Psyllid ID: psy13113


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280------
PVLDSNDARGVIHSPVVKLLAVLRFYATGNFQIDSEDYHDISQSTICRLVAKVSEELAKCHQQWIHFPEDLQTAKNQFSGIAGFPRVVVGCIDGTHVPIELPSIENGEHYRNRKHFYSINVQVIGGPNLEIYDVVASWPGSTHDSRIFQNSRVYSRFDRREIRGLLLGDIGYAQNEFTFTPVRNPITPTPSQVAYNAAQIRTRNSVERLFGVLKRRFACLRKKLANQPTTCSHIITACAVLHNIAIARREAPPPENNELPVNVHIRDADDNRLGAAVREAFINEHF
cEEEccccccccccHHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHcccccEEEEEEccEEEccccccccccccccccccEEEEEEEEEcccccEEEEEEcccccccHHHHHHccHHcHHHHccccccEEEccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHc
ccccccccccccccHHHHHHHHHHHHHccccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHccccccEEEEEEccEEEEEccccHHHHHHcccccccEEEEEEEEccccEEEEEEEcccccccHHHHHHHcHHHHHccccccccEEEEcccccccccEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHcc
pvldsndargvihSPVVKLLAVLRFYAtgnfqidsedyhdisQSTICRLVAKVSEELAKCHQQWIHFPEDLQTAKNqfsgiagfprvvvgcidgthvpielpsiengehyrnrkhfYSINvqviggpnleiydvvaswpgsthdsrifqnsrvysrfdrREIRGLLLGDIgyaqneftftpvrnpitptpsqvayNAAQIRTRNSVERLFGVLKRRFACLRKklanqpttcSHIITACAVLHNIAIarreapppennelpvnvhirdaddnrLGAAVREAFINEHF
pvldsndargvihsPVVKLLAVLRFYATGNFQIDSEDYHDISQSTICRLVAKVSEELAKCHQQWIHFPEDLQTAKNQFSGIAGFPRVVVGCIDGTHVPIELPSIENGEHYRNRKHFYSINVQVIGGPNLEIYDVVASwpgsthdsrifqnsrvysrfdRREIRGLLLGDIGYAQNEFTFTPVRNPITPTPSQVAYNAAQIRTRNSVERLFGVLKRRFACLRKKlanqpttcsHIITACAVLHNIAIARREAPPPENNELPVNVHIRDADDNRLGAAVREAFINEHF
PVLDSNDARGVIHSPVVKLLAVLRFYATGNFQIDSEDYHDISQSTICRLVAKVSEELAKCHQQWIHFPEDLQTAKNQFSGIAGFPRVVVGCIDGTHVPIELPSIENGEHYRNRKHFYSINVQVIGGPNLEIYDVVASWPGSTHDSRIFQNSRVYSRFDRREIRGLLLGDIGYAQNEFTFTPVRNPITPTPSQVAYNAAQIRTRNSVERLFGVLKRRFACLRKKLANQPTTCSHIITACAVLHNIAIarreapppenneLPVNVHIRDADDNRLGAAVREAFINEHF
*********GVIHSPVVKLLAVLRFYATGNFQIDSEDYHDISQSTICRLVAKVSEELAKCHQQWIHFPEDLQTAKNQFSGIAGFPRVVVGCIDGTHVPIELPSIENGEHYRNRKHFYSINVQVIGGPNLEIYDVVASWPGSTHDSRIFQNSRVYSRFDRREIRGLLLGDIGYAQNEFTFTPVRNPITPTPSQVAYNAAQIRTRNSVERLFGVLKRRFACLRKKLANQPTTCSHIITACAVLHNIAIAR**************************************
PVLDS*****V**SPVVKLLAVLRFYATGNFQIDSEDYHDISQSTICRLVAKVSEELAKCHQQWIHFPEDLQTAKNQFSGIAGFPRVVVGCIDGTHVPIELPSIENGEHYRNRKHFYSINVQVIGGPNLEIYDVVASWPGSTHDSRIFQNSRVYSRFDRREIRGLLLGDIGYAQNEFTFTPVRNPITPTPSQVAYNAAQIRTRNSVERLFGVLKRRFACLRKKLANQPTTCSHIITACAVLHNIAIARREAPPPENNELP***************AVREAFINEHF
PVLDSNDARGVIHSPVVKLLAVLRFYATGNFQIDSEDYHDISQSTICRLVAKVSEELAKCHQQWIHFPEDLQTAKNQFSGIAGFPRVVVGCIDGTHVPIELPSIENGEHYRNRKHFYSINVQVIGGPNLEIYDVVASWPGSTHDSRIFQNSRVYSRFDRREIRGLLLGDIGYAQNEFTFTPVRNPITPTPSQVAYNAAQIRTRNSVERLFGVLKRRFACLRKKLANQPTTCSHIITACAVLHNIAIARREAPPPENNELPVNVHIRDADDNRLGAAVREAFINEHF
**********VIHSPVVKLLAVLRFYATGNFQIDSEDYHDISQSTICRLVAKVSEELAKCHQQWIHFPEDLQTAKNQFSGIAGFPRVVVGCIDGTHVPIELPSIENGEHYRNRKHFYSINVQVIGGPNLEIYDVVASWPGSTHDSRIFQNSRVYSRFDRREIRGLLLGDIGYAQNEFTFTPVRNPITPTPSQVAYNAAQIRTRNSVERLFGVLKRRFACLRKKLANQPTTCSHIITACAVLHNIAIARREA***********************AA*REAFINE*F
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PVLDSNDARGVIHSPVVKLLAVLRFYATGNFQIDSEDYHDISQSTICRLVAKVSEELAKCHQQWIHFPEDLQTAKNQFSGIAGFPRVVVGCIDGTHVPIELPSIENGEHYRNRKHFYSINVQVIGGPNLEIYDVVASWPGSTHDSRIFQNSRVYSRFDRREIRGLLLGDIGYAQNEFTFTPVRNPITPTPSQVAYNAAQIRTRNSVERLFGVLKRRFACLRKKLANQPTTCSHIITACAVLHNIAIARREAPPPENNELPVNVHIRDADDNRLGAAVREAFINEHF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query286 2.2.26 [Sep-21-2011]
Q17QR8349 Putative nuclease HARBI1 yes N/A 0.916 0.750 0.345 5e-36
Q8BR93349 Putative nuclease HARBI1 yes N/A 0.800 0.656 0.387 5e-36
B0BN95349 Putative nuclease HARBI1 yes N/A 0.916 0.750 0.345 1e-35
Q96MB7349 Putative nuclease HARBI1 yes N/A 0.916 0.750 0.339 1e-34
Q6AZB8349 Putative nuclease HARBI1 no N/A 0.923 0.756 0.344 1e-34
Q5U538347 Putative nuclease HARBI1 N/A N/A 0.800 0.659 0.329 3e-26
>sp|Q17QR8|HARB1_BOVIN Putative nuclease HARBI1 OS=Bos taurus GN=HARBI1 PE=2 SV=1 Back     alignment and function desciption
 Score =  151 bits (382), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 101/292 (34%), Positives = 147/292 (50%), Gaps = 30/292 (10%)

Query: 14  SPVVKLLAVLRFYATGNFQIDSEDYHDISQSTICRLVAKVSEELAKCHQQWIHFPED--- 70
           SP  ++LA L FY +G+FQ    D   ISQ+++ R VA V+E L +   Q+IHFP D   
Sbjct: 68  SPETQILAALGFYTSGSFQTRMGDAIGISQASMSRCVANVTEALVERASQFIHFPADEAS 127

Query: 71  LQTAKNQFSGIAGFPRVVVGCIDGTHVPIELPSIENGEHYRNRKHFYSINVQVIGGPNLE 130
           +Q  K++F G+AG P  V+G +D  HV I+ P+ E+   Y NRK  +S+N  ++      
Sbjct: 128 VQALKDEFYGLAGIPG-VIGVVDCMHVAIKAPNAEDLS-YVNRKGLHSLNCLMVCDIRGA 185

Query: 131 IYDVVASWPGSTHDSRIFQNSRVYSRFDR-REIRGLLLGDIGYAQNEFTFTPVRNPITPT 189
           +  V  SWPGS  D  + Q S + S+F+        LLGD  +    +  TP+  P   T
Sbjct: 186 LMTVETSWPGSLQDCVVLQQSSLSSQFEAGMHKESWLLGDSSFFLRTWLMTPLHIP--ET 243

Query: 190 PSQVAYNAAQIRTRNSVERLFGVLKRRFACL---RKKLANQPTTCSHIITACAVLHNIAI 246
           P++  YN A   T + +E+ F  L  RF CL   +  L   P   SHII AC VLHNI++
Sbjct: 244 PAEYRYNMAHSATHSVIEKTFRTLCSRFRCLDGSKGALQYSPEKSSHIILACCVLHNISL 303

Query: 247 ARR------------EAPPPENNELPVNVHIRDADDNRLGAAVREAFINEHF 286
                          E PP E  E   ++   D + +R    +R+  +  HF
Sbjct: 304 EHGMDVWSSPVTGPVEQPPEEEYE---HMESLDLEADR----IRQELMLTHF 348




Transposase-derived protein that may have nuclease activity (Potential). Does not have transposase activity.
Bos taurus (taxid: 9913)
EC: 3EC: .EC: 1EC: .EC: -EC: .EC: -
>sp|Q8BR93|HARB1_MOUSE Putative nuclease HARBI1 OS=Mus musculus GN=Harbi1 PE=2 SV=1 Back     alignment and function description
>sp|B0BN95|HARB1_RAT Putative nuclease HARBI1 OS=Rattus norvegicus GN=Harbi1 PE=2 SV=1 Back     alignment and function description
>sp|Q96MB7|HARB1_HUMAN Putative nuclease HARBI1 OS=Homo sapiens GN=HARBI1 PE=1 SV=1 Back     alignment and function description
>sp|Q6AZB8|HARB1_DANRE Putative nuclease HARBI1 OS=Danio rerio GN=harbi1 PE=2 SV=1 Back     alignment and function description
>sp|Q5U538|HARB1_XENLA Putative nuclease HARBI1 OS=Xenopus laevis GN=harbi1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query286
328704555370 PREDICTED: putative nuclease HARBI1-like 0.944 0.729 0.433 6e-52
328705831326 PREDICTED: putative nuclease HARBI1-like 0.944 0.828 0.433 6e-52
328711563335 PREDICTED: putative nuclease HARBI1-like 0.937 0.8 0.419 2e-50
332374146353 unknown [Dendroctonus ponderosae] 0.863 0.699 0.416 2e-50
328697485 681 PREDICTED: hypothetical protein LOC10057 0.856 0.359 0.429 2e-49
328696997356 PREDICTED: putative nuclease HARBI1-like 0.898 0.721 0.430 3e-49
270015185 561 hypothetical protein TcasGA2_TC000011 [T 0.923 0.470 0.419 1e-47
270012680358 hypothetical protein TcasGA2_TC015989 [T 0.944 0.754 0.419 3e-47
350536511353 uncharacterized protein LOC100569528 [Ac 0.944 0.764 0.417 8e-47
193666845342 PREDICTED: putative nuclease HARBI1-like 0.800 0.669 0.453 1e-46
>gi|328704555|ref|XP_001947392.2| PREDICTED: putative nuclease HARBI1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  210 bits (535), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 124/286 (43%), Positives = 169/286 (59%), Gaps = 16/286 (5%)

Query: 14  SPVVKLLAVLRFYATGNFQIDSEDYHDISQSTICRLVAKVSEELAKCHQQWIHFPE---D 70
           +P+ +LL  LRFYATGNF I   D+  IS ++  ++V +VS  LA    ++I  PE   +
Sbjct: 85  APMTQLLITLRFYATGNFLITVGDFGGISVASAGKIVKRVSYALAFLSSRYIRLPETPEE 144

Query: 71  LQTAKNQFSGIAGFPRVVVGCIDGTHVPIELPSIENGEHYRNRKHFYSINVQVIGGPNLE 130
               K QF G+A FP+V+ G ID TH+ ++ PS E GE YRNRK ++S+NVQ +   NLE
Sbjct: 145 KMELKVQFYGLARFPKVI-GAIDCTHIKLQCPSKEYGELYRNRKGYFSLNVQALVNANLE 203

Query: 131 IYDVVASWPGSTHDSRIFQNSRVYSRFDRREIRG-LLLGDIGYAQNEFTFTPVRNPITPT 189
             DVV  WPGS HDS IF NSR+ +R +  E    ++LGD GYA + +  TP+ +  T T
Sbjct: 204 FMDVVVRWPGSAHDSNIFANSRLKARIELPEFSDCIILGDSGYALSHYLLTPLAH--TTT 261

Query: 190 PSQVAYNAAQIRTRNSVERLFGVLKRRFACLRKKLANQPTTCSHIITACAVLHNIAIARR 249
            ++  YN +QIRTRN VER FGV KRRF  L   L  +  T   +I ACAVLHN+A  + 
Sbjct: 262 NAERLYNESQIRTRNVVERSFGVWKRRFPVLFFGLRLKMETTMAVIQACAVLHNMARLQN 321

Query: 250 EAPPP---ENNELPVNVHIRDADD------NRLGAAVREAFINEHF 286
           +  PP   EN +  ++  I + +       N    A+R A I EHF
Sbjct: 322 DPQPPDDIENIKQLLSAEISEIEAATQPQINSPAQALRTALIMEHF 367




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|328705831|ref|XP_003242919.1| PREDICTED: putative nuclease HARBI1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328711563|ref|XP_003244572.1| PREDICTED: putative nuclease HARBI1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|332374146|gb|AEE62214.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
>gi|328697485|ref|XP_003240353.1| PREDICTED: hypothetical protein LOC100574226 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328696997|ref|XP_003240200.1| PREDICTED: putative nuclease HARBI1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|270015185|gb|EFA11633.1| hypothetical protein TcasGA2_TC000011 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270012680|gb|EFA09128.1| hypothetical protein TcasGA2_TC015989 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|350536511|ref|NP_001233059.1| uncharacterized protein LOC100569528 [Acyrthosiphon pisum] gi|239789800|dbj|BAH71500.1| hypothetical protein [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|193666845|ref|XP_001944531.1| PREDICTED: putative nuclease HARBI1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query286
UNIPROTKB|E1BQ99348 HARBI1 "Uncharacterized protei 0.800 0.658 0.379 1.2e-35
MGI|MGI:2443194349 Harbi1 "harbinger transposase 0.800 0.656 0.387 1.1e-34
ZFIN|ZDB-GENE-040608-1349 harbi1 "harbinger transposase 0.940 0.770 0.340 2.2e-34
UNIPROTKB|Q17QR8349 HARBI1 "Putative nuclease HARB 0.800 0.656 0.379 2.8e-34
RGD|1584007349 Harbi1 "harbinger transposase 0.800 0.656 0.379 2.8e-34
UNIPROTKB|F1SIA2349 HARBI1 "Uncharacterized protei 0.800 0.656 0.370 7.4e-34
UNIPROTKB|E2RCW9349 HARBI1 "Uncharacterized protei 0.800 0.656 0.370 5.2e-33
UNIPROTKB|Q96MB7349 HARBI1 "Putative nuclease HARB 0.800 0.656 0.370 5.2e-33
TAIR|locus:2143104502 AT5G12010 [Arabidopsis thalian 0.793 0.452 0.292 3.1e-19
ZFIN|ZDB-GENE-060810-147395 si:dkey-197c15.6 "si:dkey-197c 0.786 0.569 0.297 3.6e-19
UNIPROTKB|E1BQ99 HARBI1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 385 (140.6 bits), Expect = 1.2e-35, P = 1.2e-35
 Identities = 91/240 (37%), Positives = 132/240 (55%)

Query:    14 SPVVKLLAVLRFYATGNFQIDSEDYHDISQSTICRLVAKVSEELAKCHQQWIHFPED--- 70
             SP  ++LA L FY +G+FQ    D   ISQ+++ R VA V+E L +   Q+IHFPED   
Sbjct:    68 SPETQVLAALGFYTSGSFQTRMGDAIGISQASMSRCVANVTEALVERAPQFIHFPEDEAA 127

Query:    71 LQTAKNQFSGIAGFPRVVVGCIDGTHVPIELPSIENGEHYRNRKHFYSINVQVIGGPNLE 130
             +Q+ K+ F  +AG P V+ G +D THV I+ P+ E+   Y NRK  +S+N  ++      
Sbjct:   128 VQSLKDDFYALAGMPGVL-GVVDCTHVAIKAPNAEDLS-YVNRKGLHSLNCLMVCDARGA 185

Query:   131 IYDVVASWPGSTHDSRIFQNSRVYSRFDRREIR-GLLLGDIGYAQNEFTFTPVRNPITPT 189
             +      WPGS  D  + Q + + S+F+    + G LLGD  +    +  TP+  P   T
Sbjct:   186 LLSAETHWPGSMPDCNVLQQAALTSQFENELYKDGWLLGDSSFFLRTWLMTPLHIP--ET 243

Query:   190 PSQVAYNAAQIRTRNSVERLFGVLKRRFACL---RKKLANQPTTCSHIITACAVLHNIAI 246
             P++  YN A   T N +ER F  ++ RF CL   +  L   P   SHII AC VLHNI++
Sbjct:   244 PAEYRYNMAHSATHNVIERTFRTIRSRFRCLDGSKGTLQYSPEKSSHIILACCVLHNISL 303




GO:0005737 "cytoplasm" evidence=IEA
GO:0005813 "centrosome" evidence=IEA
MGI|MGI:2443194 Harbi1 "harbinger transposase derived 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040608-1 harbi1 "harbinger transposase derived 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q17QR8 HARBI1 "Putative nuclease HARBI1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|1584007 Harbi1 "harbinger transposase derived 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1SIA2 HARBI1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2RCW9 HARBI1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q96MB7 HARBI1 "Putative nuclease HARBI1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
TAIR|locus:2143104 AT5G12010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060810-147 si:dkey-197c15.6 "si:dkey-197c15.6" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q17QR8HARB1_BOVIN3, ., 1, ., -, ., -0.34580.91600.7507yesN/A
Q96MB7HARB1_HUMAN3, ., 1, ., -, ., -0.33900.91600.7507yesN/A
B0BN95HARB1_RAT3, ., 1, ., -, ., -0.34580.91600.7507yesN/A
Q8BR93HARB1_MOUSE3, ., 1, ., -, ., -0.38750.80060.6561yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query286
pfam13359155 pfam13359, DDE_4, DDE superfamily endonuclease 5e-39
pfam04827205 pfam04827, Plant_tran, Plant transposon protein 3e-05
>gnl|CDD|222071 pfam13359, DDE_4, DDE superfamily endonuclease Back     alignment and domain information
 Score =  133 bits (338), Expect = 5e-39
 Identities = 50/160 (31%), Positives = 71/160 (44%), Gaps = 13/160 (8%)

Query: 92  IDGTHVPIELPSI--ENGEHYRNRKHFYSINVQVIGGPNLEIYDVVASWPGSTHDSRIFQ 149
           IDGT +PIE P    E  + Y   K   ++ V ++  P+  I  V   WPGS  D RI +
Sbjct: 1   IDGTEIPIERPKSLEEQAQTYSGYKKHNTLKVLIVVDPDGRIIFVSVGWPGSVSDKRILE 60

Query: 150 NSRVYSRFDRREIRGLLLGDIGYAQNEFT-----FTPVRNPITPTPSQVAYNAAQIRTRN 204
           NS +  +    +    +L D G+  ++         P       T  +V +N      R 
Sbjct: 61  NSGLLEKLPPGDY---VLADRGFPLSDSLLAPPAKKPGGAQ--LTEEEVEFNRRIASARI 115

Query: 205 SVERLFGVLKRRFACLRKKLAN-QPTTCSHIITACAVLHN 243
            VER+ G LK RF  LR +L   + TT   I+  C  LHN
Sbjct: 116 HVERVIGRLKGRFRILRGRLRISKLTTLDKIVLVCCALHN 155


This family of proteins are related to pfam00665 and are probably endonucleases of the DDE superfamily. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction. Length = 155

>gnl|CDD|203098 pfam04827, Plant_tran, Plant transposon protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 286
PF13359158 DDE_Tnp_4: DDE superfamily endonuclease 100.0
KOG4585|consensus326 100.0
PF04827205 Plant_tran: Plant transposon protein; InterPro: IP 100.0
PF1361353 HTH_Tnp_4: Helix-turn-helix of DDE superfamily end 99.3
PF13612155 DDE_Tnp_1_3: Transposase DDE domain 99.28
PF01609213 DDE_Tnp_1: Transposase DDE domain; InterPro: IPR00 98.19
PF1358688 DDE_Tnp_1_2: Transposase DDE domain 98.15
PF0279645 HTH_7: Helix-turn-helix domain of resolvase; Inter 97.31
PF0454550 Sigma70_r4: Sigma-70, region 4; InterPro: IPR00763 97.08
PF1393644 HTH_38: Helix-turn-helix domain; PDB: 2W48_A. 96.95
PF1301185 LZ_Tnp_IS481: leucine-zipper of insertion element 96.84
PF0421853 CENP-B_N: CENP-B N-terminal DNA-binding domain; In 96.69
PF1338450 HTH_23: Homeodomain-like domain; PDB: 2X48_C. 96.37
PF1351852 HTH_28: Helix-turn-helix domain 96.3
smart00351125 PAX Paired Box domain. 96.14
PF0522545 HTH_psq: helix-turn-helix, Psq domain; InterPro: I 96.09
cd0056942 HTH_Hin_like Helix-turn-helix domain of Hin and re 95.91
PF0828154 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013 95.81
PRK09413121 IS2 repressor TnpA; Reviewed 95.67
PF0152776 HTH_Tnp_1: Transposase; InterPro: IPR002514 Transp 95.65
cd00131128 PAX Paired Box domain 95.63
cd0657190 Bac_DnaA_C C-terminal domain of bacterial DnaA pro 95.47
PF1334075 DUF4096: Putative transposase of IS4/5 family (DUF 95.4
smart0042158 HTH_LUXR helix_turn_helix, Lux Regulon. lux regulo 95.15
COG3415138 Transposase and inactivated derivatives [DNA repli 95.14
cd0617155 Sigma70_r4 Sigma70, region (SR) 4 refers to the mo 95.12
PF1211682 SpoIIID: Stage III sporulation protein D; InterPro 95.08
PRK00118104 putative DNA-binding protein; Validated 94.75
PF1354252 HTH_Tnp_ISL3: Helix-turn-helix domain of transposa 94.57
PRK04217110 hypothetical protein; Provisional 94.45
PRK09639166 RNA polymerase sigma factor SigX; Provisional 94.3
PRK12529178 RNA polymerase sigma factor; Provisional 94.1
cd0617057 LuxR_C_like C-terminal DNA-binding domain of LuxR- 94.05
TIGR0387973 near_KaiC_dom probable regulatory domain. This mod 93.85
TIGR0253188 yecD_yerC TrpR-related protein YerC/YecD. This mod 93.51
PRK06030124 hypothetical protein; Provisional 93.35
PRK09652182 RNA polymerase sigma factor RpoE; Provisional 93.14
TIGR0284480 spore_III_D sporulation transcriptional regulator 93.12
PHA0067578 hypothetical protein 92.98
PRK08301234 sporulation sigma factor SigE; Reviewed 92.82
PRK05911257 RNA polymerase sigma factor sigma-28; Reviewed 92.71
PF0496753 HTH_10: HTH DNA binding domain; InterPro: IPR00705 92.7
TIGR02985161 Sig70_bacteroi1 RNA polymerase sigma-70 factor, Ba 92.69
PRK03975141 tfx putative transcriptional regulator; Provisiona 92.61
TIGR00721137 tfx DNA-binding protein, Tfx family. Tfx from Meth 92.59
PHA0054282 putative Cro-like protein 92.47
PF1341248 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 92.45
TIGR02952170 Sig70_famx2 RNA polymerase sigma-70 factor, TIGR02 92.34
PF07374100 DUF1492: Protein of unknown function (DUF1492); In 92.27
PRK07037163 extracytoplasmic-function sigma-70 factor; Validat 92.22
TIGR02960324 SigX5 RNA polymerase sigma-70 factor, TIGR02960 fa 92.2
PRK09641187 RNA polymerase sigma factor SigW; Provisional 92.16
PF0132560 Fe_dep_repress: Iron dependent repressor, N-termin 92.16
TIGR02937158 sigma70-ECF RNA polymerase sigma factor, sigma-70 92.12
PRK09638176 RNA polymerase sigma factor SigY; Reviewed 92.1
PRK12547164 RNA polymerase sigma factor; Provisional 92.03
PRK15320251 transcriptional activator SprB; Provisional 92.03
TIGR02989159 Sig-70_gvs1 RNA polymerase sigma-70 factor, Rhodop 91.96
PRK12514179 RNA polymerase sigma factor; Provisional 91.96
PRK12511182 RNA polymerase sigma factor; Provisional 91.93
PRK12519194 RNA polymerase sigma factor; Provisional 91.93
TIGR0132194 TrpR trp operon repressor, proteobacterial. This m 91.92
PF1280262 MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP 91.72
PRK12524196 RNA polymerase sigma factor; Provisional 91.71
PRK12530189 RNA polymerase sigma factor; Provisional 91.7
PF0102247 HTH_5: Bacterial regulatory protein, arsR family; 91.66
PF1373055 HTH_36: Helix-turn-helix domain 91.64
PF0035646 LacI: Bacterial regulatory proteins, lacI family; 91.61
PF0104759 MarR: MarR family; InterPro: IPR000835 The MarR-ty 91.61
PRK12515189 RNA polymerase sigma factor; Provisional 91.6
PRK05803233 sporulation sigma factor SigK; Reviewed 91.56
PRK09415179 RNA polymerase factor sigma C; Reviewed 91.56
PRK12533216 RNA polymerase sigma factor; Provisional 91.56
PF0827955 HTH_11: HTH domain; InterPro: IPR013196 Winged hel 91.52
PF13551112 HTH_29: Winged helix-turn helix 91.44
COG2963116 Transposase and inactivated derivatives [DNA repli 91.41
PRK12537182 RNA polymerase sigma factor; Provisional 91.4
PRK12531194 RNA polymerase sigma factor; Provisional 91.31
PRK15418318 transcriptional regulator LsrR; Provisional 91.3
TIGR02392270 rpoH_proteo alternative sigma factor RpoH. A sigma 91.3
PRK12512184 RNA polymerase sigma factor; Provisional 91.23
PRK12516187 RNA polymerase sigma factor; Provisional 91.18
TIGR02939190 RpoE_Sigma70 RNA polymerase sigma factor RpoE. A s 91.13
PRK09047161 RNA polymerase factor sigma-70; Validated 91.07
PRK11924179 RNA polymerase sigma factor; Provisional 91.0
PRK05602186 RNA polymerase sigma factor; Reviewed 90.9
PRK12534187 RNA polymerase sigma factor; Provisional 90.85
TIGR02948187 SigW_bacill RNA polymerase sigma-W factor. This si 90.85
PRK09643192 RNA polymerase sigma factor SigM; Reviewed 90.82
PF0019658 GerE: Bacterial regulatory proteins, luxR family; 90.75
TIGR02950154 SigM_subfam RNA polymerase sigma factor, SigM fami 90.69
PRK11923193 algU RNA polymerase sigma factor AlgU; Provisional 90.59
PRK06596284 RNA polymerase factor sigma-32; Reviewed 90.57
PRK07408256 RNA polymerase sigma factor SigF; Reviewed 90.53
TIGR02983162 SigE-fam_strep RNA polymerase sigma-70 factor, sig 90.39
TIGR03001244 Sig-70_gmx1 RNA polymerase sigma-70 factor, Myxoco 90.35
PRK12546188 RNA polymerase sigma factor; Provisional 90.07
cd0009267 HTH_CRP helix_turn_helix, cAMP Regulatory protein 90.06
TIGR02984189 Sig-70_plancto1 RNA polymerase sigma-70 factor, Pl 90.03
TIGR02980227 SigBFG RNA polymerase sigma-70 factor, sigma-B/F/G 90.03
PRK05572252 sporulation sigma factor SigF; Validated 90.03
PF0829970 Bac_DnaA_C: Bacterial dnaA protein helix-turn-heli 89.98
PRK06811189 RNA polymerase factor sigma-70; Validated 89.96
PRK12540182 RNA polymerase sigma factor; Provisional 89.93
TIGR02954169 Sig70_famx3 RNA polymerase sigma-70 factor, TIGR02 89.91
TIGR02393238 RpoD_Cterm RNA polymerase sigma factor RpoD, C-ter 89.8
PRK12532195 RNA polymerase sigma factor; Provisional 89.79
TIGR01636134 phage_rinA phage transcriptional activator, RinA f 89.73
TIGR02835234 spore_sigmaE RNA polymerase sigma-E factor. Member 89.72
PF01710119 HTH_Tnp_IS630: Transposase; InterPro: IPR002622 Tr 89.71
PRK06759154 RNA polymerase factor sigma-70; Validated 89.63
PRK06704228 RNA polymerase factor sigma-70; Validated 89.6
PRK12544206 RNA polymerase sigma factor; Provisional 89.56
PRK08583257 RNA polymerase sigma factor SigB; Validated 89.51
TIGR02885231 spore_sigF RNA polymerase sigma-F factor. Members 89.4
PRK08215258 sporulation sigma factor SigG; Reviewed 89.31
PRK12523172 RNA polymerase sigma factor; Reviewed 89.29
PRK07500289 rpoH2 RNA polymerase factor sigma-32; Reviewed 89.27
TIGR02957281 SigX4 RNA polymerase sigma-70 factor, TIGR02957 fa 89.07
PRK12539184 RNA polymerase sigma factor; Provisional 89.04
PRK12528161 RNA polymerase sigma factor; Provisional 89.03
PRK09645173 RNA polymerase sigma factor SigL; Provisional 89.0
PF0137187 Trp_repressor: Trp repressor protein; InterPro: IP 88.97
PRK12520191 RNA polymerase sigma factor; Provisional 88.91
TIGR02999183 Sig-70_X6 RNA polymerase sigma factor, TIGR02999 f 88.8
COG2739105 Uncharacterized protein conserved in bacteria [Fun 88.73
TIGR02943188 Sig70_famx1 RNA polymerase sigma-70 factor, TIGR02 88.66
TIGR02850254 spore_sigG RNA polymerase sigma-G factor. Members 88.64
TIGR02846227 spore_sigmaK RNA polymerase sigma-K factor. The sp 88.61
PRK09637181 RNA polymerase sigma factor SigZ; Provisional 88.53
PRK06930170 positive control sigma-like factor; Validated 88.37
PRK12522173 RNA polymerase sigma factor; Provisional 88.32
TIGR02394285 rpoS_proteo RNA polymerase sigma factor RpoS. A si 88.17
PRK06986236 fliA flagellar biosynthesis sigma factor; Validate 88.15
PRK09636293 RNA polymerase sigma factor SigJ; Provisional 88.02
PF0534465 DUF746: Domain of Unknown Function (DUF746); Inter 88.0
PRK12525168 RNA polymerase sigma factor; Provisional 87.84
PF0933952 HTH_IclR: IclR helix-turn-helix domain; InterPro: 87.8
PRK07405317 RNA polymerase sigma factor SigD; Validated 87.78
COG3293124 Transposase and inactivated derivatives [DNA repli 87.71
COG1595182 RpoE DNA-directed RNA polymerase specialized sigma 87.47
PRK07670251 RNA polymerase sigma factor SigD; Validated 87.47
PF0012660 HTH_1: Bacterial regulatory helix-turn-helix prote 87.33
COG1191247 FliA DNA-directed RNA polymerase specialized sigma 87.05
PRK09642160 RNA polymerase sigma factor SigW; Reviewed 87.01
PF04297101 UPF0122: Putative helix-turn-helix protein, YlxM / 87.0
PRK09648189 RNA polymerase sigma factor SigD; Reviewed 86.96
TIGR02941255 Sigma_B RNA polymerase sigma-B factor. This sigma 86.86
smart0034691 HTH_ICLR helix_turn_helix isocitrate lyase regulat 86.85
PRK13919186 putative RNA polymerase sigma E protein; Provision 86.83
PRK09649185 RNA polymerase sigma factor SigC; Reviewed 86.78
PF1354576 HTH_Crp_2: Crp-like helix-turn-helix domain; PDB: 86.75
PRK12527159 RNA polymerase sigma factor; Reviewed 86.69
PRK08295208 RNA polymerase factor sigma-70; Validated 86.68
PRK07122264 RNA polymerase sigma factor SigF; Reviewed 86.67
PRK12542185 RNA polymerase sigma factor; Provisional 86.56
PRK12536181 RNA polymerase sigma factor; Provisional 86.48
PF0032532 Crp: Bacterial regulatory proteins, crp family; In 86.47
TIGR02479224 FliA_WhiG RNA polymerase sigma factor, FliA/WhiG f 86.38
PF09862113 DUF2089: Protein of unknown function (DUF2089); In 86.33
PRK09635290 sigI RNA polymerase sigma factor SigI; Provisional 86.23
smart0055068 Zalpha Z-DNA-binding domain in adenosine deaminase 86.22
PRK12541161 RNA polymerase sigma factor; Provisional 86.06
PRK12543179 RNA polymerase sigma factor; Provisional 85.88
PRK09644165 RNA polymerase sigma factor SigM; Provisional 85.72
PF13751125 DDE_Tnp_1_6: Transposase DDE domain 85.67
PF1356064 HTH_31: Helix-turn-helix domain; PDB: 3F51_C 3F52_ 85.45
COG2390321 DeoR Transcriptional regulator, contains sigma fac 85.38
PF0960758 BrkDBD: Brinker DNA-binding domain; InterPro: IPR0 85.32
PRK12535196 RNA polymerase sigma factor; Provisional 85.32
PRK12526206 RNA polymerase sigma factor; Provisional 85.27
PRK14088440 dnaA chromosomal replication initiation protein; P 85.09
PF13610140 DDE_Tnp_IS240: DDE domain 84.92
PRK05657325 RNA polymerase sigma factor RpoS; Validated 84.86
PRK12545201 RNA polymerase sigma factor; Provisional 84.84
PRK11922231 RNA polymerase sigma factor; Provisional 84.84
TIGR02959170 SigZ RNA polymerase sigma factor, SigZ family. Thi 84.82
TIGR03697193 NtcA_cyano global nitrogen regulator NtcA, cyanoba 84.66
PRK12517188 RNA polymerase sigma factor; Provisional 84.57
PRK15201198 fimbriae regulatory protein FimW; Provisional 84.3
PRK07406373 RNA polymerase sigma factor RpoD; Validated 84.25
TIGR0161095 phage_O_Nterm phage replication protein O, N-termi 84.09
PRK03573144 transcriptional regulator SlyA; Provisional 83.93
cd0009078 HTH_ARSR Arsenical Resistance Operon Repressor and 83.87
PF0138155 HTH_3: Helix-turn-helix; InterPro: IPR001387 This 83.79
PRK12427231 flagellar biosynthesis sigma factor; Provisional 83.73
PF1346368 HTH_27: Winged helix DNA-binding domain; PDB: 3GFL 83.73
PRK00149450 dnaA chromosomal replication initiation protein; R 83.62
PRK07598415 RNA polymerase sigma factor SigC; Validated 83.61
PRK09646194 RNA polymerase sigma factor SigK; Reviewed 83.52
TIGR02859198 spore_sigH RNA polymerase sigma-H factor. Members 83.49
PRK12538233 RNA polymerase sigma factor; Provisional 83.36
PF0605658 Terminase_5: Putative ATPase subunit of terminase 83.2
PRK11512144 DNA-binding transcriptional repressor MarR; Provis 83.2
smart0034560 HTH_GNTR helix_turn_helix gluconate operon transcr 83.11
PF07638185 Sigma70_ECF: ECF sigma factor 83.1
PRK13870234 transcriptional regulator TraR; Provisional 83.06
PRK11753211 DNA-binding transcriptional dual regulator Crp; Pr 83.01
PF00872381 Transposase_mut: Transposase, Mutator family; Inte 82.81
PRK15411207 rcsA colanic acid capsular biosynthesis activation 82.78
TIGR02947193 SigH_actino RNA polymerase sigma-70 factor, TIGR02 82.57
PRK14086617 dnaA chromosomal replication initiation protein; P 82.52
PF0197868 TrmB: Sugar-specific transcriptional regulator Trm 82.49
PRK09210367 RNA polymerase sigma factor RpoD; Validated 82.27
PRK08241339 RNA polymerase factor sigma-70; Validated 82.26
PRK06288268 RNA polymerase sigma factor WhiG; Reviewed 82.24
PRK09640188 RNA polymerase sigma factor SigX; Reviewed 82.14
PRK05949327 RNA polymerase sigma factor; Validated 81.85
smart0041948 HTH_CRP helix_turn_helix, cAMP Regulatory protein. 81.58
PF1066860 Phage_terminase: Phage terminase small subunit; In 81.53
smart0041866 HTH_ARSR helix_turn_helix, Arsenical Resistance Op 81.53
PRK09651172 RNA polymerase sigma factor FecI; Provisional 81.43
PF0016542 HTH_AraC: Bacterial regulatory helix-turn-helix pr 81.24
PRK09647203 RNA polymerase sigma factor SigE; Reviewed 81.24
PF05263130 DUF722: Protein of unknown function (DUF722); Inte 81.16
PRK10402226 DNA-binding transcriptional activator YeiL; Provis 81.11
PF0470362 FaeA: FaeA-like protein; PDB: 2JT1_A 2HTJ_A. 81.01
PHA0259183 hypothetical protein; Provisional 80.96
PF1284061 HTH_20: Helix-turn-helix domain; PDB: 1ULY_A 2CWE_ 80.84
PF1340442 HTH_AsnC-type: AsnC-type helix-turn-helix domain; 80.28
smart00347101 HTH_MARR helix_turn_helix multiple antibiotic resi 80.23
>PF13359 DDE_Tnp_4: DDE superfamily endonuclease Back     alignment and domain information
Probab=100.00  E-value=1e-38  Score=256.56  Aligned_cols=152  Identities=43%  Similarity=0.690  Sum_probs=139.6

Q ss_pred             eeeeEEEecCCCC--CCccccccCCCccccceeeecCCCccEEEeccCCCCccccccccccchhhhhcc-ccccceEEEc
Q psy13113         92 IDGTHVPIELPSI--ENGEHYRNRKHFYSINVQVIGGPNLEIYDVVASWPGSTHDSRIFQNSRVYSRFD-RREIRGLLLG  168 (286)
Q Consensus        92 iDgt~i~i~~P~~--~~~~~y~~~k~~~s~~~q~vvd~~g~i~~~~~~~~Gs~~D~~~~~~s~l~~~l~-~~~~~~~llg  168 (286)
                      ||||+|++++|..  .+...|+++|+.|++|+|++||++|+|++++.++||++||..+|++|++...++ ..+.++++||
T Consensus         1 iDgt~v~i~~P~~~~~~~~~y~~~k~~~~~~~q~v~d~~g~i~~v~~~~~Gs~~D~~i~~~s~~~~~l~~~~~~~~~~l~   80 (158)
T PF13359_consen    1 IDGTHVPIQRPSDKEEQREFYSGKKKNHSLKVQIVCDPDGRIIYVSVGWPGSVHDSTIFRQSGLLDRLEQAFPPGEYLLG   80 (158)
T ss_pred             CccEEEEEEeCCccccccccccCCCCcceEeEEEEEeccceeEeeecccccccccccccccccccceeecccccCccccc
Confidence            7999999999943  378899999999999999999999999999999999999999999999988876 2222789999


Q ss_pred             cccCCCCCcccccccCC--CCCChhhHHhHHHHHHHHHHHHHHHHHHHhhhhhhhccccCC-ccchHHHHHHHHHHHh
Q psy13113        169 DIGYAQNEFTFTPVRNP--ITPTPSQVAYNAAQIRTRNSVERLFGVLKRRFACLRKKLANQ-PTTCSHIITACAVLHN  243 (286)
Q Consensus       169 D~gY~~~~~l~~p~~~~--~~l~~~~~~~N~~~~~~R~~vE~~~~~lK~rf~~L~~~~~~~-~~~~~~ii~a~~~LhN  243 (286)
                      |+||++.+++++|++++  ..++++|+.||+.+++.|++||++||+||+||++|..+++.+ +..+.++|.+||+|||
T Consensus        81 D~gy~~~~~~~~P~~~~~~~~l~~~e~~~N~~~s~~R~~vE~~~~~lK~rf~~l~~~~~~~~~~~~~~ii~~~~~LhN  158 (158)
T PF13359_consen   81 DSGYPLSPYLLTPYKKPKGRELTPEEKEFNRRHSSARIIVERAFGRLKSRFRILRGRLRLSRPEKAPQIILACCVLHN  158 (158)
T ss_pred             cccccccccccccccccccccccccccchhccccceeeeeHHHHHHHHHhcccCCcccCCCcHhHHHHHHheeEEEEC
Confidence            99999999999999843  348899999999999999999999999999999999899998 9999999999999999



>KOG4585|consensus Back     alignment and domain information
>PF04827 Plant_tran: Plant transposon protein; InterPro: IPR006912 This entry represents a putative Harbinger transposase-derived nuclease, which is thought to have nuclease activity Back     alignment and domain information
>PF13613 HTH_Tnp_4: Helix-turn-helix of DDE superfamily endonuclease Back     alignment and domain information
>PF13612 DDE_Tnp_1_3: Transposase DDE domain Back     alignment and domain information
>PF01609 DDE_Tnp_1: Transposase DDE domain; InterPro: IPR002559 Autonomous mobile genetic elements such as transposon or insertion sequences (IS) encode an enzyme, transposase, that is required for excising and inserting the mobile element Back     alignment and domain information
>PF13586 DDE_Tnp_1_2: Transposase DDE domain Back     alignment and domain information
>PF02796 HTH_7: Helix-turn-helix domain of resolvase; InterPro: IPR006120 Site-specific recombination plays an important role in DNA rearrangement in prokaryotic organisms Back     alignment and domain information
>PF04545 Sigma70_r4: Sigma-70, region 4; InterPro: IPR007630 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PF13936 HTH_38: Helix-turn-helix domain; PDB: 2W48_A Back     alignment and domain information
>PF13011 LZ_Tnp_IS481: leucine-zipper of insertion element IS481 Back     alignment and domain information
>PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere Back     alignment and domain information
>PF13384 HTH_23: Homeodomain-like domain; PDB: 2X48_C Back     alignment and domain information
>PF13518 HTH_28: Helix-turn-helix domain Back     alignment and domain information
>smart00351 PAX Paired Box domain Back     alignment and domain information
>PF05225 HTH_psq: helix-turn-helix, Psq domain; InterPro: IPR007889 This DNA-binding motif is found in four copies in the pipsqueak protein of Drosophila melanogaster [] Back     alignment and domain information
>cd00569 HTH_Hin_like Helix-turn-helix domain of Hin and related proteins, a family of DNA-binding domains unique to bacteria and represented by the Hin protein of Salmonella Back     alignment and domain information
>PF08281 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013249 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PRK09413 IS2 repressor TnpA; Reviewed Back     alignment and domain information
>PF01527 HTH_Tnp_1: Transposase; InterPro: IPR002514 Transposase proteins are necessary for efficient DNA transposition Back     alignment and domain information
>cd00131 PAX Paired Box domain Back     alignment and domain information
>cd06571 Bac_DnaA_C C-terminal domain of bacterial DnaA proteins Back     alignment and domain information
>PF13340 DUF4096: Putative transposase of IS4/5 family (DUF4096) Back     alignment and domain information
>smart00421 HTH_LUXR helix_turn_helix, Lux Regulon Back     alignment and domain information
>COG3415 Transposase and inactivated derivatives [DNA replication, recombination, and repair] Back     alignment and domain information
>cd06171 Sigma70_r4 Sigma70, region (SR) 4 refers to the most C-terminal of four conserved domains found in Escherichia coli (Ec) sigma70, the main housekeeping sigma, and related sigma-factors (SFs) Back     alignment and domain information
>PF12116 SpoIIID: Stage III sporulation protein D; InterPro: IPR014208 Members of this entry represent the transcriptional regulator SpoIIID, or stage III sporulation protein D Back     alignment and domain information
>PRK00118 putative DNA-binding protein; Validated Back     alignment and domain information
>PF13542 HTH_Tnp_ISL3: Helix-turn-helix domain of transposase family ISL3 Back     alignment and domain information
>PRK04217 hypothetical protein; Provisional Back     alignment and domain information
>PRK09639 RNA polymerase sigma factor SigX; Provisional Back     alignment and domain information
>PRK12529 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>cd06170 LuxR_C_like C-terminal DNA-binding domain of LuxR-like proteins Back     alignment and domain information
>TIGR03879 near_KaiC_dom probable regulatory domain Back     alignment and domain information
>TIGR02531 yecD_yerC TrpR-related protein YerC/YecD Back     alignment and domain information
>PRK06030 hypothetical protein; Provisional Back     alignment and domain information
>PRK09652 RNA polymerase sigma factor RpoE; Provisional Back     alignment and domain information
>TIGR02844 spore_III_D sporulation transcriptional regulator SpoIIID Back     alignment and domain information
>PHA00675 hypothetical protein Back     alignment and domain information
>PRK08301 sporulation sigma factor SigE; Reviewed Back     alignment and domain information
>PRK05911 RNA polymerase sigma factor sigma-28; Reviewed Back     alignment and domain information
>PF04967 HTH_10: HTH DNA binding domain; InterPro: IPR007050 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif Back     alignment and domain information
>TIGR02985 Sig70_bacteroi1 RNA polymerase sigma-70 factor, Bacteroides expansion family 1 Back     alignment and domain information
>PRK03975 tfx putative transcriptional regulator; Provisional Back     alignment and domain information
>TIGR00721 tfx DNA-binding protein, Tfx family Back     alignment and domain information
>PHA00542 putative Cro-like protein Back     alignment and domain information
>PF13412 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 1I1G_B 2IA0_B 3I4P_A 2GQQ_A 2L4A_A 2CFX_B 2DBB_B 2EFO_A 2EFQ_A 2PN6_A Back     alignment and domain information
>TIGR02952 Sig70_famx2 RNA polymerase sigma-70 factor, TIGR02952 family Back     alignment and domain information
>PF07374 DUF1492: Protein of unknown function (DUF1492); InterPro: IPR010861 This entry is represented by Streptococcus phage 7201, Orf19 Back     alignment and domain information
>PRK07037 extracytoplasmic-function sigma-70 factor; Validated Back     alignment and domain information
>TIGR02960 SigX5 RNA polymerase sigma-70 factor, TIGR02960 family Back     alignment and domain information
>PRK09641 RNA polymerase sigma factor SigW; Provisional Back     alignment and domain information
>PF01325 Fe_dep_repress: Iron dependent repressor, N-terminal DNA binding domain; InterPro: IPR022687 The DtxR-type HTH domain is a DNA-binding, winged helix-turn-helix (wHTH) domain of about 65 residues present in metalloregulators of the DtxR/MntR family Back     alignment and domain information
>TIGR02937 sigma70-ECF RNA polymerase sigma factor, sigma-70 family Back     alignment and domain information
>PRK09638 RNA polymerase sigma factor SigY; Reviewed Back     alignment and domain information
>PRK12547 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK15320 transcriptional activator SprB; Provisional Back     alignment and domain information
>TIGR02989 Sig-70_gvs1 RNA polymerase sigma-70 factor, Rhodopirellula/Verrucomicrobium family Back     alignment and domain information
>PRK12514 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12511 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12519 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>TIGR01321 TrpR trp operon repressor, proteobacterial Back     alignment and domain information
>PF12802 MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP4_B 3KP2_A 3KP5_A 3KP3_B 3KP7_A 3NQO_B 3K0L_B Back     alignment and domain information
>PRK12524 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12530 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PF01022 HTH_5: Bacterial regulatory protein, arsR family; InterPro: IPR001845 Bacterial transcription regulatory proteins that bind DNA via a helix-turn-helix (HTH) motif can be grouped into families on the basis of sequence similarities Back     alignment and domain information
>PF13730 HTH_36: Helix-turn-helix domain Back     alignment and domain information
>PF00356 LacI: Bacterial regulatory proteins, lacI family; InterPro: IPR000843 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif Back     alignment and domain information
>PF01047 MarR: MarR family; InterPro: IPR000835 The MarR-type HTH domain is a DNA-binding, winged helix-turn-helix (wHTH) domain of about 135 amino acids present in transcription regulators of the MarR/SlyA family, involved in the development of antibiotic resistance Back     alignment and domain information
>PRK12515 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK05803 sporulation sigma factor SigK; Reviewed Back     alignment and domain information
>PRK09415 RNA polymerase factor sigma C; Reviewed Back     alignment and domain information
>PRK12533 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PF08279 HTH_11: HTH domain; InterPro: IPR013196 Winged helix DNA-binding proteins share a related winged helix-turn-helix DNA-binding motif, where the "wings", or loops, are small beta-sheets Back     alignment and domain information
>PF13551 HTH_29: Winged helix-turn helix Back     alignment and domain information
>COG2963 Transposase and inactivated derivatives [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12537 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12531 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK15418 transcriptional regulator LsrR; Provisional Back     alignment and domain information
>TIGR02392 rpoH_proteo alternative sigma factor RpoH Back     alignment and domain information
>PRK12512 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12516 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>TIGR02939 RpoE_Sigma70 RNA polymerase sigma factor RpoE Back     alignment and domain information
>PRK09047 RNA polymerase factor sigma-70; Validated Back     alignment and domain information
>PRK11924 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK05602 RNA polymerase sigma factor; Reviewed Back     alignment and domain information
>PRK12534 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>TIGR02948 SigW_bacill RNA polymerase sigma-W factor Back     alignment and domain information
>PRK09643 RNA polymerase sigma factor SigM; Reviewed Back     alignment and domain information
>PF00196 GerE: Bacterial regulatory proteins, luxR family; InterPro: IPR000792 This domain is a DNA-binding, helix-turn-helix (HTH) domain of about 65 amino acids, present in transcription regulators of the LuxR/FixJ family of response regulators Back     alignment and domain information
>TIGR02950 SigM_subfam RNA polymerase sigma factor, SigM family Back     alignment and domain information
>PRK11923 algU RNA polymerase sigma factor AlgU; Provisional Back     alignment and domain information
>PRK06596 RNA polymerase factor sigma-32; Reviewed Back     alignment and domain information
>PRK07408 RNA polymerase sigma factor SigF; Reviewed Back     alignment and domain information
>TIGR02983 SigE-fam_strep RNA polymerase sigma-70 factor, sigma-E family Back     alignment and domain information
>TIGR03001 Sig-70_gmx1 RNA polymerase sigma-70 factor, Myxococcales family 1 Back     alignment and domain information
>PRK12546 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>cd00092 HTH_CRP helix_turn_helix, cAMP Regulatory protein C-terminus; DNA binding domain of prokaryotic regulatory proteins belonging to the catabolite activator protein family Back     alignment and domain information
>TIGR02984 Sig-70_plancto1 RNA polymerase sigma-70 factor, Planctomycetaceae-specific subfamily 1 Back     alignment and domain information
>TIGR02980 SigBFG RNA polymerase sigma-70 factor, sigma-B/F/G subfamily Back     alignment and domain information
>PRK05572 sporulation sigma factor SigF; Validated Back     alignment and domain information
>PF08299 Bac_DnaA_C: Bacterial dnaA protein helix-turn-helix; InterPro: IPR013159 This entry represents the C-terminal domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK06811 RNA polymerase factor sigma-70; Validated Back     alignment and domain information
>PRK12540 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>TIGR02954 Sig70_famx3 RNA polymerase sigma-70 factor, TIGR02954 family Back     alignment and domain information
>TIGR02393 RpoD_Cterm RNA polymerase sigma factor RpoD, C-terminal domain Back     alignment and domain information
>PRK12532 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>TIGR01636 phage_rinA phage transcriptional activator, RinA family Back     alignment and domain information
>TIGR02835 spore_sigmaE RNA polymerase sigma-E factor Back     alignment and domain information
>PF01710 HTH_Tnp_IS630: Transposase; InterPro: IPR002622 Transposase proteins are necessary for efficient DNA transposition Back     alignment and domain information
>PRK06759 RNA polymerase factor sigma-70; Validated Back     alignment and domain information
>PRK06704 RNA polymerase factor sigma-70; Validated Back     alignment and domain information
>PRK12544 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK08583 RNA polymerase sigma factor SigB; Validated Back     alignment and domain information
>TIGR02885 spore_sigF RNA polymerase sigma-F factor Back     alignment and domain information
>PRK08215 sporulation sigma factor SigG; Reviewed Back     alignment and domain information
>PRK12523 RNA polymerase sigma factor; Reviewed Back     alignment and domain information
>PRK07500 rpoH2 RNA polymerase factor sigma-32; Reviewed Back     alignment and domain information
>TIGR02957 SigX4 RNA polymerase sigma-70 factor, TIGR02957 family Back     alignment and domain information
>PRK12539 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12528 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK09645 RNA polymerase sigma factor SigL; Provisional Back     alignment and domain information
>PF01371 Trp_repressor: Trp repressor protein; InterPro: IPR000831 The Trp repressor (TrpR) binds to at least five operators in the Escherichia coli genome, repressing gene expression Back     alignment and domain information
>PRK12520 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>TIGR02999 Sig-70_X6 RNA polymerase sigma factor, TIGR02999 family Back     alignment and domain information
>COG2739 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR02943 Sig70_famx1 RNA polymerase sigma-70 factor, TIGR02943 family Back     alignment and domain information
>TIGR02850 spore_sigG RNA polymerase sigma-G factor Back     alignment and domain information
>TIGR02846 spore_sigmaK RNA polymerase sigma-K factor Back     alignment and domain information
>PRK09637 RNA polymerase sigma factor SigZ; Provisional Back     alignment and domain information
>PRK06930 positive control sigma-like factor; Validated Back     alignment and domain information
>PRK12522 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>TIGR02394 rpoS_proteo RNA polymerase sigma factor RpoS Back     alignment and domain information
>PRK06986 fliA flagellar biosynthesis sigma factor; Validated Back     alignment and domain information
>PRK09636 RNA polymerase sigma factor SigJ; Provisional Back     alignment and domain information
>PF05344 DUF746: Domain of Unknown Function (DUF746); InterPro: IPR008008 This is a short conserved region found in some transposons Back     alignment and domain information
>PRK12525 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PF09339 HTH_IclR: IclR helix-turn-helix domain; InterPro: IPR005471 The many bacterial transcription regulation proteins which bind DNA through a 'helix-turn-helix' motif can be classified into subfamilies on the basis of sequence similarities Back     alignment and domain information
>PRK07405 RNA polymerase sigma factor SigD; Validated Back     alignment and domain information
>COG3293 Transposase and inactivated derivatives [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1595 RpoE DNA-directed RNA polymerase specialized sigma subunit, sigma24 homolog [Transcription] Back     alignment and domain information
>PRK07670 RNA polymerase sigma factor SigD; Validated Back     alignment and domain information
>PF00126 HTH_1: Bacterial regulatory helix-turn-helix protein, lysR family; InterPro: IPR000847 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif Back     alignment and domain information
>COG1191 FliA DNA-directed RNA polymerase specialized sigma subunit [Transcription] Back     alignment and domain information
>PRK09642 RNA polymerase sigma factor SigW; Reviewed Back     alignment and domain information
>PF04297 UPF0122: Putative helix-turn-helix protein, YlxM / p13 like; InterPro: IPR007394 Members of this family are predicted to contain a helix-turn-helix motif, for example residues 37-55 in Mycoplasma mycoides p13 (O05290 from SWISSPROT) Back     alignment and domain information
>PRK09648 RNA polymerase sigma factor SigD; Reviewed Back     alignment and domain information
>TIGR02941 Sigma_B RNA polymerase sigma-B factor Back     alignment and domain information
>smart00346 HTH_ICLR helix_turn_helix isocitrate lyase regulation Back     alignment and domain information
>PRK13919 putative RNA polymerase sigma E protein; Provisional Back     alignment and domain information
>PRK09649 RNA polymerase sigma factor SigC; Reviewed Back     alignment and domain information
>PF13545 HTH_Crp_2: Crp-like helix-turn-helix domain; PDB: 3LA2_A 3LA3_B 3LA7_A 3B02_A 3E97_A 2H6C_B 1OMI_A 2BGC_H 2BEO_A 2GAU_A Back     alignment and domain information
>PRK12527 RNA polymerase sigma factor; Reviewed Back     alignment and domain information
>PRK08295 RNA polymerase factor sigma-70; Validated Back     alignment and domain information
>PRK07122 RNA polymerase sigma factor SigF; Reviewed Back     alignment and domain information
>PRK12542 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12536 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PF00325 Crp: Bacterial regulatory proteins, crp family; InterPro: IPR001808 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif Back     alignment and domain information
>TIGR02479 FliA_WhiG RNA polymerase sigma factor, FliA/WhiG family Back     alignment and domain information
>PF09862 DUF2089: Protein of unknown function (DUF2089); InterPro: IPR018658 This family consists of various hypothetical prokaryotic proteins Back     alignment and domain information
>PRK09635 sigI RNA polymerase sigma factor SigI; Provisional Back     alignment and domain information
>smart00550 Zalpha Z-DNA-binding domain in adenosine deaminases Back     alignment and domain information
>PRK12541 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12543 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK09644 RNA polymerase sigma factor SigM; Provisional Back     alignment and domain information
>PF13751 DDE_Tnp_1_6: Transposase DDE domain Back     alignment and domain information
>PF13560 HTH_31: Helix-turn-helix domain; PDB: 3F51_C 3F52_A 3PXP_A 2OFY_A Back     alignment and domain information
>COG2390 DeoR Transcriptional regulator, contains sigma factor-related N-terminal domain [Transcription] Back     alignment and domain information
>PF09607 BrkDBD: Brinker DNA-binding domain; InterPro: IPR018586 This DNA-binding domain is the first approx Back     alignment and domain information
>PRK12535 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12526 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PF13610 DDE_Tnp_IS240: DDE domain Back     alignment and domain information
>PRK05657 RNA polymerase sigma factor RpoS; Validated Back     alignment and domain information
>PRK12545 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK11922 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>TIGR02959 SigZ RNA polymerase sigma factor, SigZ family Back     alignment and domain information
>TIGR03697 NtcA_cyano global nitrogen regulator NtcA, cyanobacterial Back     alignment and domain information
>PRK12517 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK15201 fimbriae regulatory protein FimW; Provisional Back     alignment and domain information
>PRK07406 RNA polymerase sigma factor RpoD; Validated Back     alignment and domain information
>TIGR01610 phage_O_Nterm phage replication protein O, N-terminal domain Back     alignment and domain information
>PRK03573 transcriptional regulator SlyA; Provisional Back     alignment and domain information
>cd00090 HTH_ARSR Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors Back     alignment and domain information
>PF01381 HTH_3: Helix-turn-helix; InterPro: IPR001387 This is large family of DNA binding helix-turn helix proteins that include a bacterial plasmid copy control protein, bacterial methylases, various bacteriophage transcription control proteins and a vegetative specific protein from Dictyostelium discoideum (Slime mould) Back     alignment and domain information
>PRK12427 flagellar biosynthesis sigma factor; Provisional Back     alignment and domain information
>PF13463 HTH_27: Winged helix DNA-binding domain; PDB: 3GFL_A 2YR2_B 3GFM_A 3GFJ_A 3GF2_A 3GEZ_A 2GXG_A 3GFI_A 2EB7_A Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK07598 RNA polymerase sigma factor SigC; Validated Back     alignment and domain information
>PRK09646 RNA polymerase sigma factor SigK; Reviewed Back     alignment and domain information
>TIGR02859 spore_sigH RNA polymerase sigma-H factor Back     alignment and domain information
>PRK12538 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PF06056 Terminase_5: Putative ATPase subunit of terminase (gpP-like); InterPro: IPR010332 This family of proteins are annotated as ATPase subunits of phage terminase after [] Back     alignment and domain information
>PRK11512 DNA-binding transcriptional repressor MarR; Provisional Back     alignment and domain information
>smart00345 HTH_GNTR helix_turn_helix gluconate operon transcriptional repressor Back     alignment and domain information
>PF07638 Sigma70_ECF: ECF sigma factor Back     alignment and domain information
>PRK13870 transcriptional regulator TraR; Provisional Back     alignment and domain information
>PRK11753 DNA-binding transcriptional dual regulator Crp; Provisional Back     alignment and domain information
>PF00872 Transposase_mut: Transposase, Mutator family; InterPro: IPR001207 Autonomous mobile genetic elements such as transposon or insertion sequences (IS) encode an enzyme, transposase, that is required for excising and inserting the mobile element Back     alignment and domain information
>PRK15411 rcsA colanic acid capsular biosynthesis activation protein A; Provisional Back     alignment and domain information
>TIGR02947 SigH_actino RNA polymerase sigma-70 factor, TIGR02947 family Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PF01978 TrmB: Sugar-specific transcriptional regulator TrmB; InterPro: IPR002831 TrmB, is a protein of 38,800 apparent molecular weight, that is involved in the maltose-specific regulation of the trehalose/maltose ABC transport operon in Thermococcus litoralis Back     alignment and domain information
>PRK09210 RNA polymerase sigma factor RpoD; Validated Back     alignment and domain information
>PRK08241 RNA polymerase factor sigma-70; Validated Back     alignment and domain information
>PRK06288 RNA polymerase sigma factor WhiG; Reviewed Back     alignment and domain information
>PRK09640 RNA polymerase sigma factor SigX; Reviewed Back     alignment and domain information
>PRK05949 RNA polymerase sigma factor; Validated Back     alignment and domain information
>smart00419 HTH_CRP helix_turn_helix, cAMP Regulatory protein Back     alignment and domain information
>PF10668 Phage_terminase: Phage terminase small subunit; InterPro: IPR018925 This entry describes the terminase small subunit from Enterococcus phage phiFL1A, related proteins in other bacteriophage, and prophage regions of bacterial genomes Back     alignment and domain information
>smart00418 HTH_ARSR helix_turn_helix, Arsenical Resistance Operon Repressor Back     alignment and domain information
>PRK09651 RNA polymerase sigma factor FecI; Provisional Back     alignment and domain information
>PF00165 HTH_AraC: Bacterial regulatory helix-turn-helix proteins, AraC family; PDB: 1WPK_A 1ZGW_A 1U8B_A Back     alignment and domain information
>PRK09647 RNA polymerase sigma factor SigE; Reviewed Back     alignment and domain information
>PF05263 DUF722: Protein of unknown function (DUF722); InterPro: IPR007927 This entry is represented by Bacteriophage bIL285, Orf38 Back     alignment and domain information
>PRK10402 DNA-binding transcriptional activator YeiL; Provisional Back     alignment and domain information
>PF04703 FaeA: FaeA-like protein; PDB: 2JT1_A 2HTJ_A Back     alignment and domain information
>PHA02591 hypothetical protein; Provisional Back     alignment and domain information
>PF12840 HTH_20: Helix-turn-helix domain; PDB: 1ULY_A 2CWE_A 1Y0U_B 2QUF_B 2QLZ_C 2OQG_B 2ZKZ_C 3PQK_A 3PQJ_D 3F6O_B Back     alignment and domain information
>PF13404 HTH_AsnC-type: AsnC-type helix-turn-helix domain; PDB: 2ZNY_E 2ZNZ_G 1RI7_A 2CYY_A 2E1C_A 2VC1_B 2QZ8_A 2W29_C 2IVM_B 2VBX_B Back     alignment and domain information
>smart00347 HTH_MARR helix_turn_helix multiple antibiotic resistance protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query286
1tc3_C51 Protein (TC3 transposase); DNA binding, helix-turn 97.18
2glo_A59 Brinker CG9653-PA; protein-DNA complex, helix-turn 97.07
1jko_C52 HIN recombinase, DNA-invertase HIN; water-mediated 96.3
2jn6_A97 Protein CGL2762, transposase; GFT PSI-2, protein s 96.27
1tty_A87 Sigma-A, RNA polymerase sigma factor RPOD; helix-t 95.85
1ku3_A73 Sigma factor SIGA; helix-turn-helix, transcription 95.85
2jrt_A95 Uncharacterized protein; solution, structure, NESG 95.85
2p7v_B68 Sigma-70, RNA polymerase sigma factor RPOD; RSD, r 95.75
2elh_A87 CG11849-PA, LD40883P; structural genomics, NPPSFA, 95.73
2o8x_A70 Probable RNA polymerase sigma-C factor; promoter r 95.62
3hug_A92 RNA polymerase sigma factor; ECF sigma factor, zin 95.24
3t72_q99 RNA polymerase sigma factor RPOD, DNA-directed RN 95.06
2x48_A55 CAG38821; archeal virus, viral protein; 2.60A {Sul 94.97
1u78_A141 TC3 transposase, transposable element TC3 transpos 94.94
1fse_A74 GERE; helix-turn-helix DNA-binding protein transcr 94.74
1k78_A149 Paired box protein PAX5; paired domain, ETS domain 94.7
2rn7_A108 IS629 ORFA; helix, all alpha, unknown function, st 94.69
1hlv_A131 CENP-B, major centromere autoantigen B; helix-turn 94.63
1jhg_A101 Trp operon repressor; complex (regulatory protein- 94.48
1pdn_C128 Protein (PRD paired); protein-DNA complex, double 94.39
3c57_A95 Two component transcriptional regulatory protein; 94.23
1je8_A82 Nitrate/nitrite response regulator protein NARL; p 94.1
1j1v_A94 Chromosomal replication initiator protein DNAA, 5' 94.06
1p4w_A99 RCSB; solution structure, DNA binding domain, DNA 94.04
1s7o_A113 Hypothetical UPF0122 protein SPY1201/SPYM3_0842/SP 93.9
2jpc_A61 SSRB; DNA binding protein, structural genomics, PS 93.43
2w7n_A101 TRFB transcriptional repressor protein; INCP, plas 93.4
1x3u_A79 Transcriptional regulatory protein FIXJ; helix-tur 93.1
3ulq_B90 Transcriptional regulatory protein COMA; tetratric 93.0
1or7_A194 Sigma-24, RNA polymerase sigma-E factor; regulatio 92.85
2k27_A159 Paired box protein PAX-8; paired domain, solution 92.71
1iuf_A144 Centromere ABP1 protein; riken structural genomics 92.71
2rnj_A91 Response regulator protein VRAR; HTH LUXR-type dom 92.64
1rp3_A239 RNA polymerase sigma factor sigma-28 (FLIA); trans 92.6
1xsv_A113 Hypothetical UPF0122 protein SAV1236; helix-turn-h 92.27
3pvv_A101 Chromosomal replication initiator protein DNAA; he 91.97
2oa4_A101 SIR5; structure, structural genomics, PSI-2, prote 90.7
3mzy_A164 RNA polymerase sigma-H factor; PSI, MCSG, structur 90.57
4dyq_A140 Gene 1 protein; GP1, octamer, DNA-binding, viral p 90.52
2q1z_A184 RPOE, ECF SIGE; ECF sigma factor, cupin fold, zinc 90.07
2dk5_A91 DNA-directed RNA polymerase III 39 kDa polypeptide 89.87
2cob_A70 LCOR protein; MLR2, KIAA1795, helix-turn-helix, st 89.69
2d1h_A109 ST1889, 109AA long hypothetical transcriptional re 89.22
1zx4_A192 P1 PARB, plasmid partition PAR B protein, PARB; tr 89.19
1qgp_A77 Protein (double stranded RNA adenosine deaminase); 88.96
2heo_A67 Z-DNA binding protein 1; protein DLM1-Z-DNA comple 88.69
3frw_A107 Putative Trp repressor protein; structural genomic 88.59
3mky_B189 Protein SOPB; partition, F plasmid, centromere, DN 88.4
3kor_A119 Possible Trp repressor; putative DNA-binding Trp r 88.31
1qbj_A81 Protein (double-stranded RNA specific adenosine D 88.21
2l1p_A83 DNA-binding protein SATB1; PSI-biology, NESG, stru 87.95
2ao9_A155 Phage protein; structural genomics, nine-fold NCS. 87.88
2qvo_A95 Uncharacterized protein AF_1382; PSI, structural g 87.8
1uxc_A65 FRUR (1-57), fructose repressor; DNA-binding prote 87.57
2l0k_A93 Stage III sporulation protein D; SPOIIID, solution 87.08
2cw1_A65 SN4M; lambda CRO fold, de novo protein; NMR {Synth 87.06
2p5k_A64 Arginine repressor; DNA-binding domain, winged hel 87.02
1oyi_A82 Double-stranded RNA-binding protein; (alpha+beta) 86.46
3dv8_A220 Transcriptional regulator, CRP/FNR family; cyclic 86.44
1y0u_A96 Arsenical resistance operon repressor, putative; s 86.42
3ech_A142 MEXR, multidrug resistance operon repressor; winge 86.25
2lfw_A157 PHYR sigma-like domain; signal transduction, respo 86.01
2ia0_A171 Putative HTH-type transcriptional regulator PF086; 85.86
2x4h_A139 Hypothetical protein SSO2273; transcription; 2.30A 85.81
3r0a_A123 Putative transcriptional regulator; structural gen 85.78
1sfx_A109 Conserved hypothetical protein AF2008; structural 85.77
1xn7_A78 Hypothetical protein YHGG; alpha+beta, GFT structu 85.54
2jt1_A77 PEFI protein; solution structure, winged helix-tur 85.43
2pij_A67 Prophage PFL 6 CRO; transcription factor, helix-tu 85.41
4aik_A151 Transcriptional regulator SLYA; transcription, tra 85.38
4ham_A134 LMO2241 protein; structural genomics, PSI-biology, 85.17
1l9z_H438 Sigma factor SIGA; helix-turn-helix, coiled-coil, 85.17
2e1c_A171 Putative HTH-type transcriptional regulator PH151; 84.97
2pg4_A95 Uncharacterized protein; structural genomics, join 84.65
1r71_A178 Transcriptional repressor protein KORB; INCP, plas 84.63
3ryp_A210 Catabolite gene activator; CAMP receptor protein ( 84.42
2htj_A81 P fimbrial regulatory protein KS71A; winged helix- 84.17
1on2_A142 Transcriptional regulator MNTR; helix-turn-helix, 84.16
1tbx_A99 ORF F-93, hypothetical 11.0 kDa protein; sulfolobu 84.16
2gxg_A146 146AA long hypothetical transcriptional regulator; 84.11
2rdp_A150 Putative transcriptional regulator MARR; PFAM PF01 83.92
3g3z_A145 NMB1585, transcriptional regulator, MARR family; t 83.79
3bpv_A138 Transcriptional regulator; MARR, DNA binding, tran 83.69
2fmy_A220 COOA, carbon monoxide oxidation system transcripti 83.67
2nnn_A140 Probable transcriptional regulator; structural gen 83.65
3b02_A195 Transcriptional regulator, CRP family; structural 83.65
1jgs_A138 Multiple antibiotic resistance protein MARR; trans 83.53
2oz6_A207 Virulence factor regulator; winged helix, helix-tu 83.51
1ku9_A152 Hypothetical protein MJ223; putative transcription 83.4
3clo_A258 Transcriptional regulator; NP_811094.1, bacterial 83.39
1r1u_A106 CZRA, repressor protein; zinc, DNA binding, transc 83.38
3bro_A141 Transcriptional regulator; helix_TURN_helix, multi 83.31
3oop_A143 LIN2960 protein; protein structure initiative, PSI 83.29
2lkp_A119 Transcriptional regulator, ARSR family; symmetric 83.24
2zcw_A202 TTHA1359, transcriptional regulator, FNR/CRP famil 83.22
2pex_A153 Transcriptional regulator OHRR; transcription regu 82.96
2fbi_A142 Probable transcriptional regulator; MARR, APC5816, 82.85
3iwz_A230 CAP-like, catabolite activation-like protein; XCC, 82.8
3la7_A243 Global nitrogen regulator; activator, DNA-binding, 82.49
3cuo_A99 Uncharacterized HTH-type transcriptional regulato; 82.42
2a61_A145 Transcriptional regulator TM0710; APC4350, MCSG, m 82.4
3nrv_A148 Putative transcriptional regulator (MARR/EMRR FAM; 82.39
2l8n_A67 Transcriptional repressor CYTR; bacterial gene rep 82.32
2fbh_A146 Transcriptional regulator PA3341; MARR, transcript 82.29
2a6h_F423 RNA polymerase sigma factor RPOD; RNA polymerase h 82.26
3k0l_A162 Repressor protein; helix-turn-helix, structural ge 82.23
1l3l_A234 Transcriptional activator protein TRAR; helix-turn 82.21
1z91_A147 Organic hydroperoxide resistance transcriptional; 82.13
2q0o_A236 Probable transcriptional activator protein TRAR; h 82.11
1u78_A141 TC3 transposase, transposable element TC3 transpos 81.87
2frh_A127 SARA, staphylococcal accessory regulator A; winged 81.66
4ev0_A216 Transcription regulator, CRP family; CAMP binding, 81.59
2cyy_A151 Putative HTH-type transcriptional regulator PH151; 81.53
3bdd_A142 Regulatory protein MARR; putative multiple antibio 81.49
1zyb_A232 Transcription regulator, CRP family; NP_813211.1, 81.31
2w48_A315 Sorbitol operon regulator; SORC, activator, repres 81.21
1rzs_A61 Antirepressor, regulatory protein CRO; helix-turn- 81.17
2fa5_A162 Transcriptional regulator MARR/EMRR family; multip 81.01
2k02_A87 Ferrous iron transport protein C; FEOC, iron-sulfu 81.0
2oqg_A114 Possible transcriptional regulator, ARSR family P; 80.68
2ofy_A86 Putative XRE-family transcriptional regulator; tra 80.67
3tgn_A146 ADC operon repressor ADCR; helix-turn-helix, trans 80.62
2cfx_A144 HTH-type transcriptional regulator LRPC; transcrip 80.55
3cjn_A162 Transcriptional regulator, MARR family; silicibact 80.4
4hbl_A149 Transcriptional regulator, MARR family; HTH, trans 80.39
1ft9_A222 Carbon monoxide oxidation system transcription reg 80.37
2eth_A154 Transcriptional regulator, putative, MAR family; M 80.37
1sfu_A75 34L protein; protein/Z-DNA complex, DNA binding pr 80.19
3szt_A237 QCSR, quorum-sensing control repressor; quorum sen 80.15
2hin_A71 GP39, repressor protein; transcription factor, dim 80.14
3eco_A139 MEPR; mutlidrug efflux pump regulator winged helix 80.12
2w25_A150 Probable transcriptional regulatory protein; trans 80.09
1i1g_A141 Transcriptional regulator LRPA; helix-turn-helix, 80.05
>1tc3_C Protein (TC3 transposase); DNA binding, helix-turn-helix, TC1/mariner family, complex (transposase/DNA), DNA binding protein/DNA complex; HET: DNA; 2.45A {Caenorhabditis elegans} SCOP: a.4.1.2 Back     alignment and structure
Probab=97.18  E-value=0.0009  Score=40.76  Aligned_cols=44  Identities=11%  Similarity=-0.072  Sum_probs=35.8

Q ss_pred             CCCCCCCHHHHHHHHHHHhhcCCChHhhhhhccccHhHHHHHHHH
Q psy13113          8 ARGVIHSPVVKLLAVLRFYATGNFQIDSEDYHDISQSTICRLVAK   52 (286)
Q Consensus         8 ~~~~~~~~~~~l~~~L~~L~~~~~~~~l~~~Fgvs~stv~~~~~~   52 (286)
                      +|+..++.+++..+... +..|.+..++|..+|||.+||++++++
T Consensus         1 GR~~~l~~~~~~~i~~~-~~~g~s~~~IA~~lgis~~Tv~~~~~~   44 (51)
T 1tc3_C            1 PRGSALSDTERAQLDVM-KLLNVSLHEMSRKISRSRHCIRVYLKD   44 (51)
T ss_dssp             CCSCCCCHHHHHHHHHH-HHTTCCHHHHHHHHTCCHHHHHHHHHC
T ss_pred             CCCCCCCHHHHHHHHHH-HHcCCCHHHHHHHHCcCHHHHHHHHhh
Confidence            45667888887666554 467899999999999999999998864



>2glo_A Brinker CG9653-PA; protein-DNA complex, helix-turn-helix motif, transcription/DNA complex; NMR {Drosophila melanogaster} Back     alignment and structure
>1jko_C HIN recombinase, DNA-invertase HIN; water-mediated recognition, protein-DNA complex, A10G mutant, DNA binding protein/DNA complex; 2.24A {Synthetic} SCOP: a.4.1.2 PDB: 1ijw_C* 1jj6_C* 1jj8_C* 1hcr_A 1jkp_C 1jkq_C 1jkr_C Back     alignment and structure
>2jn6_A Protein CGL2762, transposase; GFT PSI-2, protein structure, structural genomics, protein structure initiative; NMR {Corynebacterium glutamicum} SCOP: a.4.1.19 Back     alignment and structure
>1tty_A Sigma-A, RNA polymerase sigma factor RPOD; helix-turn-helix, transcription; NMR {Thermotoga maritima} SCOP: a.4.13.2 Back     alignment and structure
>1ku3_A Sigma factor SIGA; helix-turn-helix, transcription; 1.80A {Thermus aquaticus} SCOP: a.4.13.2 PDB: 1ku7_A 1rio_H 3n97_A* Back     alignment and structure
>2jrt_A Uncharacterized protein; solution, structure, NESG, PSI, target RHR5, structural genomics, protein structure initiative; NMR {Rhodobacter sphaeroides} Back     alignment and structure
>2p7v_B Sigma-70, RNA polymerase sigma factor RPOD; RSD, regulator of sigma 70, sigma 70 domain 4, transcription, regulation, helix-turn-helix; 2.60A {Escherichia coli} SCOP: a.4.13.2 Back     alignment and structure
>2elh_A CG11849-PA, LD40883P; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Drosophila melanogaster} Back     alignment and structure
>2o8x_A Probable RNA polymerase sigma-C factor; promoter recognition, transcription regulation, helix-turn-H motif, transcription; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3hug_A RNA polymerase sigma factor; ECF sigma factor, zinc binding anti-sigma factor, oxidative transcription regulation; 2.35A {Mycobacterium tuberculosis} Back     alignment and structure
>3t72_q RNA polymerase sigma factor RPOD, DNA-directed RN polymerase subunit beta; winged-helix motif, transcription activation, DNA-binding; 4.33A {Escherichia coli} PDB: 1tlh_B Back     alignment and structure
>2x48_A CAG38821; archeal virus, viral protein; 2.60A {Sulfolobus islandicus rod-shaped virusorganism_taxid} Back     alignment and structure
>1u78_A TC3 transposase, transposable element TC3 transposase; transposon DNA, bipartite DNA-binding, HTH- motif, DNA binding protein/DNA complex; 2.69A {Caenorhabditis elegans} SCOP: a.4.1.2 a.4.1.2 Back     alignment and structure
>1fse_A GERE; helix-turn-helix DNA-binding protein transcriptional regulat transcription; 2.05A {Bacillus subtilis} SCOP: a.4.6.2 Back     alignment and structure
>1k78_A Paired box protein PAX5; paired domain, ETS domain, transcription factor, transcription/DNA complex; 2.25A {Homo sapiens} SCOP: a.4.1.5 a.4.1.5 PDB: 1mdm_A 6pax_A Back     alignment and structure
>2rn7_A IS629 ORFA; helix, all alpha, unknown function, structural genomics, PSI-2, protein structure initiative; NMR {Shigella flexneri} Back     alignment and structure
>1hlv_A CENP-B, major centromere autoantigen B; helix-turn-helix, protein-DNA complex, riken structural genomics/proteomics initiative, RSGI; 2.50A {Homo sapiens} SCOP: a.4.1.7 a.4.1.7 PDB: 1bw6_A Back     alignment and structure
>1jhg_A Trp operon repressor; complex (regulatory protein-peptide), DNA-binding regulatory complex (regulatory protein-peptide) complex; HET: TRP; 1.30A {Escherichia coli} SCOP: a.4.12.1 PDB: 1co0_A* 1mi7_R 1p6z_R 1wrp_R* 1zt9_A* 2oz9_R* 3ssw_R 3wrp_A 1rcs_A* 1wrs_R* 1wrt_R 2xdi_A 3ssx_R* 1trr_A* 1tro_A* Back     alignment and structure
>1pdn_C Protein (PRD paired); protein-DNA complex, double helix, PAX, paired domain, DNA-binding protein, gene regulation/DNA complex; HET: DNA; 2.50A {Drosophila melanogaster} SCOP: a.4.1.5 Back     alignment and structure
>3c57_A Two component transcriptional regulatory protein; response regulator, two-component regulatory system, DNA-BIN protein; 1.70A {Mycobacterium tuberculosis} PDB: 1zlk_A 1zlj_A Back     alignment and structure
>1je8_A Nitrate/nitrite response regulator protein NARL; protein-DNA complex, two-component response regulator, helix-turn-helix, DNA bending; 2.12A {Escherichia coli} SCOP: a.4.6.2 PDB: 1zg1_A 1zg5_A Back     alignment and structure
>1j1v_A Chromosomal replication initiator protein DNAA, 5'-D(*CP*CP*TP*GP*TP*GP*GP*AP*TP*AP*AP*CP*A)-3'; protein-DNA complex; 2.10A {Escherichia coli} SCOP: a.4.12.2 Back     alignment and structure
>1p4w_A RCSB; solution structure, DNA binding domain, DNA binding protein; NMR {Erwinia amylovora} SCOP: a.4.6.2 Back     alignment and structure
>1s7o_A Hypothetical UPF0122 protein SPY1201/SPYM3_0842/SPS1042/SPYM18_1152; putative DNA binding protein, structural genomics; 2.31A {Streptococcus pyogenes serotype M3} SCOP: a.4.13.3 Back     alignment and structure
>2jpc_A SSRB; DNA binding protein, structural genomics, PSI-2, protein structure initiative; NMR {Salmonella typhimurium} Back     alignment and structure
>2w7n_A TRFB transcriptional repressor protein; INCP, plasmid, repressor, DNA-binding, transcription/DNA; HET: BRU; 1.85A {Escherichia coli} Back     alignment and structure
>1x3u_A Transcriptional regulatory protein FIXJ; helix-turn-helix; NMR {Sinorhizobium meliloti} Back     alignment and structure
>3ulq_B Transcriptional regulatory protein COMA; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} PDB: 2krf_A Back     alignment and structure
>1or7_A Sigma-24, RNA polymerase sigma-E factor; regulation, DNA-binding, transmembrane, transcription; 2.00A {Escherichia coli} SCOP: a.4.13.2 a.177.1.1 PDB: 2h27_A Back     alignment and structure
>2k27_A Paired box protein PAX-8; paired domain, solution structure, triple frequency, 3D NMR, induced FIT, alternative splicing, developmental protein; NMR {Homo sapiens} Back     alignment and structure
>1iuf_A Centromere ABP1 protein; riken structural genomics/proteomics initiative, RSGI, structural genomics, DNA binding protein; NMR {Schizosaccharomyces pombe} SCOP: a.4.1.7 a.4.1.7 Back     alignment and structure
>2rnj_A Response regulator protein VRAR; HTH LUXR-type domain, DNA binding domain, activator, antibiotic resistance, cytoplasm, DNA-binding; NMR {Staphylococcus aureus} Back     alignment and structure
>1rp3_A RNA polymerase sigma factor sigma-28 (FLIA); transcription; 2.30A {Aquifex aeolicus} SCOP: a.4.13.1 a.4.13.2 a.177.1.1 PDB: 1sc5_A Back     alignment and structure
>1xsv_A Hypothetical UPF0122 protein SAV1236; helix-turn-helix, putative DNA-binding protein, signal recognition particle, unknown function; 1.70A {Staphylococcus aureus subsp} SCOP: a.4.13.3 Back     alignment and structure
>3pvv_A Chromosomal replication initiator protein DNAA; helix-turn-helix motif, interacting with DNAA-BOX, DNAA-box; HET: DNA; 2.00A {Mycobacterium tuberculosis} PDB: 3pvp_A* Back     alignment and structure
>2oa4_A SIR5; structure, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Silicibacter pomeroyi} SCOP: a.4.12.3 Back     alignment and structure
>3mzy_A RNA polymerase sigma-H factor; PSI, MCSG, structural genomics, midwest center for structura genomics, protein structure initiative; 2.50A {Fusobacterium nucleatum subsp} Back     alignment and structure
>4dyq_A Gene 1 protein; GP1, octamer, DNA-binding, viral protein; 1.50A {Shigella phage SF6} PDB: 4dyc_A 4dyr_A 3hef_A 4dzj_A 4dzp_A Back     alignment and structure
>2dk5_A DNA-directed RNA polymerase III 39 kDa polypeptide; structural genomics, winged helix domain, NPPSFA; NMR {Homo sapiens} SCOP: a.4.5.85 Back     alignment and structure
>2cob_A LCOR protein; MLR2, KIAA1795, helix-turn-helix, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.15 Back     alignment and structure
>2d1h_A ST1889, 109AA long hypothetical transcriptional regulator; helix-turn-helix, intermolecular and intramolecular S-S bond structural genomics; 2.05A {Sulfolobus tokodaii} SCOP: a.4.5.50 Back     alignment and structure
>1zx4_A P1 PARB, plasmid partition PAR B protein, PARB; translation; HET: CIT; 2.98A {Enterobacteria phage P1} PDB: 2ntz_A Back     alignment and structure
>1qgp_A Protein (double stranded RNA adenosine deaminase); Z-alpha-Z-DNA binding domain, RNA-editing, Z-DNA recognition, ADAR1, helix- turn-helix; NMR {Homo sapiens} SCOP: a.4.5.19 Back     alignment and structure
>2heo_A Z-DNA binding protein 1; protein DLM1-Z-DNA complex, immune system-DNA complex; 1.70A {Mus musculus} PDB: 1j75_A Back     alignment and structure
>3frw_A Putative Trp repressor protein; structural genomics, APC21159, PSI-2, P structure initiative; 2.05A {Ruminococcus obeum atcc 29174} PDB: 3g1c_A Back     alignment and structure
>3mky_B Protein SOPB; partition, F plasmid, centromere, DNA binding protein- complex; HET: DNA; 2.86A {Escherichia coli} PDB: 3mkw_B* 3mkz_A* Back     alignment and structure
>3kor_A Possible Trp repressor; putative DNA-binding Trp repressor, TRPR like protein, struc genomics, transcription; 1.60A {Staphylococcus aureus} Back     alignment and structure
>1qbj_A Protein (double-stranded RNA specific adenosine D (ADAR1)); protein-Z-DNA complex, hydrolase-DNA complex; HET: DNA; 2.10A {Homo sapiens} SCOP: a.4.5.19 PDB: 3f21_A* 3f22_A* 3f23_A* 3irr_A* 3irq_D* 2gxb_A 2acj_A 2l54_A Back     alignment and structure
>2l1p_A DNA-binding protein SATB1; PSI-biology, NESG, structural genomics, protein structure in northeast structural genomics consortium; NMR {Homo sapiens} PDB: 3nzl_A* Back     alignment and structure
>2ao9_A Phage protein; structural genomics, nine-fold NCS., PSI, protein structure initiative, midwest center for structural genomics, MCSG, U function; 1.90A {Bacillus cereus} SCOP: a.4.1.17 Back     alignment and structure
>2qvo_A Uncharacterized protein AF_1382; PSI, structural genomics, southeast collaboratory for structural genomics; 1.85A {Archaeoglobus fulgidus dsm 4304} PDB: 3o3k_A 3ov8_A Back     alignment and structure
>1uxc_A FRUR (1-57), fructose repressor; DNA-binding protein, LACI family, transc regulation; NMR {Escherichia coli} SCOP: a.35.1.5 PDB: 1uxd_A Back     alignment and structure
>2l0k_A Stage III sporulation protein D; SPOIIID, solution structure, DNA binding, bacillus subti transcription factor, transcription; NMR {Bacillus subtilis} Back     alignment and structure
>2cw1_A SN4M; lambda CRO fold, de novo protein; NMR {Synthetic} SCOP: k.46.1.1 Back     alignment and structure
>2p5k_A Arginine repressor; DNA-binding domain, winged helix-turn-helix (WHTH), DNA binding protein; 1.00A {Bacillus subtilis} SCOP: a.4.5.3 PDB: 2p5l_C* Back     alignment and structure
>1oyi_A Double-stranded RNA-binding protein; (alpha+beta) helix-turn-helix, viral protein; NMR {Vaccinia virus} SCOP: a.4.5.19 Back     alignment and structure
>3dv8_A Transcriptional regulator, CRP/FNR family; cyclic nucleotide-binding domain, structural genomics, joint for structural genomics; 2.55A {Eubacterium rectale atcc 33656} Back     alignment and structure
>1y0u_A Arsenical resistance operon repressor, putative; structural genomics, protein structure initiative, PSI; HET: MSE; 1.60A {Archaeoglobus fulgidus} SCOP: a.4.5.5 Back     alignment and structure
>3ech_A MEXR, multidrug resistance operon repressor; winged helix, helix-turn-helix, protein-peptide complex; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.28 PDB: 1lnw_A 3mex_A Back     alignment and structure
>2lfw_A PHYR sigma-like domain; signal transduction, response regulator, sigma factor mimicr sigma factor, general stress response, signaling protein; NMR {Sphingomonas SP} Back     alignment and structure
>2ia0_A Putative HTH-type transcriptional regulator PF086; ASNC, PSI, structural genomics, southeast collaboratory for structural genomics; 2.37A {Pyrococcus furiosus} Back     alignment and structure
>2x4h_A Hypothetical protein SSO2273; transcription; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>3r0a_A Putative transcriptional regulator; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.31A {Methanosarcina mazei} Back     alignment and structure
>1sfx_A Conserved hypothetical protein AF2008; structural genomics, HTH MOT protein structure initiative, midwest center for structural genomics; 1.55A {Archaeoglobus fulgidus} SCOP: a.4.5.50 Back     alignment and structure
>1xn7_A Hypothetical protein YHGG; alpha+beta, GFT structural genomics, protein structure initiative, PSI, NESG; NMR {Escherichia coli} SCOP: a.4.5.62 Back     alignment and structure
>2jt1_A PEFI protein; solution structure, winged helix-turn-helix, transcripti regulatory protein, structural genomics, PSI-2; NMR {Salmonella typhimurium LT2} Back     alignment and structure
>2pij_A Prophage PFL 6 CRO; transcription factor, helix-turn-helix, structural evolution, transcription; 1.70A {Pseudomonas fluorescens} Back     alignment and structure
>4aik_A Transcriptional regulator SLYA; transcription, transcription factor; 1.85A {Yersinia pseudotuberculosis} PDB: 4aih_A 4aij_A 3qpt_A* 3q5f_A* Back     alignment and structure
>4ham_A LMO2241 protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, winged helix-turn-helix, four helix bundle; 1.91A {Listeria monocytogenes} Back     alignment and structure
>1l9z_H Sigma factor SIGA; helix-turn-helix, coiled-coil, transcription/DNA complex; 6.50A {Thermus aquaticus} SCOP: i.8.1.1 Back     alignment and structure
>2pg4_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, DNA binding protein; HET: MSE CIT; 2.21A {Aeropyrum pernix} SCOP: a.4.5.48 Back     alignment and structure
>1r71_A Transcriptional repressor protein KORB; INCP, plasmid partitioning, protein-DNA complex, heilx-turn- helix motif, transcription factor; HET: BRU; 2.20A {Escherichia coli} SCOP: a.4.14.1 Back     alignment and structure
>3ryp_A Catabolite gene activator; CAMP receptor protein (CRP), allostery, DNA binding cyclic A transcription regulator; HET: CMP; 1.60A {Escherichia coli} PDB: 2cgp_A* 3hif_A 1g6n_A* 3ryr_A* 1i5z_A* 1j59_A* 1lb2_A* 1run_A* 1zrc_A* 1zrd_A* 1zre_A* 1zrf_A* 2gzw_A* 2wc2_A 3iyd_G* 3n4m_A* 3qop_A* 3rdi_A* 3rou_A* 3rpq_A* ... Back     alignment and structure
>2htj_A P fimbrial regulatory protein KS71A; winged helix-turn-helix, PAP PILI, transcription activator; NMR {Escherichia coli} SCOP: a.4.5.73 Back     alignment and structure
>1on2_A Transcriptional regulator MNTR; helix-turn-helix, DNA-binding protein, metalloregulatory protein; 1.61A {Bacillus subtilis} SCOP: a.4.5.24 a.76.1.1 PDB: 2ev0_A 1on1_A 2ev5_A 2ev6_A* 2f5c_A 2f5d_A 2f5e_A 2f5f_A 2hyf_A* 2hyg_D 3r60_A* 3r61_A* Back     alignment and structure
>1tbx_A ORF F-93, hypothetical 11.0 kDa protein; sulfolobus spindle virus, winged helix, fusellovirus; 2.70A {Sulfolobus virus 1} SCOP: a.4.5.48 Back     alignment and structure
>2gxg_A 146AA long hypothetical transcriptional regulator; winged helix; 1.45A {Sulfolobus tokodaii} PDB: 2eb7_A 2yr2_A 3gez_A 3gf2_A* 3gfi_A 3gfm_A 3gfj_A 3gfl_A Back     alignment and structure
>2rdp_A Putative transcriptional regulator MARR; PFAM PF01047, winged-helix binding motif, structural genomics, PSI-2; 2.30A {Geobacillus stearothermophilus} Back     alignment and structure
>3g3z_A NMB1585, transcriptional regulator, MARR family; transcription factor, structur genomics, oxford protein production facility; 2.10A {Neisseria meningitidis serogroup B} Back     alignment and structure
>3bpv_A Transcriptional regulator; MARR, DNA binding, transcription factor, winged helix motif, DNA-binding; 1.40A {Methanobacterium thermoautotrophicum} PDB: 3bpx_A* Back     alignment and structure
>2fmy_A COOA, carbon monoxide oxidation system transcription RE COOA-1; DNA transcription regulator, DNA binding protein; HET: HEM; 2.20A {Carboxydothermus hydrogenoformans} PDB: 2hkx_A* Back     alignment and structure
>2nnn_A Probable transcriptional regulator; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>3b02_A Transcriptional regulator, CRP family; structural genomics, riken structural genomics/proteomics in RSGI; 1.92A {Thermus thermophilus} PDB: 2zdb_A Back     alignment and structure
>1jgs_A Multiple antibiotic resistance protein MARR; transcription regulation, DNA-binding, repressor, transcription; HET: SAL; 2.30A {Escherichia coli} SCOP: a.4.5.28 Back     alignment and structure
>2oz6_A Virulence factor regulator; winged helix, helix-turn-helix, transcription factor, CAMP-B proteins, CAMP receptor protein; HET: CMP; 2.80A {Pseudomonas aeruginosa} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>1ku9_A Hypothetical protein MJ223; putative transcription factor, homodimeric winged-helix fold, structural genomics, PSI; 2.80A {Methanocaldococcus jannaschii} SCOP: a.4.5.36 Back     alignment and structure
>3clo_A Transcriptional regulator; NP_811094.1, bacterial regulatory proteins, LUXR family, structural genomics; 2.04A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1r1u_A CZRA, repressor protein; zinc, DNA binding, transcriptional regulation, winged HTH protein, transcription repressor; 2.00A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 1r1v_A 2kjb_A 2kjc_A Back     alignment and structure
>3bro_A Transcriptional regulator; helix_TURN_helix, multiple antibiotic resistance protein (MA structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.04A {Oenococcus oeni} SCOP: a.4.5.28 Back     alignment and structure
>3oop_A LIN2960 protein; protein structure initiative, PSI-2, structural genomics, MI center for structural genomics, MCSG, unknown function; 1.78A {Listeria innocua} Back     alignment and structure
>2lkp_A Transcriptional regulator, ARSR family; symmetric homodimer, NI(II) binding protein, DNA binding Pro transcription regulator; NMR {Mycobacterium tuberculosis} Back     alignment and structure
>2zcw_A TTHA1359, transcriptional regulator, FNR/CRP family; stationary phase, DNA-binding, transcription regulation; 1.50A {Thermus thermophilus} Back     alignment and structure
>2pex_A Transcriptional regulator OHRR; transcription regulator; 1.90A {Xanthomonas campestris} PDB: 2pfb_A Back     alignment and structure
>2fbi_A Probable transcriptional regulator; MARR, APC5816, structural genomic protein structure initiative; 2.10A {Pseudomonas aeruginosa} SCOP: a.4.5.28 Back     alignment and structure
>3iwz_A CAP-like, catabolite activation-like protein; XCC, pathogenicity, CRP, CLP, C-DI-GMP receptor, quorum SENS binding, transcription; 2.30A {Xanthomonas campestris PV} Back     alignment and structure
>3la7_A Global nitrogen regulator; activator, DNA-binding, transcription, transcription regulation; HET: BOG; 1.90A {Anabaena} PDB: 3la2_A* 3la3_A* 2xko_A* 2xgx_A* 2xhk_A* 2xkp_A* Back     alignment and structure
>3cuo_A Uncharacterized HTH-type transcriptional regulato; DNA-binding transcriptional regulator, structural genomics, MCSG; 2.00A {Escherichia coli K12} Back     alignment and structure
>2a61_A Transcriptional regulator TM0710; APC4350, MCSG, midwest center for structural genomics, PSI, protein structure initiative, MARR; 1.80A {Thermotoga maritima} SCOP: a.4.5.28 Back     alignment and structure
>3nrv_A Putative transcriptional regulator (MARR/EMRR FAM; PSI-2, protein structure initiati structural genomics; HET: MSE; 2.00A {Acinetobacter SP} Back     alignment and structure
>2l8n_A Transcriptional repressor CYTR; bacterial gene repressor, helix turn helix binding domain, L family, transcription regulation, binding protein; NMR {Escherichia coli} PDB: 2lcv_A Back     alignment and structure
>2fbh_A Transcriptional regulator PA3341; MARR, transcription regulator, APC5857, structural genomics, protein structure initiative; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.28 Back     alignment and structure
>2a6h_F RNA polymerase sigma factor RPOD; RNA polymerase holoenzyme, streptolydigin, antibiotic, transcription regulation; HET: STD; 2.40A {Thermus thermophilus} SCOP: a.4.13.1 a.4.13.2 a.177.1.1 PDB: 1smy_F* 1zyr_F* 1iw7_F* 2a69_F* 2a6e_F 2a68_F* 2be5_F* 2cw0_F 3eql_F* 3dxj_F* 1l9u_H Back     alignment and structure
>3k0l_A Repressor protein; helix-turn-helix, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.35A {Acinetobacter SP} Back     alignment and structure
>1l3l_A Transcriptional activator protein TRAR; helix-turn-helix DNA binding motif, alpha/beta/alpha sandwich; HET: LAE; 1.66A {Agrobacterium tumefaciens} SCOP: a.4.6.2 d.110.5.1 PDB: 1h0m_A* Back     alignment and structure
>1z91_A Organic hydroperoxide resistance transcriptional; OHRR, MARR family, bacterial transcription factor, DNA bindi protein; 2.50A {Bacillus subtilis} SCOP: a.4.5.28 PDB: 1z9c_A* Back     alignment and structure
>2q0o_A Probable transcriptional activator protein TRAR; helix-turn-helix, two-helix coiled coil; HET: LAE; 2.00A {Rhizobium SP} Back     alignment and structure
>1u78_A TC3 transposase, transposable element TC3 transposase; transposon DNA, bipartite DNA-binding, HTH- motif, DNA binding protein/DNA complex; 2.69A {Caenorhabditis elegans} SCOP: a.4.1.2 a.4.1.2 Back     alignment and structure
>2frh_A SARA, staphylococcal accessory regulator A; winged-helix protein, divalent metal binding, transcription; 2.50A {Staphylococcus aureus} SCOP: a.4.5.28 PDB: 2fnp_A 1fzp_D Back     alignment and structure
>4ev0_A Transcription regulator, CRP family; CAMP binding, winged helix-turn-helix motif, DNA binding, transcription activator; HET: CMP; 2.40A {Thermus thermophilus} Back     alignment and structure
>2cyy_A Putative HTH-type transcriptional regulator PH151; structural genomics, pyrococcus horikosii OT3, NPPSFA; HET: MSE GLN; 1.80A {Pyrococcus horikoshii} SCOP: a.4.5.32 d.58.4.2 Back     alignment and structure
>3bdd_A Regulatory protein MARR; putative multiple antibiotic-resistance repressor, structura genomics, joint center for structural genomics, JCSG; 2.20A {Streptococcus suis} Back     alignment and structure
>1zyb_A Transcription regulator, CRP family; NP_813211.1, structural genomics, joint center for structura genomics, JCSG; 2.15A {Bacteroides thetaiotaomicron} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>2w48_A Sorbitol operon regulator; SORC, activator, repressor, DNA-binding, transcription, transcription regulator, transcription regulation; 3.20A {Klebsiella pneumoniae} Back     alignment and structure
>1rzs_A Antirepressor, regulatory protein CRO; helix-turn-helix, DNA-binding protein, structural evolution, transcription; NMR {Enterobacteria phage P22} SCOP: a.35.1.2 Back     alignment and structure
>2fa5_A Transcriptional regulator MARR/EMRR family; multiple antibiotics resistance repressor, XCC structural genomics, X-RAY diffraction; 1.80A {Xanthomonas campestris} Back     alignment and structure
>2k02_A Ferrous iron transport protein C; FEOC, iron-sulfur, metal-binding, metal binding protein; NMR {Klebsiella pneumoniae subsp} Back     alignment and structure
>2oqg_A Possible transcriptional regulator, ARSR family P; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 1.54A {Rhodococcus SP} Back     alignment and structure
>2ofy_A Putative XRE-family transcriptional regulator; transcription regulator, structural genomics, PS protein structure initiative; 1.70A {Rhodococcus SP} SCOP: a.35.1.3 Back     alignment and structure
>3tgn_A ADC operon repressor ADCR; helix-turn-helix, transcriptional regulator, transcription; 2.00A {Streptococcus pneumoniae} Back     alignment and structure
>2cfx_A HTH-type transcriptional regulator LRPC; transcriptional regulation, DNA binding, FFRP; 2.4A {Bacillus subtilis} SCOP: a.4.5.32 d.58.4.2 Back     alignment and structure
>3cjn_A Transcriptional regulator, MARR family; silicibacter pomeroy structural genomics, PSI-2, protein structure initiative; 1.95A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>4hbl_A Transcriptional regulator, MARR family; HTH, transcription factor, DNA binding; 2.50A {Staphylococcus epidermidis} Back     alignment and structure
>1ft9_A Carbon monoxide oxidation system transcription regulator; heme sensor, catabolite gene activator protein; HET: HEM; 2.60A {Rhodospirillum rubrum} SCOP: a.4.5.4 b.82.3.1 Back     alignment and structure
>2eth_A Transcriptional regulator, putative, MAR family; MARR family, structural genomics, joint center for structura genomics, JCSG; 2.30A {Thermotoga maritima} SCOP: a.4.5.28 Back     alignment and structure
>1sfu_A 34L protein; protein/Z-DNA complex, DNA binding protein/DNA complex; 2.00A {Yaba-like disease virus} SCOP: a.4.5.19 Back     alignment and structure
>3szt_A QCSR, quorum-sensing control repressor; quorum sensing acyl-homoserine lactone, helix-turn-helix, transcription factor, 3-OXO-C12 HSL; HET: OHN; 2.55A {Pseudomonas aeruginosa} Back     alignment and structure
>2hin_A GP39, repressor protein; transcription factor, dimer interface, helix-turn-helix; 1.05A {Enterobacteria phage N15} PDB: 3qws_A Back     alignment and structure
>3eco_A MEPR; mutlidrug efflux pump regulator winged helix-turn-helix motif, DNA-binding, transcription, transcription regulation; 2.40A {Staphylococcus aureus} SCOP: a.4.5.0 Back     alignment and structure
>2w25_A Probable transcriptional regulatory protein; transcription regulation, mutant, RV3291C, Glu104Ala, DNA-binding; 2.15A {Mycobacterium tuberculosis} PDB: 2vbw_A* 2vbx_A* 2vby_A* 2vbz_A* 2vc0_A 2vc1_A 2w24_A 2ivm_A 2w29_A 2qz8_A Back     alignment and structure
>1i1g_A Transcriptional regulator LRPA; helix-turn-helix, LRP/ASNC family; 2.90A {Pyrococcus furiosus} SCOP: a.4.5.32 d.58.4.2 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query286
d1ijwc_47 HIN recombinase (DNA-binding domain) {Synthetic} 97.87
d1hlva166 DNA-binding domain of centromere binding protein B 97.17
d1rp3a271 Sigma factor sigma-28 (FliA) {Aquifex aeolicus [Ta 96.17
d1k78a163 Pax-5 {Human (Homo sapiens) [TaxId: 9606]} 95.57
d1pdnc_123 Paired protein (prd) {Fruit fly (Drosophila melano 95.2
d2jn6a189 Uncharacterized protein Cgl2762 {Corynebacterium g 95.19
d1or7a168 SigmaE factor (RpoE) {Escherichia coli [TaxId: 562 94.72
d1s7oa_106 Hypothetical protein SPy1201 {Streptococcus pyogen 94.5
d1i5za169 Catabolite gene activator protein (CAP), C-termina 94.36
d1fsea_67 Germination protein GerE {Bacillus subtilis [TaxId 93.88
d1a04a167 Nitrate/nitrite response regulator (NarL) {Escheri 93.22
d1ku3a_61 Sigma70 (SigA, RpoD) {Thermus aquaticus [TaxId: 27 93.14
d1xsva_106 Hypothetical protein SAV1236 {Staphylococcus aureu 93.01
d1l3la165 Quorum-sensing transcription factor TraR, C-termin 92.96
d1ft9a180 CO-sensing protein CooA, C-terminal domain {Rhodos 92.85
d1zyba173 Probable transcription regulator BT4300, C-termina 92.38
d3e5ua180 Chlorophenol reduction protein CprK {Desulfitobact 92.28
d2gaua181 Transcriptional regulator PG0396, C-terminal domai 92.01
d2ofya182 Putative transcriptional regulator RHA1_ro04071 {R 91.77
d1yioa170 Response regulatory protein StyR, C-terminal domai 91.77
d1ttya_87 Sigma70 (SigA, RpoD) {Thermotoga maritima [TaxId: 91.68
d1biaa163 Biotin repressor, N-terminal domain {Escherichia c 90.98
d1gdta143 gamma,delta resolvase (C-terminal domain) {Escheri 90.9
d2p7vb168 Sigma70 (SigA, RpoD) {Escherichia coli [TaxId: 562 90.69
d2zcwa182 Transcriptional regulator TTHA1359, C-terminal dom 90.59
d2hsga157 Glucose-resistance amylase regulator CcpA, N-termi 90.38
d1qpza157 Purine repressor (PurR), N-terminal domain {Escher 90.37
d1p4wa_87 Transcriptional regulator RcsB {Erwinia amylovora 90.12
d2ppxa162 Uncharacterized protein Atu1735 {Agrobacterium tum 89.68
d1z05a171 Transcriptional regulator VC2007 N-terminal domain 88.84
d1efaa159 Lac repressor (LacR), N-terminal domain {Escherich 88.66
d1uxda_59 Fructose repressor (FruR), N-terminal domain {Esch 88.53
d2auwa167 Hypothetical protein NE0471 C-terminal domain {Nit 88.41
d2d1ha1109 Hypothetical transcriptional regulator ST1889 {Sul 88.07
d1r71a_114 Transcriptional repressor protein KorB DNA-binding 87.5
d1j5ya165 Putative transcriptional regulator TM1602, N-termi 87.41
d1l8qa1110 Chromosomal replication initiation factor DnaA C-t 87.25
d1j1va_94 Chromosomal replication initiation factor DnaA C-t 87.03
d2ev0a161 Manganese transport regulator MntR {Bacillus subti 85.86
d2etha1140 Putative transcriptional regulator TM0816 {Thermot 84.32
d2o38a189 Hypothetical protein RPA3824 {Rhodopseudomonas pal 84.1
d1d5ya154 Rob transcription factor, N-terminal domain {Esche 83.56
d1mkma175 Transcriptional regulator IclR, N-terminal domain 83.42
d1lnwa_141 MexR repressor {Pseudomonas aeruginosa [TaxId: 287 83.37
d2isya163 Iron-dependent regulator IdeR {Mycobacterium tuber 82.79
d2a61a1139 Transcriptional regulator TM0710 {Thermotoga marit 82.51
d1z6ra170 Mlc protein N-terminal domain {Escherichia coli [T 81.92
d1vz0a193 Putative partitioning protein ParB/Spo0J {Thermus 81.91
d1utxa_66 Putative transcription regulator CylR2 {Enterococc 81.87
d2oa4a193 Uncharacterized protein SPO1678 {Silicibacter pome 81.65
d1z91a1137 Organic hydroperoxide resistance transcriptional r 81.62
d1bl0a154 MarA {Escherichia coli [TaxId: 562]} 80.97
d2bgca1100 Listeriolysin regulatory protein PrfA, C-terminal 80.88
d1i1ga160 LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} 80.86
d1j9ia_68 Terminase gpNU1 subunit domain {Bacteriophage lamb 80.85
d2hr3a1145 Probable transcriptional regulator PA3067 {Pseudom 80.85
d3deua1140 Transcriptional regulator SlyA {Salmonella typhimu 80.17
>d1ijwc_ a.4.1.2 (C:) HIN recombinase (DNA-binding domain) {Synthetic} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Recombinase DNA-binding domain
domain: HIN recombinase (DNA-binding domain)
species: Synthetic
Probab=97.87  E-value=9.8e-06  Score=48.15  Aligned_cols=42  Identities=17%  Similarity=0.112  Sum_probs=36.8

Q ss_pred             CCCCCCCHHHHHHHHHHHhhcCCChHhhhhhccccHhHHHHHH
Q psy13113          8 ARGVIHSPVVKLLAVLRFYATGNFQIDSEDYHDISQSTICRLV   50 (286)
Q Consensus         8 ~~~~~~~~~~~l~~~L~~L~~~~~~~~l~~~Fgvs~stv~~~~   50 (286)
                      ||++.++. +|+..+..+++.|.+..++|..||||++|+++++
T Consensus         1 GR~~~lt~-~q~~~a~~l~~~G~s~~~iA~~~gVSr~TiYry~   42 (47)
T d1ijwc_           1 GRPRAINK-HEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYF   42 (47)
T ss_dssp             CCCCSSCH-HHHHHHHHHHHTTCCHHHHHHHHTCCHHHHHHHS
T ss_pred             CCCCcCCH-HHHHHHHHHHHCCCCHHHHHHHHCcCHHHHHhhC
Confidence            46667776 6788888889999999999999999999999986



>d1hlva1 a.4.1.7 (A:1-66) DNA-binding domain of centromere binding protein B (CENP-B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rp3a2 a.4.13.2 (A:164-234) Sigma factor sigma-28 (FliA) {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1k78a1 a.4.1.5 (A:19-81) Pax-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pdnc_ a.4.1.5 (C:) Paired protein (prd) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2jn6a1 a.4.1.19 (A:1-89) Uncharacterized protein Cgl2762 {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1or7a1 a.4.13.2 (A:120-187) SigmaE factor (RpoE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s7oa_ a.4.13.3 (A:) Hypothetical protein SPy1201 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1i5za1 a.4.5.4 (A:138-206) Catabolite gene activator protein (CAP), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fsea_ a.4.6.2 (A:) Germination protein GerE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1a04a1 a.4.6.2 (A:150-216) Nitrate/nitrite response regulator (NarL) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ku3a_ a.4.13.2 (A:) Sigma70 (SigA, RpoD) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1xsva_ a.4.13.3 (A:) Hypothetical protein SAV1236 {Staphylococcus aureus, strain Mu50 / ATCC 700699 [TaxId: 1280]} Back     information, alignment and structure
>d1l3la1 a.4.6.2 (A:170-234) Quorum-sensing transcription factor TraR, C-terminal domain {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ft9a1 a.4.5.4 (A:134-213) CO-sensing protein CooA, C-terminal domain {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1zyba1 a.4.5.4 (A:148-220) Probable transcription regulator BT4300, C-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d3e5ua1 a.4.5.4 (A:148-227) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]} Back     information, alignment and structure
>d2gaua1 a.4.5.4 (A:152-232) Transcriptional regulator PG0396, C-terminal domain {Porphyromonas gingivalis [TaxId: 837]} Back     information, alignment and structure
>d2ofya1 a.35.1.3 (A:3-84) Putative transcriptional regulator RHA1_ro04071 {Rhodococcus sp. RHA1 [TaxId: 101510]} Back     information, alignment and structure
>d1yioa1 a.4.6.2 (A:131-200) Response regulatory protein StyR, C-terminal domain {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1ttya_ a.4.13.2 (A:) Sigma70 (SigA, RpoD) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1biaa1 a.4.5.1 (A:1-63) Biotin repressor, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gdta1 a.4.1.2 (A:141-183) gamma,delta resolvase (C-terminal domain) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p7vb1 a.4.13.2 (B:546-613) Sigma70 (SigA, RpoD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hsga1 a.35.1.5 (A:2-58) Glucose-resistance amylase regulator CcpA, N-terminal domain {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1qpza1 a.35.1.5 (A:2-58) Purine repressor (PurR), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p4wa_ a.4.6.2 (A:) Transcriptional regulator RcsB {Erwinia amylovora [TaxId: 552]} Back     information, alignment and structure
>d2ppxa1 a.35.1.3 (A:30-91) Uncharacterized protein Atu1735 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1z05a1 a.4.5.63 (A:10-80) Transcriptional regulator VC2007 N-terminal domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1efaa1 a.35.1.5 (A:2-60) Lac repressor (LacR), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uxda_ a.35.1.5 (A:) Fructose repressor (FruR), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2auwa1 a.35.1.10 (A:88-154) Hypothetical protein NE0471 C-terminal domain {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d2d1ha1 a.4.5.50 (A:1-109) Hypothetical transcriptional regulator ST1889 {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1r71a_ a.4.14.1 (A:) Transcriptional repressor protein KorB DNA-binding domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j5ya1 a.4.5.1 (A:3-67) Putative transcriptional regulator TM1602, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1l8qa1 a.4.12.2 (A:290-399) Chromosomal replication initiation factor DnaA C-terminal domain IV {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1j1va_ a.4.12.2 (A:) Chromosomal replication initiation factor DnaA C-terminal domain IV {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ev0a1 a.4.5.24 (A:2-62) Manganese transport regulator MntR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2etha1 a.4.5.28 (A:1-140) Putative transcriptional regulator TM0816 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2o38a1 a.35.1.13 (A:28-116) Hypothetical protein RPA3824 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d1d5ya1 a.4.1.8 (A:3-56) Rob transcription factor, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mkma1 a.4.5.33 (A:1-75) Transcriptional regulator IclR, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lnwa_ a.4.5.28 (A:) MexR repressor {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2isya1 a.4.5.24 (A:2-64) Iron-dependent regulator IdeR {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2a61a1 a.4.5.28 (A:5-143) Transcriptional regulator TM0710 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1z6ra1 a.4.5.63 (A:12-81) Mlc protein N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vz0a1 a.4.14.1 (A:116-208) Putative partitioning protein ParB/Spo0J {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1utxa_ a.35.1.3 (A:) Putative transcription regulator CylR2 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2oa4a1 a.4.12.3 (A:1-93) Uncharacterized protein SPO1678 {Silicibacter pomeroyi [TaxId: 89184]} Back     information, alignment and structure
>d1z91a1 a.4.5.28 (A:8-144) Organic hydroperoxide resistance transcriptional regulator OhrR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1bl0a1 a.4.1.8 (A:9-62) MarA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bgca1 a.4.5.4 (A:138-237) Listeriolysin regulatory protein PrfA, C-terminal domain {Bacteria (Listeria monocytogenes) [TaxId: 1639]} Back     information, alignment and structure
>d1i1ga1 a.4.5.32 (A:2-61) LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1j9ia_ a.6.1.5 (A:) Terminase gpNU1 subunit domain {Bacteriophage lambda [TaxId: 10710]} Back     information, alignment and structure
>d2hr3a1 a.4.5.28 (A:2-146) Probable transcriptional regulator PA3067 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d3deua1 a.4.5.28 (A:2-141) Transcriptional regulator SlyA {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure