+|+||++|+.||+
T Consensus       135 ---------------~i~~~l-~~i~~~~~~~~~~~-~~~~~llp~~~-~yy~Y~GSLTTPpC~E~V~W~V~~~pi~is~  196 (236)
T cd03149         135 ---------------RLTDAL-YMVRFKGTKAQFLD-FNPKCLLPKSL-DYWTYPGSLTTPPLNESVTWIVLKEPIPVSE  196 (236)
T ss_pred             ---------------HHHHHh-hhcccCCcceeecc-CCHHHHCCCCC-CeEEecccCcCCCCCCceEEEEeCceeeCCH
Confidence                           788888 77777777777754 99999999885 8999999999999999999999999999999


Q ss_pred             HHHhCcc
Q psy12959        231 TQVSNPI  237 (239)
Q Consensus       231 ~Ql~~~~  237 (239)
                      +||++|+
T Consensus       197 ~Ql~~fr  203 (236)
T cd03149         197 KQMGKFR  203 (236)
T ss_pred             HHHHHHH
Confidence            9999886

Carbonic anhydrases (CAs) are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism: a nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site. They are ubiquitous enzymes involved in fundamental processes like photosynthesis, respiration, pH homeostasis and ion transport. Most alpha CAs are monomeric enzymes. The zinc ion is complexed by three histidines. This vertebrate subgroup comprises isozyme VII. CA VII is the most active cytosolic enzyme after CA II, and may be highly expressed in the brain. Human CA VII may be a target of antiepileptic sulfonamides/sulfamates.
>cd03118 alpha_CA_V Carbonic anhydrase alpha, CA isozyme V_like subgroup Back     alignment and domain information
>cd03119 alpha_CA_I_II_III_XIII Carbonic anhydrase alpha, isozymes I, II, and III and XIII Back     alignment and domain information
>KOG0382|consensus Back     alignment and domain information
>cd03121 alpha_CARP_X_XI_like Carbonic anhydrase alpha related protein: groups X, XI and related proteins Back     alignment and domain information
>cd03117 alpha_CA_IV_XV_like Carbonic anhydrase alpha, CA_IV, CA_XV, like isozymes Back     alignment and domain information
>cd03122 alpha_CARP_receptor_like Carbonic anhydrase alpha related protein, receptor_like subfamily Back     alignment and domain information
>cd03150 alpha_CA_IX Carbonic anhydrase alpha, isozyme IX Back     alignment and domain information
>cd03126 alpha_CA_XII_XIV Carbonic anhydrase alpha, isozymes XII and XIV Back     alignment and domain information
>cd03120 alpha_CARP_VIII Carbonic anhydrase alpha related protein, group VIII Back     alignment and domain information
>cd03125 alpha_CA_VI Carbonic anhydrase alpha, isozyme VI Back     alignment and domain information
>PF00194 Carb_anhydrase: Eukaryotic-type carbonic anhydrase; InterPro: IPR001148 Carbonic anhydrases (CA: 4 Back     alignment and domain information
>cd03123 alpha_CA_VI_IX_XII_XIV Carbonic anhydrase alpha, isozymes VI, IX, XII and XIV Back     alignment and domain information
>cd00326 alpha_CA Carbonic anhydrase alpha (vertebrate-like) group Back     alignment and domain information
>cd03124 alpha_CA_prokaryotic_like Carbonic anhydrase alpha, prokaryotic-like subfamily Back     alignment and domain information
>PLN02202 carbonate dehydratase Back     alignment and domain information
>PLN02179 carbonic anhydrase Back     alignment and domain information
>COG3338 Cah Carbonic anhydrase [Inorganic ion transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query239
3fe4_A278 Crystal Structure Of Human Carbonic Anhydrase Vi Le 2e-21
1rj5_A261 Crystal Structure Of The Extracellular Domain Of Mu 2e-19
3iai_A257 Crystal Structure Of The Catalytic Domain Of The Tu 3e-18
1v9i_C261 Crystal Structure Analysis Of The Site Specific Mut 4e-17
1v9e_A259 Crystal Structure Analysis Of Bovine Carbonic Anhyd 5e-17
3jxh_C265 Ca-Like Domain Of Human Ptprg Length = 265 6e-17
3jxg_B269 Ca-Like Domain Of Mouse Ptprg Length = 269 1e-16
1keq_A248 Crystal Structure Of F65aY131C CARBONIC ANHYDRASE V 2e-16
3ml5_A269 Crystal Structure Of The C183sC217S MUTANT OF HUMAN 4e-16
1jcz_A263 Crystal Structure Of The Extracellular Domain Of Hu 4e-16
1dmx_A248 Murine Mitochondrial Carbonic Anyhdrase V At 2.45 A 4e-16
3m1q_A265 Carbonic Anhydrase Ii Mutant W5c-H64c With Opened D 1e-15
3mdz_A281 Crystal Structure Of Human Carbonic Anhydrase Vii [ 1e-15
3kig_A265 Mutant Carbonic Anhydrase Ii In Complex With An Azi 1e-15
1urt_A248 Murine Carbonic Anhydrase V Length = 248 2e-15
3v3j_A260 Kinetic And Structural Studies Of Thermostabilized 6e-15
3v3i_B260 Kinetic And Structural Studies Of Thermostabilized 7e-15
3v3g_B260 Kinetic And Structural Studies Of Thermostabilized 8e-15
3v3h_B260 Kinetic And Structural Studies Of Thermostabilized 8e-15
2nwy_A260 Structural And Kinetic Effects Of Hydrophobic Mutat 9e-15
3v3f_A260 Kinetic And Structural Studies Of Thermostabilized 9e-15
3tvo_X258 Human Carbonic Anhydrase Ii Proton Transfer Double 2e-14
1g0e_A260 Site-Specific Mutant (His64 Replaced With Ala) Of H 2e-14
1cni_A259 X-Ray Crystallographic Studies Of Engineered Hydrog 2e-14
3tvn_X258 Human Carbonic Anhydrase Ii Proton Transfer Mutant 2e-14
2nwo_A260 Structural And Kinetic Effect Of Hydrophobic Mutati 2e-14
2foq_A260 Human Carbonic Anhydrase Ii Complexed With Two-Pron 2e-14
3m1k_A265 Carbonic Anhydrase In Complex With Fragment Length 2e-14
1cnj_A259 X-Ray Crystallographic Studies Of Engineered Hydrog 2e-14
3rld_A260 Crystal Structure Of The Y7i Mutant Of Human Carbon 2e-14
2nxr_A260 Structural Effects Of Hydrophobic Mutations On The 2e-14
3rg4_A260 Crystal Structure Of The W5f Mutant Of Human Carbon 2e-14
1tg3_A260 Effect Of Shuttle Location And Ph Environment On H+ 2e-14
2fnm_A260 Activation Of Human Carbonic Anhdyrase Ii By Exogen 2e-14
4g0c_A257 Neutron Structure Of Acetazolamide-Bound Human Carb 2e-14
3tmj_A258 Joint X-RayNEUTRON STRUCTURE OF HUMAN CARBONIC ANHY 2e-14
3r16_A257 Human Caii Bound To N-(4-Sulfamoylphenyl)-2-(Thioph 2e-14
1g3z_A259 Carbonic Anhydrase Ii (F131v) Length = 259 2e-14
2fnk_A260 Activation Of Human Carbonic Anhydrase Ii By Exogen 2e-14
1g6v_A260 Complex Of The Camelid Heavy-Chain Antibody Fragmen 2e-14
1lzv_A260 Site-Specific Mutant (Tyr7 Replaced With His) Of Hu 2e-14
3pyk_A260 Human Carbonic Anhydrase Ii As Host For Pianostool 2e-14
3kkx_A260 Neutron Structure Of Human Carbonic Anhydrase Ii Le 2e-14
2pov_A259 The Crystal Structure Of The Human Carbonic Anhydra 2e-14
2fnn_A260 Activation Of Human Carbonic Anhydrase Ii By Exogen 2e-14
3dv7_A259 Role Of Hydrophilic Residues In Proton Transfer Dur 2e-14
2cbe_A260 Structure Of Native And Apo Carbonic Anhydrase Ii A 2e-14
1xpz_A258 Structure Of Human Carbonic Anhydrase Ii With 4-[4- 2e-14
1f2w_A259 The Mechanism Of Cyanamide Hydration Catalyzed By C 2e-14
3dvc_A259 X-Ray Crystal Structure Of Mutant N62t Of Human Car 2e-14
3dvb_A259 X-Ray Crystal Structure Of Mutant N62v Human Carbon 2e-14
3rge_A260 Crystal Structure Of The W5h Mutant Of Human Carbon 2e-14
3mnh_A260 Human Carbonic Anhydrase Ii Mutant K170a Length = 2 2e-14
3dvd_A259 X-Ray Crystal Structure Of Mutant N62d Of Human Car 2e-14
3ryv_B259 Carbonic Anhydrase Complexed With N-Ethyl-4-Sulfamo 3e-14
3rg3_A260 Crystal Structure Of The W5e Mutant Of Human Carbon 3e-14
1th9_A260 Effect Of Shuttle Location And Ph Environment On H+ 3e-14
1cnh_A259 X-Ray Crystallographic Studies Of Engineered Hydrog 3e-14
3pjj_A259 Synthetic Dimer Of Human Carbonic Anhydrase Ii Leng 3e-14
3mnj_A260 Human Carbonic Anhydrase Ii Mutant K170e Length = 2 3e-14
3mni_A260 Human Carbonic Anhydrase Ii Mutant K170d Length = 2 3e-14
3u3a_X260 Structure Of Human Carbonic Anhydrase Ii V143i Leng 3e-14
3dbu_A260 Use Of Carbonic Anhydrase Ii, Ix Active-Site Mimic, 3e-14
4bcw_A257 Carbonic Anhydrase Ix Mimic In Complex With (e)-2-( 3e-14
1lg5_A260 Crystal Structure Analysis Of The Hca Ii Mutant T19 4e-14
1uga_A258 Human Carbonic Anhydrase Ii[hcaii] (E.C.4.2.1.1) Mu 4e-14
1ugc_A258 Human Carbonic Anhydrase Ii [hcaii] (e.c.4.2.1.1) M 4e-14
1ugd_A258 Human Carbonic Anhydrase Ii[hcaii] (E.C.4.2.1.1) Mu 4e-14
3mnk_A260 Human Carbonic Anhydrase Ii Mutant K170h Length = 2 4e-14
1z97_A266 Human Carbonic Anhydrase Iii: Structural And Kineti 4e-14
1ugb_A258 Human Carbonic Anhydrase Ii[hcaii] (E.C.4.2.1.1) Mu 4e-14
1ugf_A258 Human Carbonic Anhydrase Ii [hcaii] (E.C.4.2.1.1) M 4e-14
1uge_A258 Human Carbonic Anhydrase Ii [hcaii] (E.C.4.2.1.1) M 4e-14
1cnk_A259 X-Ray Crystallographic Studies Of Engineered Hydrog 5e-14
1cak_A259 Structural Analysis Of The Zinc Hydroxide-Thr 199-G 5e-14
1zsa_A259 Carbonic Anhydrase Ii Mutant E117q, Apo Form Length 5e-14
5ca2_A260 Conformational Mobility Of His-64 In The Thr-200 (R 5e-14
1caj_A259 Structural Analysis Of The Zinc Hydroxide-Thr 199-G 6e-14
1zh9_A259 Carbonic Anhydrase Ii In Complex With N-4-methyl-1- 6e-14
1ydb_A259 Structural Basis Of Inhibitor Affinity To Variants 6e-14
3u47_A260 Human Carbonic Anhydrase Ii V143l Length = 260 6e-14
3u45_X260 Human Carbonic Anhydrase Ii V143a Length = 260 7e-14
12ca_A260 Altering The Mouth Of A Hydrophobic Pocket. Structu 7e-14
1flj_A260 Crystal Structure Of S-Glutathiolated Carbonic Anhy 7e-14
6ca2_A260 Engineering The Hydrophobic Pocket Of Carbonic Anhy 8e-14
1j9w_A260 Solution Structure Of The Cai Michigan 1 Variant Le 8e-14
2foy_A260 Human Carbonic Anhydrase I Complexed With A Two-Pro 8e-14
1cva_A259 Structural And Functional Importance Of A Conserved 8e-14
1cal_A259 Structural Analysis Of The Zinc Hydroxide-Thr 199-G 8e-14
2it4_A256 X Ray Structure Of The Complex Between Carbonic Anh 8e-14
1dca_A260 Structure Of An Engineered Metal Binding Site In Hu 9e-14
1crm_A260 Structure And Function Of Carbonic Anhydrases Lengt 9e-14
9ca2_A260 Engineering The Hydrophobic Pocket Of Carbonic Anhy 9e-14
1yo0_A260 Proton Transfer From His200 In Human Carbonic Anhyd 9e-14
1z93_A266 Human Carbonic Anhydrase Iii:structural And Kinetic 1e-13
1ccs_A259 Structure-Assisted Redesign Of A Protein-Zinc Bindi 1e-13
1hed_A260 Structural Consequences Of Hydrophilic Amino-Acid S 1e-13
3uyq_A260 Hca 3 Length = 260 1e-13
2hfw_A260 Structural And Kinetic Analysis Of Proton Shuttle R 1e-13
1ydd_A259 Structural Basis Of Inhibitor Affinity To Variants 1e-13
1cct_A259 Structure-Assisted Redesign Of A Protein-Zinc Bindi 1e-13
1cai_A259 Structural Analysis Of The Zinc Hydroxide-Thr 199-G 1e-13
1cng_A259 X-Ray Crystallographic Studies Of Engineered Hydrog 1e-13
1hea_A260 Carbonic Anhydrase Ii (Carbonate Dehydratase) (Hca 1e-13
3uyn_A260 Hca 3 Length = 260 1e-13
1bic_A259 Crystallographic Analysis Of Thr-200-> His Human Ca 1e-13
1ccu_A259 Structure-Assisted Redesign Of A Protein-Zinc Bindi 1e-13
1heb_A260 Structural Consequences Of Hydrophilic Amino-Acid S 1e-13
1yda_A259 Structural Basis Of Inhibitor Affinity To Variants 1e-13
1hec_A260 Structural Consequences Of Hydrophilic Amino-Acid S 1e-13
7ca2_A260 Engineering The Hydrophobic Pocket Of Carbonic Anhy 2e-13
1h9q_A259 H119q Carbonic Anhydrase Ii Length = 259 2e-13
8ca2_A260 Engineering The Hydrophobic Pocket Of Carbonic Anhy 2e-13
1h4n_A259 H94n Carbonic Anhydrase Ii Complexed With Tris Leng 2e-13
1h9n_A259 H119n Carbonic Anhydrase Ii Length = 259 2e-13
1mua_A256 Structure And Energetics Of A Non-Proline Cis-Pepti 2e-13
3da2_A262 X-Ray Structure Of Human Carbonic Anhydrase 13 In C 2e-13
1znc_A266 Human Carbonic Anhydrase Iv Length = 266 2e-13
3czv_A264 Crystal Structure Of The Human Carbonic Anhydrase X 2e-13
1cve_A259 Structural Consequences Of Redesigning A Protein-Zi 3e-13
1cvc_A259 Redesigning The Zinc Binding Site Of Human Carbonic 3e-13
1cvf_A259 Structural Consequences Of Redesigning A Protein-Zi 3e-13
1cvd_A255 Structural Consequences Of Redesigning A Protein-Zi 3e-13
1cvh_A255 Structural Consequences Of Redesigning A Protein-Zi 3e-13
1hva_A260 Engineering The Zinc Binding Site Of Human Carbonic 3e-13
1cnb_A259 Compensatory Plastic Effects In The Redesign Of Pro 4e-13
1fqm_A260 X-Ray Crystal Structure Of Zinc-Bound F93iF95MW97V 2e-12
1fql_A260 X-Ray Crystal Structure Of Zinc-Bound F95mW97V CARB 7e-12
1fr7_A260 X-Ray Crystal Structure Of Zinc-Bound F93sF95LW97M 9e-12
2w2j_A291 Crystal Structure Of The Human Carbonic Anhydrase R 2e-10
2znc_A258 Murine Carbonic Anhydrase Iv Length = 258 1e-09
3s97_A273 Ptprz Cntn1 Complex Length = 273 1e-08
3jxf_A272 Ca-Like Domain Of Human Ptprz Length = 272 1e-08
4e9o_X269 Vaccinia D8l Ectodomain Structure Length = 269 2e-08
1kop_A223 Neisseria Gonorrhoeae Carbonic Anhydrase Length = 2 5e-05
3q31_A244 Structure Of Fungal Alpha Carbonic Anhydrase From A 2e-04
3b1b_A377 The Unique Structure Of Wild Type Carbonic Anhydras 5e-04
>pdb|3FE4|A Chain A, Crystal Structure Of Human Carbonic Anhydrase Vi Length = 278 Back     alignment and structure 
Iteration: 1

 Score = 99.0 bits (245), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 66/185 (35%), Positives = 85/185 (45%), Gaps = 52/185 (28%)
Query: 56  YILDSIHFHWGG-------SEHTFNGQRLATEVHLVHYNSQYESLTEAKDEPRGLAVIAV 108
           YI   +HFHWGG       SEHT +G R   E+H+VHYNS+Y+S   A+D P GLAV+A 
Sbjct: 86  YIAQQMHFHWGGASSEISGSEHTVDGIRHVIEIHIVHYNSKYKSYDIAQDAPDGLAVLAA 145
Query: 109 IIHETPEDNPILAPLVSSLDHVTPWLRCFCTRLLIYTILLQMSSHFQETPEDNPILAPLV 168
            +                                            +  PE N   +  +
Sbjct: 146 FV------------------------------------------EVKNYPE-NTYYSNFI 162
Query: 169 SSLGETIDDPGESTSLPIPLAPSDLLPANRSAFFRYSGSLTTPPCSESVEWTVLYRTVGA 228
           S L   I  PG+ T+L   L   D+LP N   ++ Y GSLTTPPC+E+V W VL   V  
Sbjct: 163 SHLA-NIKYPGQRTTL-TGLDVQDMLPRNLQHYYTYHGSLTTPPCTENVHWFVLADFVKL 220
Query: 229 SRTQV 233
           SRTQV
Sbjct: 221 SRTQV 225
>pdb|1RJ5|A Chain A, Crystal Structure Of The Extracellular Domain Of Murine Carbonic Anhydrase Xiv Length = 261 Back     alignment and structure
>pdb|3IAI|A Chain A, Crystal Structure Of The Catalytic Domain Of The Tumor-Associated Human Carbonic Anhydrase Ix Length = 257 Back     alignment and structure
>pdb|1V9I|C Chain C, Crystal Structure Analysis Of The Site Specific Mutant (Q253c) Of Bovine Carbonic Anhydrase Ii Length = 261 Back     alignment and structure
>pdb|1V9E|A Chain A, Crystal Structure Analysis Of Bovine Carbonic Anhydrase Ii Length = 259 Back     alignment and structure
>pdb|3JXH|C Chain C, Ca-Like Domain Of Human Ptprg Length = 265 Back     alignment and structure
>pdb|1KEQ|A Chain A, Crystal Structure Of F65aY131C CARBONIC ANHYDRASE V, Covalently Modified With 4-Chloromethylimidazole Length = 248 Back     alignment and structure
>pdb|3ML5|A Chain A, Crystal Structure Of The C183sC217S MUTANT OF HUMAN CA VII IN COMPLEX With Acetazolamide Length = 269 Back     alignment and structure
>pdb|1JCZ|A Chain A, Crystal Structure Of The Extracellular Domain Of Human Carbonic Anhydrase Xii Length = 263 Back     alignment and structure
>pdb|1DMX|A Chain A, Murine Mitochondrial Carbonic Anyhdrase V At 2.45 Angstroms Resolution Length = 248 Back     alignment and structure
>pdb|3M1Q|A Chain A, Carbonic Anhydrase Ii Mutant W5c-H64c With Opened Disulfide Bond Length = 265 Back     alignment and structure
>pdb|3MDZ|A Chain A, Crystal Structure Of Human Carbonic Anhydrase Vii [isoform 1], Ca7 Length = 281 Back     alignment and structure
>pdb|3KIG|A Chain A, Mutant Carbonic Anhydrase Ii In Complex With An Azide And An Alkyne Length = 265 Back     alignment and structure
>pdb|1URT|A Chain A, Murine Carbonic Anhydrase V Length = 248 Back     alignment and structure
>pdb|3V3J|A Chain A, Kinetic And Structural Studies Of Thermostabilized Mutants Of Hca Ii Length = 260 Back     alignment and structure
>pdb|3V3I|B Chain B, Kinetic And Structural Studies Of Thermostabilized Mutants Of Hca Ii Length = 260 Back     alignment and structure
>pdb|3V3G|B Chain B, Kinetic And Structural Studies Of Thermostabilized Mutants Of Hca Ii Length = 260 Back     alignment and structure
>pdb|3V3H|B Chain B, Kinetic And Structural Studies Of Thermostabilized Mutants Of Hca Ii Length = 260 Back     alignment and structure
>pdb|2NWY|A Chain A, Structural And Kinetic Effects Of Hydrophobic Mutations On The Active Site Of Human Carbonic Anhydrase Ii Length = 260 Back     alignment and structure
>pdb|3V3F|A Chain A, Kinetic And Structural Studies Of Thermostabilized Mutants Of Hca Ii Length = 260 Back     alignment and structure
>pdb|3TVO|X Chain X, Human Carbonic Anhydrase Ii Proton Transfer Double Mutant Length = 258 Back     alignment and structure
>pdb|1G0E|A Chain A, Site-Specific Mutant (His64 Replaced With Ala) Of Human Carbonic Anhydrase Ii Complexed With 4-Methylimidazole Length = 260 Back     alignment and structure
>pdb|1CNI|A Chain A, X-Ray Crystallographic Studies Of Engineered Hydrogen Bond Networks In A Protein-Zinc Binding Site Length = 259 Back     alignment and structure
>pdb|3TVN|X Chain X, Human Carbonic Anhydrase Ii Proton Transfer Mutant Length = 258 Back     alignment and structure
>pdb|2NWO|A Chain A, Structural And Kinetic Effect Of Hydrophobic Mutations In The Active Site Of Human Carbonic Anhydrase Ii Length = 260 Back     alignment and structure
>pdb|2FOQ|A Chain A, Human Carbonic Anhydrase Ii Complexed With Two-Prong Inhibitors Length = 260 Back     alignment and structure
>pdb|3M1K|A Chain A, Carbonic Anhydrase In Complex With Fragment Length = 265 Back     alignment and structure
>pdb|1CNJ|A Chain A, X-Ray Crystallographic Studies Of Engineered Hydrogen Bond Networks In A Protein-Zinc Binding Site Length = 259 Back     alignment and structure
>pdb|3RLD|A Chain A, Crystal Structure Of The Y7i Mutant Of Human Carbonic Anhydrase Ii Length = 260 Back     alignment and structure
>pdb|2NXR|A Chain A, Structural Effects Of Hydrophobic Mutations On The Active Site Of Human Carbonic Anhydrase Ii Length = 260 Back     alignment and structure
>pdb|3RG4|A Chain A, Crystal Structure Of The W5f Mutant Of Human Carbonic Anhydrase Ii Length = 260 Back     alignment and structure
>pdb|1TG3|A Chain A, Effect Of Shuttle Location And Ph Environment On H+ Transfer In Human Carbonic Anhydrase Ii Length = 260 Back     alignment and structure
>pdb|2FNM|A Chain A, Activation Of Human Carbonic Anhdyrase Ii By Exogenous Proton Donors Length = 260 Back     alignment and structure
>pdb|4G0C|A Chain A, Neutron Structure Of Acetazolamide-Bound Human Carbonic Anhydrase Ii Reveal Molecular Details Of Drug Binding Length = 257 Back     alignment and structure
>pdb|3TMJ|A Chain A, Joint X-RayNEUTRON STRUCTURE OF HUMAN CARBONIC ANHYDRASE II AT PH 7.8 Length = 258 Back     alignment and structure
>pdb|3R16|A Chain A, Human Caii Bound To N-(4-Sulfamoylphenyl)-2-(Thiophen-2-Yl) Acetamide Length = 257 Back     alignment and structure
>pdb|1G3Z|A Chain A, Carbonic Anhydrase Ii (F131v) Length = 259 Back     alignment and structure
>pdb|2FNK|A Chain A, Activation Of Human Carbonic Anhydrase Ii By Exogenous Proton Donors Length = 260 Back     alignment and structure
>pdb|1G6V|A Chain A, Complex Of The Camelid Heavy-Chain Antibody Fragment Cab- Ca05 With Bovine Carbonic Anhydrase Length = 260 Back     alignment and structure
>pdb|1LZV|A Chain A, Site-Specific Mutant (Tyr7 Replaced With His) Of Human Carbonic Anhydrase Ii Length = 260 Back     alignment and structure
>pdb|3PYK|A Chain A, Human Carbonic Anhydrase Ii As Host For Pianostool Complexes Bearing A Sulfonamide Anchor Length = 260 Back     alignment and structure
>pdb|3KKX|A Chain A, Neutron Structure Of Human Carbonic Anhydrase Ii Length = 260 Back     alignment and structure
>pdb|2POV|A Chain A, The Crystal Structure Of The Human Carbonic Anhydrase Ii In Complex With 4-Amino-6-Chloro-Benzene-1,3-Disulfonamide Length = 259 Back     alignment and structure
>pdb|2FNN|A Chain A, Activation Of Human Carbonic Anhydrase Ii By Exogenous Proton Donors Length = 260 Back     alignment and structure
>pdb|3DV7|A Chain A, Role Of Hydrophilic Residues In Proton Transfer During Catalysis By Human Carbonic Anhydrase Ii (N62a) Length = 259 Back     alignment and structure
>pdb|2CBE|A Chain A, Structure Of Native And Apo Carbonic Anhydrase Ii And Some Of Its Anion-Ligand Complexes Length = 260 Back     alignment and structure
>pdb|1XPZ|A Chain A, Structure Of Human Carbonic Anhydrase Ii With 4-[4-O- Sulfamoylbenzyl)(4-Cyanophenyl)amino]-4h-[1,2, 4]-Triazole Length = 258 Back     alignment and structure
>pdb|1F2W|A Chain A, The Mechanism Of Cyanamide Hydration Catalyzed By Carbonic Anhydrase Ii Revealed By Cryogenic X-Ray Diffraction Length = 259 Back     alignment and structure
>pdb|3DVC|A Chain A, X-Ray Crystal Structure Of Mutant N62t Of Human Carbonic Anhydrase Ii Length = 259 Back     alignment and structure
>pdb|3DVB|A Chain A, X-Ray Crystal Structure Of Mutant N62v Human Carbonic Anhydrase Ii Length = 259 Back     alignment and structure
>pdb|3RGE|A Chain A, Crystal Structure Of The W5h Mutant Of Human Carbonic Anhydrase Ii Length = 260 Back     alignment and structure
>pdb|3MNH|A Chain A, Human Carbonic Anhydrase Ii Mutant K170a Length = 260 Back     alignment and structure
>pdb|3DVD|A Chain A, X-Ray Crystal Structure Of Mutant N62d Of Human Carbonic Anhydrase Ii Length = 259 Back     alignment and structure
>pdb|3RYV|B Chain B, Carbonic Anhydrase Complexed With N-Ethyl-4-Sulfamoylbenzamide Length = 259 Back     alignment and structure
>pdb|3RG3|A Chain A, Crystal Structure Of The W5e Mutant Of Human Carbonic Anhydrase Ii Length = 260 Back     alignment and structure
>pdb|1TH9|A Chain A, Effect Of Shuttle Location And Ph Environment On H+ Transfer In Human Carbonic Anhydrase Ii Length = 260 Back     alignment and structure
>pdb|1CNH|A Chain A, X-Ray Crystallographic Studies Of Engineered Hydrogen Bond Networks In A Protein-Zinc Binding Site Length = 259 Back     alignment and structure
>pdb|3PJJ|A Chain A, Synthetic Dimer Of Human Carbonic Anhydrase Ii Length = 259 Back     alignment and structure
>pdb|3MNJ|A Chain A, Human Carbonic Anhydrase Ii Mutant K170e Length = 260 Back     alignment and structure
>pdb|3MNI|A Chain A, Human Carbonic Anhydrase Ii Mutant K170d Length = 260 Back     alignment and structure
>pdb|3U3A|X Chain X, Structure Of Human Carbonic Anhydrase Ii V143i Length = 260 Back     alignment and structure
>pdb|3DBU|A Chain A, Use Of Carbonic Anhydrase Ii, Ix Active-Site Mimic, For The Purpose Of Screening Inhibitors For Possible Anti-Cancer Properties Length = 260 Back     alignment and structure
>pdb|4BCW|A Chain A, Carbonic Anhydrase Ix Mimic In Complex With (e)-2-(5-bromo- 2-hydroxyphenyl)ethenesulfonic Acid Length = 257 Back     alignment and structure
>pdb|1LG5|A Chain A, Crystal Structure Analysis Of The Hca Ii Mutant T199p In Complex With Beta-Mercaptoethanol Length = 260 Back     alignment and structure
>pdb|1UGA|A Chain A, Human Carbonic Anhydrase Ii[hcaii] (E.C.4.2.1.1) Mutant With Ala 65 Replaced By Phe (A65f) Length = 258 Back     alignment and structure
>pdb|1UGC|A Chain A, Human Carbonic Anhydrase Ii [hcaii] (e.c.4.2.1.1) Mutant With Ala 65 Replaced By His (a65h) Length = 258 Back     alignment and structure
>pdb|1UGD|A Chain A, Human Carbonic Anhydrase Ii[hcaii] (E.C.4.2.1.1) Mutant With Ala 65 Replaced By Ser (A65s) Length = 258 Back     alignment and structure
>pdb|3MNK|A Chain A, Human Carbonic Anhydrase Ii Mutant K170h Length = 260 Back     alignment and structure
>pdb|1Z97|A Chain A, Human Carbonic Anhydrase Iii: Structural And Kinetic Study Of Catalysis And Proton Transfer Length = 266 Back     alignment and structure
>pdb|1UGB|A Chain A, Human Carbonic Anhydrase Ii[hcaii] (E.C.4.2.1.1) Mutant With Ala 65 Replaced By Gly (A65g) Length = 258 Back     alignment and structure
>pdb|1UGF|A Chain A, Human Carbonic Anhydrase Ii [hcaii] (E.C.4.2.1.1) Mutant With Ala 65 Replaced By Thr (A65t) Length = 258 Back     alignment and structure
>pdb|1UGE|A Chain A, Human Carbonic Anhydrase Ii [hcaii] (E.C.4.2.1.1) Mutant With Ala 65 Replaced By Leu (A65l) Length = 258 Back     alignment and structure
>pdb|1CNK|A Chain A, X-Ray Crystallographic Studies Of Engineered Hydrogen Bond Networks In A Protein-Zinc Binding Site Length = 259 Back     alignment and structure
>pdb|1CAK|A Chain A, Structural Analysis Of The Zinc Hydroxide-Thr 199-Glu 106 Hydrogen Bonding Network In Human Carbonic Anhydrase Ii Length = 259 Back     alignment and structure
>pdb|1ZSA|A Chain A, Carbonic Anhydrase Ii Mutant E117q, Apo Form Length = 259 Back     alignment and structure
>pdb|5CA2|A Chain A, Conformational Mobility Of His-64 In The Thr-200 (Right Arrow) Ser Mutant Of Human Carbonic Anhydrase Ii Length = 260 Back     alignment and structure
>pdb|1CAJ|A Chain A, Structural Analysis Of The Zinc Hydroxide-Thr 199-Glu 106 Hydrogen Bonding Network In Human Carbonic Anhydrase Ii Length = 259 Back     alignment and structure
>pdb|1ZH9|A Chain A, Carbonic Anhydrase Ii In Complex With N-4-methyl-1- Piperazinyl-n'-(p-sulfonamide)phenylthiourea As Sulfonamide Inhibitor Length = 259 Back     alignment and structure
>pdb|1YDB|A Chain A, Structural Basis Of Inhibitor Affinity To Variants Of Human Carbonic Anhydrase Ii Length = 259 Back     alignment and structure
>pdb|3U47|A Chain A, Human Carbonic Anhydrase Ii V143l Length = 260 Back     alignment and structure
>pdb|3U45|X Chain X, Human Carbonic Anhydrase Ii V143a Length = 260 Back     alignment and structure
>pdb|12CA|A Chain A, Altering The Mouth Of A Hydrophobic Pocket. Structure And Kinetics Of Human Carbonic Anhydrase Ii Mutants At Residue Val-121 Length = 260 Back     alignment and structure
>pdb|1FLJ|A Chain A, Crystal Structure Of S-Glutathiolated Carbonic Anhydrase Iii Length = 260 Back     alignment and structure
>pdb|6CA2|A Chain A, Engineering The Hydrophobic Pocket Of Carbonic Anhydrase Ii Length = 260 Back     alignment and structure
>pdb|1J9W|A Chain A, Solution Structure Of The Cai Michigan 1 Variant Length = 260 Back     alignment and structure
>pdb|2FOY|A Chain A, Human Carbonic Anhydrase I Complexed With A Two-Prong Inhibitor Length = 260 Back     alignment and structure
>pdb|1CVA|A Chain A, Structural And Functional Importance Of A Conserved Hydrogen Bond Network In Human Carbonic Anhydrase Ii Length = 259 Back     alignment and structure
>pdb|1CAL|A Chain A, Structural Analysis Of The Zinc Hydroxide-Thr 199-Glu 106 Hydrogen Bonding Network In Human Carbonic Anhydrase Ii Length = 259 Back     alignment and structure
>pdb|2IT4|A Chain A, X Ray Structure Of The Complex Between Carbonic Anhydrase I And The Phosphonate Antiviral Drug Foscarnet Length = 256 Back     alignment and structure
>pdb|1DCA|A Chain A, Structure Of An Engineered Metal Binding Site In Human Carbonic Anhydrase Ii Reveals The Architecture Of A Regulatory Cysteine Switch Length = 260 Back     alignment and structure
>pdb|1CRM|A Chain A, Structure And Function Of Carbonic Anhydrases Length = 260 Back     alignment and structure
>pdb|9CA2|A Chain A, Engineering The Hydrophobic Pocket Of Carbonic Anhydrase Ii Length = 260 Back     alignment and structure
>pdb|1YO0|A Chain A, Proton Transfer From His200 In Human Carbonic Anhydrase Ii Length = 260 Back     alignment and structure
>pdb|1Z93|A Chain A, Human Carbonic Anhydrase Iii:structural And Kinetic Study Of Catalysis And Proton Transfer Length = 266 Back     alignment and structure
>pdb|1CCS|A Chain A, Structure-Assisted Redesign Of A Protein-Zinc Binding Site With Femtomolar Affinity Length = 259 Back     alignment and structure
>pdb|1HED|A Chain A, Structural Consequences Of Hydrophilic Amino-Acid Substitutions In The Hydrophobic Pocket Of Human Carbonic Anhydrase Ii Length = 260 Back     alignment and structure
>pdb|3UYQ|A Chain A, Hca 3 Length = 260 Back     alignment and structure
>pdb|2HFW|A Chain A, Structural And Kinetic Analysis Of Proton Shuttle Residues In The Active Site Of Human Carbonic Anhydrase Iii Length = 260 Back     alignment and structure
>pdb|1YDD|A Chain A, Structural Basis Of Inhibitor Affinity To Variants Of Human Carbonic Anhydrase Ii Length = 259 Back     alignment and structure
>pdb|1CCT|A Chain A, Structure-Assisted Redesign Of A Protein-Zinc Binding Site With Femtomolar Affinity Length = 259 Back     alignment and structure
>pdb|1CAI|A Chain A, Structural Analysis Of The Zinc Hydroxide-Thr 199-Glu 106 Hydrogen Bonding Network In Human Carbonic Anhydrase Ii Length = 259 Back     alignment and structure
>pdb|1CNG|A Chain A, X-Ray Crystallographic Studies Of Engineered Hydrogen Bond Networks In A Protein-Zinc Binding Site Length = 259 Back     alignment and structure
>pdb|1HEA|A Chain A, Carbonic Anhydrase Ii (Carbonate Dehydratase) (Hca Ii) (E.C.4.2.1.1) Mutant With Leu 198 Replaced By Arg (L198r) Length = 260 Back     alignment and structure
>pdb|3UYN|A Chain A, Hca 3 Length = 260 Back     alignment and structure
>pdb|1BIC|A Chain A, Crystallographic Analysis Of Thr-200-> His Human Carbonic Anhydrase Ii And Its Complex With The Substrate, Hco3- Length = 259 Back     alignment and structure
>pdb|1CCU|A Chain A, Structure-Assisted Redesign Of A Protein-Zinc Binding Site With Femtomolar Affinity Length = 259 Back     alignment and structure
>pdb|1HEB|A Chain A, Structural Consequences Of Hydrophilic Amino-Acid Substitutions In The Hydrophobic Pocket Of Human Carbonic Anhydrase Ii Length = 260 Back     alignment and structure
>pdb|1YDA|A Chain A, Structural Basis Of Inhibitor Affinity To Variants Of Human Carbonic Anhydrase Ii Length = 259 Back     alignment and structure
>pdb|1HEC|A Chain A, Structural Consequences Of Hydrophilic Amino-Acid Substitutions In The Hydrophobic Pocket Of Human Carbonic Anhydrase Ii Length = 260 Back     alignment and structure
>pdb|7CA2|A Chain A, Engineering The Hydrophobic Pocket Of Carbonic Anhydrase Ii Length = 260 Back     alignment and structure
>pdb|1H9Q|A Chain A, H119q Carbonic Anhydrase Ii Length = 259 Back     alignment and structure
>pdb|8CA2|A Chain A, Engineering The Hydrophobic Pocket Of Carbonic Anhydrase Ii Length = 260 Back     alignment and structure
>pdb|1H4N|A Chain A, H94n Carbonic Anhydrase Ii Complexed With Tris Length = 259 Back     alignment and structure
>pdb|1H9N|A Chain A, H119n Carbonic Anhydrase Ii Length = 259 Back     alignment and structure
>pdb|1MUA|A Chain A, Structure And Energetics Of A Non-Proline Cis-Peptidyl Linkage In An Engineered Protein Length = 256 Back     alignment and structure
>pdb|3DA2|A Chain A, X-Ray Structure Of Human Carbonic Anhydrase 13 In Complex With Inhibitor Length = 262 Back     alignment and structure
>pdb|1ZNC|A Chain A, Human Carbonic Anhydrase Iv Length = 266 Back     alignment and structure
>pdb|3CZV|A Chain A, Crystal Structure Of The Human Carbonic Anhydrase Xiii In Complex With Acetazolamide Length = 264 Back     alignment and structure
>pdb|1CVE|A Chain A, Structural Consequences Of Redesigning A Protein-Zinc Binding Site Length = 259 Back     alignment and structure
>pdb|1CVC|A Chain A, Redesigning The Zinc Binding Site Of Human Carbonic Anhydrase Ii: Structure Of A His2asp-Zn2+ Metal Coordination Polyhedron Length = 259 Back     alignment and structure
>pdb|1CVF|A Chain A, Structural Consequences Of Redesigning A Protein-Zinc Binding Site Length = 259 Back     alignment and structure
>pdb|1CVD|A Chain A, Structural Consequences Of Redesigning A Protein-Zinc Binding Site Length = 255 Back     alignment and structure
>pdb|1CVH|A Chain A, Structural Consequences Of Redesigning A Protein-Zinc Binding Site Length = 255 Back     alignment and structure
>pdb|1HVA|A Chain A, Engineering The Zinc Binding Site Of Human Carbonic Anhydrase Ii: Structure Of The His-94-> Cys Apoenzyme In A New Crystalline Form Length = 260 Back     alignment and structure
>pdb|1CNB|A Chain A, Compensatory Plastic Effects In The Redesign Of Protein- Zinc Binding Sites Length = 259 Back     alignment and structure
>pdb|1FQM|A Chain A, X-Ray Crystal Structure Of Zinc-Bound F93iF95MW97V Carbonic Anhydrase (Caii) Variant Length = 260 Back     alignment and structure
>pdb|1FQL|A Chain A, X-Ray Crystal Structure Of Zinc-Bound F95mW97V CARBONIC Anhydrase (Caii) Variant Length = 260 Back     alignment and structure
>pdb|1FR7|A Chain A, X-Ray Crystal Structure Of Zinc-Bound F93sF95LW97M Carbonic Anhydrase (Caii) Variant Length = 260 Back     alignment and structure
>pdb|2W2J|A Chain A, Crystal Structure Of The Human Carbonic Anhydrase Related Protein Viii Length = 291 Back     alignment and structure
>pdb|2ZNC|A Chain A, Murine Carbonic Anhydrase Iv Length = 258 Back     alignment and structure
>pdb|3S97|A Chain A, Ptprz Cntn1 Complex Length = 273 Back     alignment and structure
>pdb|3JXF|A Chain A, Ca-Like Domain Of Human Ptprz Length = 272 Back     alignment and structure
>pdb|4E9O|X Chain X, Vaccinia D8l Ectodomain Structure Length = 269 Back     alignment and structure
>pdb|1KOP|A Chain A, Neisseria Gonorrhoeae Carbonic Anhydrase Length = 223 Back     alignment and structure
>pdb|3Q31|A Chain A, Structure Of Fungal Alpha Carbonic Anhydrase From Aspergillus Oryzae Length = 244 Back     alignment and structure
>pdb|3B1B|A Chain A, The Unique Structure Of Wild Type Carbonic Anhydrase Alpha-Ca1 From Chlamydomonas Reinhardtii Length = 377 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query239
3iai_A257 Carbonic anhydrase 9; transmembrane proteins, cell 4e-50
3k34_A260 Carbonic anhydrase 2; atomic resolution, sulfonami 2e-49
1rj5_A261 Carbonic anhydrase XIV; beta-sheet, alpha-helix, z 6e-49
2hfx_A260 Carbonic anhydrase 3; proton shuttle, HCA III, pro 1e-48
3fe4_A278 Carbonic anhydrase 6; secretion, metal binding, st 2e-47
3d0n_A264 Carbonic anhydrase 13; lyase, metal-binding, metal 4e-47
1keq_A248 F65A/Y131C-MI carbonic anhydrase V; proton transfe 4e-47
2foy_A260 Carbonic anhydrase 1; lyase, zinc, inhibitor, copp 5e-47
3jxg_A269 Receptor-type tyrosine-protein phosphatase gamma; 1e-46
1jd0_A263 Carbonic anhydrase XII; extracellular domain, bito 1e-46
3fw3_A266 Carbonic anhydrase 4; structure-based drug design. 2e-46
3jxf_A272 Receptor-type tyrosine-protein phosphatase zeta; C 3e-46
3ml5_A269 Carbonic anhydrase 7; protein-inhibitor complex, l 6e-46
2znc_A258 Carbonic anhydrase IV; lyase, zinc, murine, membra 1e-45
1y7w_A291 Halotolerant alpha-type carbonic anhydrase (DCA I; 1e-45
4e9o_X269 D8L antigen, IMV membrane protein; CAH alpha fold, 2e-43
2w2j_A291 Carbonic anhydrase-related protein; lyase, metal-b 1e-41
3b1b_A377 Carbonic anhydrase 1; N-glycosylation, zinc-finger 2e-39
3q31_A244 Carbonic anhydrase; glysosy secreted, dimeric, lya 3e-37
1kop_A223 Carbonic anhydrase; lyase, structural trimming; 1. 5e-36
>3iai_A Carbonic anhydrase 9; transmembrane proteins, cell membrane, projection, disulfide bond, glycoprotein, lyase, membrane, binding, nucleus; HET: AZM NAG BMA MAN; 2.20A {Homo sapiens} Length = 257 Back     alignment and structure
 Score =  163 bits (414), Expect = 4e-50
 Identities = 60/190 (31%), Positives = 83/190 (43%), Gaps = 51/190 (26%)

Query: 49  AGGLYNYYILDSIHFHWG-----GSEHTFNGQRLATEVHLVHYNSQYESLTEAKDEPRGL 103
           A G    Y    +H HWG     GSEHT  G R   E+H+VH ++ +  + EA   P GL
Sbjct: 79  ALGPGREYRALQLHLHWGAAGRPGSEHTVEGHRFPAEIHVVHLSTAFARVDEALGRPGGL 138

Query: 104 AVIAVIIHETPEDNPILAPLVSSLDHVTPWLRCFCTRLLIYTILLQMSSHFQETPEDNPI 163
           AV+A  + E PE+N     L+S L+ +                                 
Sbjct: 139 AVLAAFLEEGPEENSAYEQLLSRLEEIA-------------------------------- 166

Query: 164 LAPLVSSLGETIDDPGESTSLPIPLAPSDLLPANRSAFFRYSGSLTTPPCSESVEWTVLY 223
                        + G  T +P  L  S LLP++ S +F+Y GSLTTPPC++ V WTV  
Sbjct: 167 -------------EEGSETQVP-GLDISALLPSDFSRYFQYEGSLTTPPCAQGVIWTVFN 212

Query: 224 RTVGASRTQV 233
           +TV  S  Q+
Sbjct: 213 QTVMLSAKQL 222
>3k34_A Carbonic anhydrase 2; atomic resolution, sulfonamide inhibitor mutation, lyase, metal-binding, lyase-lyase inhibitor compl; HET: HGB SUA; 0.90A {Homo sapiens} PDB: 1ca3_A* 1cnw_A* 1cny_A* 1eou_A* 1g6v_A 1hca_A 1kwq_A* 1kwr_A* 1t9n_A 1tb0_X 1tbt_X 1te3_X 1teq_X 1teu_X 1cnx_A 1xev_A 1xeg_A 2ax2_A* 2eu3_A* 2ez7_A* ... Length = 260 Back     alignment and structure
>1rj5_A Carbonic anhydrase XIV; beta-sheet, alpha-helix, zinc enzyme, lyase; HET: NAG BMA; 2.81A {Mus musculus} SCOP: b.74.1.1 PDB: 1rj6_A* Length = 261 Back     alignment and structure
>3fe4_A Carbonic anhydrase 6; secretion, metal binding, structural GEN structural genomics consortium, SGC, glycoprotein, lyase, M binding, secreted; 1.90A {Homo sapiens} Length = 278 Back     alignment and structure
>3d0n_A Carbonic anhydrase 13; lyase, metal-binding, metal binding PROT; HET: GOL; 1.55A {Homo sapiens} PDB: 3czv_A* 3da2_A* Length = 264 Back     alignment and structure
>1keq_A F65A/Y131C-MI carbonic anhydrase V; proton transfer, engineered residue, lyase; HET: 4MZ; 1.88A {Mus musculus} SCOP: b.74.1.1 PDB: 1dmx_A 1dmy_A* 1urt_A Length = 248 Back     alignment and structure
>2foy_A Carbonic anhydrase 1; lyase, zinc, inhibitor, copper; HET: B30; 1.55A {Homo sapiens} SCOP: b.74.1.1 PDB: 1bzm_A* 1czm_A* 1azm_A 1hug_A 1huh_A 1hcb_A* 2fw4_A* 2nmx_A* 2nn1_A* 2nn7_A* 3lxe_A* 1jv0_A 1j9w_A 1crm_A 2cab_A 2it4_A Length = 260 Back     alignment and structure
>1jd0_A Carbonic anhydrase XII; extracellular domain, bitopic protein, type I membrane protein, lyase; HET: AZM; 1.50A {Homo sapiens} SCOP: b.74.1.1 PDB: 1jcz_A* Length = 263 Back     alignment and structure
>3fw3_A Carbonic anhydrase 4; structure-based drug design. small molecule complex. CO-CRYS membrane, disease mutation, glycoprotein, GPI-anchor; HET: ETS GLC; 1.72A {Homo sapiens} PDB: 1znc_A* 3f7b_A* 3f7u_A* Length = 266 Back     alignment and structure
>3jxf_A Receptor-type tyrosine-protein phosphatase zeta; Ca-like domain, alternative splicing, glycoprotein, hydrolase, membrane, polymorphism; 2.00A {Homo sapiens} PDB: 3s97_A* Length = 272 Back     alignment and structure
>3ml5_A Carbonic anhydrase 7; protein-inhibitor complex, lyase; HET: AZM; 2.05A {Homo sapiens} PDB: 3mdz_A* Length = 269 Back     alignment and structure
>2znc_A Carbonic anhydrase IV; lyase, zinc, murine, membrane; 2.80A {Mus musculus} SCOP: b.74.1.1 PDB: 3znc_A* Length = 258 Back     alignment and structure
>1y7w_A Halotolerant alpha-type carbonic anhydrase (DCA I; haltolerant protein, algal Ca anhydrase, salt tolerant protein, zinc enzyme; 1.86A {Dunaliella salina} Length = 291 Back     alignment and structure
>4e9o_X D8L antigen, IMV membrane protein; CAH alpha fold, VP7 motif, beta sheet, cell surface chondroi binding, viral entry, chondroitin sulfate; 1.42A {Vaccinia virus} PDB: 4etq_X Length = 269 Back     alignment and structure
>2w2j_A Carbonic anhydrase-related protein; lyase, metal-binding; 1.60A {Homo sapiens} Length = 291 Back     alignment and structure
>3b1b_A Carbonic anhydrase 1; N-glycosylation, zinc-finger, lyase; HET: NAG; 1.88A {Chlamydomonas reinhardtii} Length = 377 Back     alignment and structure
>3q31_A Carbonic anhydrase; glysosy secreted, dimeric, lyase; HET: NAG; 2.70A {Aspergillus oryzae} Length = 244 Back     alignment and structure
>1kop_A Carbonic anhydrase; lyase, structural trimming; 1.90A {Neisseria gonorrhoeae} SCOP: b.74.1.1 PDB: 1koq_A Length = 223 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query239
3k34_A260 Carbonic anhydrase 2; atomic resolution, sulfonami 100.0
1keq_A248 F65A/Y131C-MI carbonic anhydrase V; proton transfe 100.0
2hfx_A260 Carbonic anhydrase 3; proton shuttle, HCA III, pro 100.0
2foy_A260 Carbonic anhydrase 1; lyase, zinc, inhibitor, copp 100.0
3d0n_A264 Carbonic anhydrase 13; lyase, metal-binding, metal 100.0
3ml5_A269 Carbonic anhydrase 7; protein-inhibitor complex, l 100.0
3fw3_A266 Carbonic anhydrase 4; structure-based drug design. 100.0
2w2j_A291 Carbonic anhydrase-related protein; lyase, metal-b 100.0
3jxg_A269 Receptor-type tyrosine-protein phosphatase gamma; 100.0
3jxf_A272 Receptor-type tyrosine-protein phosphatase zeta; C 100.0
1rj5_A261 Carbonic anhydrase XIV; beta-sheet, alpha-helix, z 100.0
2znc_A258 Carbonic anhydrase IV; lyase, zinc, murine, membra 100.0
1jd0_A263 Carbonic anhydrase XII; extracellular domain, bito 100.0
3iai_A257 Carbonic anhydrase 9; transmembrane proteins, cell 100.0
3fe4_A278 Carbonic anhydrase 6; secretion, metal binding, st 100.0
4e9o_X269 D8L antigen, IMV membrane protein; CAH alpha fold, 100.0
1kop_A223 Carbonic anhydrase; lyase, structural trimming; 1. 100.0
1y7w_A291 Halotolerant alpha-type carbonic anhydrase (DCA I; 100.0
3b1b_A377 Carbonic anhydrase 1; N-glycosylation, zinc-finger 100.0
3q31_A244 Carbonic anhydrase; glysosy secreted, dimeric, lya 100.0
>3k34_A Carbonic anhydrase 2; atomic resolution, sulfonamide inhibitor mutation, lyase, metal-binding, lyase-lyase inhibitor compl; HET: HGB SUA; 0.90A {Homo sapiens} SCOP: b.74.1.1 PDB: 1ca3_A* 1cnw_A* 1cny_A* 1eou_A* 1g6v_A 1hca_A 1kwq_A* 1kwr_A* 1t9n_A 1tb0_X 1tbt_X 1te3_X 1teq_X 1teu_X 1cnx_A 1xev_A 1xeg_A 2ax2_A* 2eu3_A* 2ez7_A* ... Back     alignment and structure
Probab=100.00  E-value=7.6e-54  Score=381.59  Aligned_cols=183  Identities=34%  Similarity=0.603  Sum_probs=157.8

Q ss_pred             Cccchhhhhhhh-cCCCCc-ccccCCce---------EEEEEcCCCCeeEEeccCCCCceeeeEEEEeec-----CCccc
Q psy12959          8 RPGALQLLHTRL-HSLIPL-FSYFPFCA---------VVLKLDQNEKEIGIAAGGLYNYYILDSIHFHWG-----GSEHT   71 (239)
Q Consensus         8 ~~~~~~~~~~~~-~~~~~~-~~y~~~~~---------~~~~~~~~~~~~~i~gg~l~~~Y~l~q~HfHwG-----gSEHt   71 (239)
                      +|+-|....... ..+.|+ ++|++..+         +.+.++++.+.+.|+||||...|+|.|||||||     ||||+
T Consensus        29 SPInI~~~~~~~~~~l~~l~~~Y~~~~~~~l~NnGhtv~v~~~~~~~~~~i~gg~L~~~Y~l~Q~HfHWG~~~~~gSEHt  108 (260)
T 3k34_A           29 SPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHT  108 (260)
T ss_dssp             SCCEECTTTCEECTTCEEEEEECTTCCEEEEEECSSSEEEEECCSSSCSEEEEETCCSCEEEEEEEEEECSSTTCCCSSE
T ss_pred             CCEEEccCceEecCCCcceeeeecCCceEEEEECCeEEEEEEcCCCCceEEeCCCCCCcEEEEEEEEecCCCCCCCCcce
Confidence            455444333222 345666 78876543         346666555668999999999999999999998     99999


Q ss_pred             ccCccccceEEEEEeecCCCChhhhhcCCCceEEEEEEEeeCCCCCCCccccccccCCCCcccccccchhhhhHHHhhhc
Q psy12959         72 FNGQRLATEVHLVHYNSQYESLTEAKDEPRGLAVIAVIIHETPEDNPILAPLVSSLDHVTPWLRCFCTRLLIYTILLQMS  151 (239)
Q Consensus        72 idG~~~~~E~HiVh~~~~y~~~~eA~~~~~glaVlavf~~~~~~~n~~l~~~~~~~~~~~~~~~~~c~r~~~~~~~~~~~  151 (239)
                      |||++|||||||||+|.+|.+++||...++||||||||++++ ..|+.++                              
T Consensus       109 idG~~~p~ElH~VH~n~~y~~~~eA~~~~~glaVlgv~~~~g-~~n~~l~------------------------------  157 (260)
T 3k34_A          109 VDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVG-SAKPGLQ------------------------------  157 (260)
T ss_dssp             ETTBCCSEEEEEEEEEGGGSSHHHHTTSTTSEEEEEEEEEES-SCCGGGH------------------------------
T ss_pred             eccccCCcceeEEEecCCCCCHHHHhhccCceEEEEEEEecC-CCCHHHH------------------------------
Confidence            999999999999999999999999999999999999999999 4588877                              


Q ss_pred             ccccCCCCCCCchhhHHHHhcccCCCCCCeeEcCCCCCCCCcCCCCCCCcEEEeecccCCCCCCceEEEEeCeeeecCHH
Q psy12959        152 SHFQETPEDNPILAPLVSSLGETIDDPGESTSLPIPLAPSDLLPANRSAFFRYSGSLTTPPCSESVEWTVLYRTVGASRT  231 (239)
Q Consensus       152 ~~~~~~~~~~~~l~~i~~~l~~~i~~~g~~~~i~~~~~l~~Llp~~~~~yy~Y~GSLTTPPCsE~V~WiV~~~pi~IS~~  231 (239)
                                    +|++.| ..|..+|+.+.+.. |++.+|||.+. +||+|.||||||||+|+|+|+||++|+.||.+
T Consensus       158 --------------~i~~~l-~~i~~~g~~~~~~~-~~l~~Llp~~~-~yy~Y~GSLTTPPC~E~V~W~V~~~pi~iS~~  220 (260)
T 3k34_A          158 --------------KVVDVL-DSIKTKGKSADFTN-FDPRGLLPESL-DYWTYPGSLTTPPLLECVTWIVLKEPISVSSE  220 (260)
T ss_dssp             --------------HHHHHG-GGSCSTTCEEECCS-CCGGGGCCSCC-CEEEEEECCSSTTCCSCEEEEEESSCEEECHH
T ss_pred             --------------HHHHHH-HhhccCCceeecCC-cCHHHHcCCCC-CeEEEecCccCCCCccceEEEEEeeeEEECHH
Confidence                          899999 88998999888865 99999999986 99999999999999999999999999999999


Q ss_pred             HHhCccC
Q psy12959        232 QVSNPIG  238 (239)
Q Consensus       232 Ql~~~~~  238 (239)
                      ||++|+.
T Consensus       221 Ql~~fr~  227 (260)
T 3k34_A          221 QVLKFRK  227 (260)
T ss_dssp             HHHHHTT
T ss_pred             HHHHHHH
Confidence            9998863
>1keq_A F65A/Y131C-MI carbonic anhydrase V; proton transfer, engineered residue, lyase; HET: 4MZ; 1.88A {Mus musculus} SCOP: b.74.1.1 PDB: 1dmx_A 1dmy_A* 1urt_A Back     alignment and structure
>2foy_A Carbonic anhydrase 1; lyase, zinc, inhibitor, copper; HET: B30; 1.55A {Homo sapiens} SCOP: b.74.1.1 PDB: 1bzm_A* 1czm_A* 1azm_A 1hug_A 1huh_A 1hcb_A* 2fw4_A* 2nmx_A* 2nn1_A* 2nn7_A* 3lxe_A* 1jv0_A 1j9w_A 1crm_A 2cab_A 2it4_A Back     alignment and structure
>3d0n_A Carbonic anhydrase 13; lyase, metal-binding, metal binding PROT; HET: GOL; 1.55A {Homo sapiens} PDB: 3czv_A* 3da2_A* Back     alignment and structure
>3ml5_A Carbonic anhydrase 7; protein-inhibitor complex, lyase; HET: AZM; 2.05A {Homo sapiens} SCOP: b.74.1.1 PDB: 3mdz_A* Back     alignment and structure
>3fw3_A Carbonic anhydrase 4; structure-based drug design. small molecule complex. CO-CRYS membrane, disease mutation, glycoprotein, GPI-anchor; HET: ETS GLC; 1.72A {Homo sapiens} SCOP: b.74.1.1 PDB: 1znc_A* 3f7b_A* 3f7u_A* Back     alignment and structure
>2w2j_A Carbonic anhydrase-related protein; lyase, metal-binding; 1.60A {Homo sapiens} Back     alignment and structure
>3jxf_A Receptor-type tyrosine-protein phosphatase zeta; Ca-like domain, alternative splicing, glycoprotein, hydrolase, membrane, polymorphism; 2.00A {Homo sapiens} SCOP: b.74.1.0 PDB: 3s97_A* Back     alignment and structure
>1rj5_A Carbonic anhydrase XIV; beta-sheet, alpha-helix, zinc enzyme, lyase; HET: NAG BMA; 2.81A {Mus musculus} SCOP: b.74.1.1 PDB: 1rj6_A* Back     alignment and structure
>2znc_A Carbonic anhydrase IV; lyase, zinc, murine, membrane; 2.80A {Mus musculus} SCOP: b.74.1.1 PDB: 3znc_A* Back     alignment and structure
>1jd0_A Carbonic anhydrase XII; extracellular domain, bitopic protein, type I membrane protein, lyase; HET: AZM; 1.50A {Homo sapiens} SCOP: b.74.1.1 PDB: 1jcz_A* Back     alignment and structure
>3iai_A Carbonic anhydrase 9; transmembrane proteins, cell membrane, projection, disulfide bond, glycoprotein, lyase, membrane, binding, nucleus; HET: AZM NAG BMA MAN; 2.20A {Homo sapiens} SCOP: b.74.1.0 Back     alignment and structure
>3fe4_A Carbonic anhydrase 6; secretion, metal binding, structural GEN structural genomics consortium, SGC, glycoprotein, lyase, M binding, secreted; 1.90A {Homo sapiens} SCOP: b.74.1.0 Back     alignment and structure
>4e9o_X D8L antigen, IMV membrane protein; CAH alpha fold, VP7 motif, beta sheet, cell surface chondroi binding, viral entry, chondroitin sulfate; 1.42A {Vaccinia virus} PDB: 4etq_X Back     alignment and structure
>1kop_A Carbonic anhydrase; lyase, structural trimming; 1.90A {Neisseria gonorrhoeae} SCOP: b.74.1.1 PDB: 1koq_A Back     alignment and structure
>1y7w_A Halotolerant alpha-type carbonic anhydrase (DCA I; haltolerant protein, algal Ca anhydrase, salt tolerant protein, zinc enzyme; 1.86A {Dunaliella salina} Back     alignment and structure
>3b1b_A Carbonic anhydrase 1; N-glycosylation, zinc-finger, lyase; HET: NAG; 1.88A {Chlamydomonas reinhardtii} Back     alignment and structure
>3q31_A Carbonic anhydrase; glysosy secreted, dimeric, lyase; HET: NAG; 2.70A {Aspergillus oryzae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 239
d1rj6a_259 b.74.1.1 (A:) Carbonic anhydrase {Mouse (Mus muscu 4e-34
d1flja_259 b.74.1.1 (A:) Carbonic anhydrase {Rat (Rattus norv 2e-31
d1luga_259 b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapi 8e-31
d1jd0a_260 b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapi 2e-30
d1keqa_238 b.74.1.1 (A:) Carbonic anhydrase {Mouse (Mus muscu 4e-30
d1hcba_258 b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapi 5e-30
d1znca_262 b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapi 3e-28
d2znca_258 b.74.1.1 (A:) Carbonic anhydrase {Mouse (Mus muscu 9e-27
d1kopa_223 b.74.1.1 (A:) Carbonic anhydrase {Neisseria gonorr 9e-19
>d1rj6a_ b.74.1.1 (A:) Carbonic anhydrase {Mouse (Mus musculus), isozyme XIV [TaxId: 10090]} Length = 259 Back     information, alignment and structure

class: All beta proteins
fold: Carbonic anhydrase
superfamily: Carbonic anhydrase
family: Carbonic anhydrase
domain: Carbonic anhydrase
species: Mouse (Mus musculus), isozyme XIV [TaxId: 10090]

 Score =  121 bits (303), Expect = 4e-34
 Identities = 62/194 (31%), Positives = 85/194 (43%), Gaps = 53/194 (27%)

Query: 47  IAAGGLYNYYILDSIHFHWG------GSEHTFNGQRLATEVHLVHYNSQ-YESLTEAKDE 99
           +  GGL   Y    +H HWG      GSEH  N +  A E+H+VHY+SQ Y SL+EA  +
Sbjct: 75  LHLGGLPRKYTAAQLHLHWGQRGSLEGSEHHINSEATAAELHVVHYDSQSYSSLSEAAQK 134

Query: 100 PRGLAVIAVIIHETPEDNPILAPLVSSLDHVTPWLRCFCTRLLIYTILLQMSSHFQETPE 159
           P+GLAV+ ++I     +NP    ++S L  +                             
Sbjct: 135 PQGLAVLGILIEVGETENPAYDHILSRLHEIRY--------------------------- 167

Query: 160 DNPILAPLVSSLGETIDDPGESTSLPIPLAPSDLLPANRSAFFRYSGSLTTPPCSESVEW 219
                               + TS+P P +  +L P     FFRY+GSLTTPPC +SV W
Sbjct: 168 ------------------KDQKTSVP-PFSVRELFPQQLEQFFRYNGSLTTPPCYQSVLW 208

Query: 220 TVLYRTVGASRTQV 233
           TV  R    S  Q+
Sbjct: 209 TVFNRRAQISMGQL 222
>d1flja_ b.74.1.1 (A:) Carbonic anhydrase {Rat (Rattus norvegicus), isozyme III [TaxId: 10116]} Length = 259 Back     information, alignment and structure
>d1luga_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II [TaxId: 9606]} Length = 259 Back     information, alignment and structure
>d1jd0a_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), isozyme XII [TaxId: 9606]} Length = 260 Back     information, alignment and structure
>d1keqa_ b.74.1.1 (A:) Carbonic anhydrase {Mouse (Mus musculus), liver, isozyme V [TaxId: 10090]} Length = 238 Back     information, alignment and structure
>d1hcba_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme I [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1znca_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), isozyme IV [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d2znca_ b.74.1.1 (A:) Carbonic anhydrase {Mouse (Mus musculus), isozyme IV [TaxId: 10090]} Length = 258 Back     information, alignment and structure
>d1kopa_ b.74.1.1 (A:) Carbonic anhydrase {Neisseria gonorrhoeae [TaxId: 485]} Length = 223 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query239
d1flja_259 Carbonic anhydrase {Rat (Rattus norvegicus), isozy 100.0
d1hcba_258 Carbonic anhydrase {Human (Homo sapiens), erythroc 100.0
d1luga_259 Carbonic anhydrase {Human (Homo sapiens), erythroc 100.0
d1keqa_238 Carbonic anhydrase {Mouse (Mus musculus), liver, i 100.0
d1rj6a_259 Carbonic anhydrase {Mouse (Mus musculus), isozyme 100.0
d1jd0a_260 Carbonic anhydrase {Human (Homo sapiens), isozyme 100.0
d1znca_262 Carbonic anhydrase {Human (Homo sapiens), isozyme 100.0
d2znca_258 Carbonic anhydrase {Mouse (Mus musculus), isozyme 100.0
d1kopa_223 Carbonic anhydrase {Neisseria gonorrhoeae [TaxId: 100.0
>d1flja_ b.74.1.1 (A:) Carbonic anhydrase {Rat (Rattus norvegicus), isozyme III [TaxId: 10116]} Back     information, alignment and structure
class: All beta proteins
fold: Carbonic anhydrase
superfamily: Carbonic anhydrase
family: Carbonic anhydrase
domain: Carbonic anhydrase
species: Rat (Rattus norvegicus), isozyme III [TaxId: 10116]

Probab=100.00  E-value=6.1e-49  Score=346.54  Aligned_cols=182  Identities=34%  Similarity=0.605  Sum_probs=155.9

Q ss_pred             Cccchhhhhhhhc-CCCCc-ccccCCceE---------EEEEcCCCCeeEEeccCCCCceeeeEEEEeec-----CCccc
Q psy12959          8 RPGALQLLHTRLH-SLIPL-FSYFPFCAV---------VLKLDQNEKEIGIAAGGLYNYYILDSIHFHWG-----GSEHT   71 (239)
Q Consensus         8 ~~~~~~~~~~~~~-~~~~~-~~y~~~~~~---------~~~~~~~~~~~~i~gg~l~~~Y~l~q~HfHwG-----gSEHt   71 (239)
                      +|+-|........ .+.++ +.|.+....         .+.+++....++|.||+|..+|.|.|||||||     ||||+
T Consensus        28 SPInI~~~~~~~~~~l~~l~~~y~~~~~~~l~N~G~t~~~~~~~~~~~~~~~gg~l~~~Y~l~q~hfHwG~~~~~gSEH~  107 (259)
T d1flja_          28 SPIELHTKDIRHDPSLQPWSVSYDPGSAKTILNNGKTCRVVFDDTFDRSMLRGGPLSGPYRLRQFHLHWGSSDDHGSEHT  107 (259)
T ss_dssp             SCCEECGGGEEECTTCCCEEEECCGGGEEEEEECSSCEEEEECCSSSSSEEEETTCSSCEEEEEEEEEECSSTTCCCSSE
T ss_pred             CCEeECcCceeECCCCCceeeeccCCCceEEEecCeEEEEEEcCCCCeeEEecCccccceeeEEEEEEeCCCCCCCccee
Confidence            5555544333322 44566 778776553         35566555678899999999999999999998     99999


Q ss_pred             ccCccccceEEEEEeecCCCChhhhhcCCCceEEEEEEEeeCCCCCCCccccccccCCCCcccccccchhhhhHHHhhhc
Q psy12959         72 FNGQRLATEVHLVHYNSQYESLTEAKDEPRGLAVIAVIIHETPEDNPILAPLVSSLDHVTPWLRCFCTRLLIYTILLQMS  151 (239)
Q Consensus        72 idG~~~~~E~HiVh~~~~y~~~~eA~~~~~glaVlavf~~~~~~~n~~l~~~~~~~~~~~~~~~~~c~r~~~~~~~~~~~  151 (239)
                      |||++|||||||||++.+|.++.+|.+.++++|||+||++++ .+|+.++                              
T Consensus       108 idG~~~~~E~h~VH~n~~~~~~~~a~~~~~~lav~~v~~~~~-~~n~~~~------------------------------  156 (259)
T d1flja_         108 VDGVKYAAELHLVHWNPKYNTFGEALKQPDGIAVVGIFLKIG-REKGEFQ------------------------------  156 (259)
T ss_dssp             ETTBCCSEEEEEEEECGGGSSHHHHTTSTTSEEEEEEEEEES-SCCHHHH------------------------------
T ss_pred             ECCEecCCceEEEEecCCCCCHHHHhcCCCCcEEEEEEEecC-CcchHHH------------------------------
Confidence            999999999999999999999999999999999999999998 4676666                              


Q ss_pred             ccccCCCCCCCchhhHHHHhcccCCCCCCeeEcCCCCCCCCcCCCCCCCcEEEeecccCCCCCCceEEEEeCeeeecCHH
Q psy12959        152 SHFQETPEDNPILAPLVSSLGETIDDPGESTSLPIPLAPSDLLPANRSAFFRYSGSLTTPPCSESVEWTVLYRTVGASRT  231 (239)
Q Consensus       152 ~~~~~~~~~~~~l~~i~~~l~~~i~~~g~~~~i~~~~~l~~Llp~~~~~yy~Y~GSLTTPPCsE~V~WiV~~~pi~IS~~  231 (239)
                                    .+++.+ ..|..++....+.. |+|..|+|... +||+|.||||||||+|+|+|+||++|+.||++
T Consensus       157 --------------~i~~~l-~~i~~~~~~~~~~~-~~l~~llp~~~-~yy~Y~GSLTtPPC~E~V~W~V~~~p~~IS~~  219 (259)
T d1flja_         157 --------------ILLDAL-DKIKTKGKEAPFNH-FDPSCLFPACR-DYWTYHGSFTTPPCEECIVWLLLKEPMTVSSD  219 (259)
T ss_dssp             --------------HHHHHG-GGGCSTTCEEECCS-CCGGGGCCSCC-CEEEEEECCSSTTCCSCEEEEEESSCEEECHH
T ss_pred             --------------HHHHHH-HhhhccCceeccCC-CCHHHhCcCCC-ccEEEeCccCCCCCCCCeEEEEeceeeeeCHH
Confidence                          888888 88988888888865 99999999884 89999999999999999999999999999999


Q ss_pred             HHhCcc
Q psy12959        232 QVSNPI  237 (239)
Q Consensus       232 Ql~~~~  237 (239)
                      ||++|+
T Consensus       220 Ql~~fr  225 (259)
T d1flja_         220 QMAKLR  225 (259)
T ss_dssp             HHHHHT
T ss_pred             HHHHHH
Confidence            999885
>d1hcba_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme I [TaxId: 9606]} Back     information, alignment and structure
>d1luga_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II [TaxId: 9606]} Back     information, alignment and structure
>d1keqa_ b.74.1.1 (A:) Carbonic anhydrase {Mouse (Mus musculus), liver, isozyme V [TaxId: 10090]} Back     information, alignment and structure
>d1rj6a_ b.74.1.1 (A:) Carbonic anhydrase {Mouse (Mus musculus), isozyme XIV [TaxId: 10090]} Back     information, alignment and structure
>d1jd0a_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), isozyme XII [TaxId: 9606]} Back     information, alignment and structure
>d1znca_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), isozyme IV [TaxId: 9606]} Back     information, alignment and structure
>d2znca_ b.74.1.1 (A:) Carbonic anhydrase {Mouse (Mus musculus), isozyme IV [TaxId: 10090]} Back     information, alignment and structure
>d1kopa_ b.74.1.1 (A:) Carbonic anhydrase {Neisseria gonorrhoeae [TaxId: 485]} Back     information, alignment and structure