Psyllid ID: psy13113
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 286 | ||||||
| 328704555 | 370 | PREDICTED: putative nuclease HARBI1-like | 0.944 | 0.729 | 0.433 | 6e-52 | |
| 328705831 | 326 | PREDICTED: putative nuclease HARBI1-like | 0.944 | 0.828 | 0.433 | 6e-52 | |
| 328711563 | 335 | PREDICTED: putative nuclease HARBI1-like | 0.937 | 0.8 | 0.419 | 2e-50 | |
| 332374146 | 353 | unknown [Dendroctonus ponderosae] | 0.863 | 0.699 | 0.416 | 2e-50 | |
| 328697485 | 681 | PREDICTED: hypothetical protein LOC10057 | 0.856 | 0.359 | 0.429 | 2e-49 | |
| 328696997 | 356 | PREDICTED: putative nuclease HARBI1-like | 0.898 | 0.721 | 0.430 | 3e-49 | |
| 270015185 | 561 | hypothetical protein TcasGA2_TC000011 [T | 0.923 | 0.470 | 0.419 | 1e-47 | |
| 270012680 | 358 | hypothetical protein TcasGA2_TC015989 [T | 0.944 | 0.754 | 0.419 | 3e-47 | |
| 350536511 | 353 | uncharacterized protein LOC100569528 [Ac | 0.944 | 0.764 | 0.417 | 8e-47 | |
| 193666845 | 342 | PREDICTED: putative nuclease HARBI1-like | 0.800 | 0.669 | 0.453 | 1e-46 |
| >gi|328704555|ref|XP_001947392.2| PREDICTED: putative nuclease HARBI1-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 210 bits (535), Expect = 6e-52, Method: Compositional matrix adjust.
Identities = 124/286 (43%), Positives = 169/286 (59%), Gaps = 16/286 (5%)
Query: 14 SPVVKLLAVLRFYATGNFQIDSEDYHDISQSTICRLVAKVSEELAKCHQQWIHFPE---D 70
+P+ +LL LRFYATGNF I D+ IS ++ ++V +VS LA ++I PE +
Sbjct: 85 APMTQLLITLRFYATGNFLITVGDFGGISVASAGKIVKRVSYALAFLSSRYIRLPETPEE 144
Query: 71 LQTAKNQFSGIAGFPRVVVGCIDGTHVPIELPSIENGEHYRNRKHFYSINVQVIGGPNLE 130
K QF G+A FP+V+ G ID TH+ ++ PS E GE YRNRK ++S+NVQ + NLE
Sbjct: 145 KMELKVQFYGLARFPKVI-GAIDCTHIKLQCPSKEYGELYRNRKGYFSLNVQALVNANLE 203
Query: 131 IYDVVASWPGSTHDSRIFQNSRVYSRFDRREIRG-LLLGDIGYAQNEFTFTPVRNPITPT 189
DVV WPGS HDS IF NSR+ +R + E ++LGD GYA + + TP+ + T T
Sbjct: 204 FMDVVVRWPGSAHDSNIFANSRLKARIELPEFSDCIILGDSGYALSHYLLTPLAH--TTT 261
Query: 190 PSQVAYNAAQIRTRNSVERLFGVLKRRFACLRKKLANQPTTCSHIITACAVLHNIAIARR 249
++ YN +QIRTRN VER FGV KRRF L L + T +I ACAVLHN+A +
Sbjct: 262 NAERLYNESQIRTRNVVERSFGVWKRRFPVLFFGLRLKMETTMAVIQACAVLHNMARLQN 321
Query: 250 EAPPP---ENNELPVNVHIRDADD------NRLGAAVREAFINEHF 286
+ PP EN + ++ I + + N A+R A I EHF
Sbjct: 322 DPQPPDDIENIKQLLSAEISEIEAATQPQINSPAQALRTALIMEHF 367
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|328705831|ref|XP_003242919.1| PREDICTED: putative nuclease HARBI1-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|328711563|ref|XP_003244572.1| PREDICTED: putative nuclease HARBI1-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|332374146|gb|AEE62214.1| unknown [Dendroctonus ponderosae] | Back alignment and taxonomy information |
|---|
| >gi|328697485|ref|XP_003240353.1| PREDICTED: hypothetical protein LOC100574226 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|328696997|ref|XP_003240200.1| PREDICTED: putative nuclease HARBI1-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|270015185|gb|EFA11633.1| hypothetical protein TcasGA2_TC000011 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|270012680|gb|EFA09128.1| hypothetical protein TcasGA2_TC015989 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|350536511|ref|NP_001233059.1| uncharacterized protein LOC100569528 [Acyrthosiphon pisum] gi|239789800|dbj|BAH71500.1| hypothetical protein [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|193666845|ref|XP_001944531.1| PREDICTED: putative nuclease HARBI1-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 286 | ||||||
| UNIPROTKB|E1BQ99 | 348 | HARBI1 "Uncharacterized protei | 0.800 | 0.658 | 0.379 | 1.2e-35 | |
| MGI|MGI:2443194 | 349 | Harbi1 "harbinger transposase | 0.800 | 0.656 | 0.387 | 1.1e-34 | |
| ZFIN|ZDB-GENE-040608-1 | 349 | harbi1 "harbinger transposase | 0.940 | 0.770 | 0.340 | 2.2e-34 | |
| UNIPROTKB|Q17QR8 | 349 | HARBI1 "Putative nuclease HARB | 0.800 | 0.656 | 0.379 | 2.8e-34 | |
| RGD|1584007 | 349 | Harbi1 "harbinger transposase | 0.800 | 0.656 | 0.379 | 2.8e-34 | |
| UNIPROTKB|F1SIA2 | 349 | HARBI1 "Uncharacterized protei | 0.800 | 0.656 | 0.370 | 7.4e-34 | |
| UNIPROTKB|E2RCW9 | 349 | HARBI1 "Uncharacterized protei | 0.800 | 0.656 | 0.370 | 5.2e-33 | |
| UNIPROTKB|Q96MB7 | 349 | HARBI1 "Putative nuclease HARB | 0.800 | 0.656 | 0.370 | 5.2e-33 | |
| TAIR|locus:2143104 | 502 | AT5G12010 [Arabidopsis thalian | 0.793 | 0.452 | 0.292 | 3.1e-19 | |
| ZFIN|ZDB-GENE-060810-147 | 395 | si:dkey-197c15.6 "si:dkey-197c | 0.786 | 0.569 | 0.297 | 3.6e-19 |
| UNIPROTKB|E1BQ99 HARBI1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Score = 385 (140.6 bits), Expect = 1.2e-35, P = 1.2e-35
Identities = 91/240 (37%), Positives = 132/240 (55%)
Query: 14 SPVVKLLAVLRFYATGNFQIDSEDYHDISQSTICRLVAKVSEELAKCHQQWIHFPED--- 70
SP ++LA L FY +G+FQ D ISQ+++ R VA V+E L + Q+IHFPED
Sbjct: 68 SPETQVLAALGFYTSGSFQTRMGDAIGISQASMSRCVANVTEALVERAPQFIHFPEDEAA 127
Query: 71 LQTAKNQFSGIAGFPRVVVGCIDGTHVPIELPSIENGEHYRNRKHFYSINVQVIGGPNLE 130
+Q+ K+ F +AG P V+ G +D THV I+ P+ E+ Y NRK +S+N ++
Sbjct: 128 VQSLKDDFYALAGMPGVL-GVVDCTHVAIKAPNAEDLS-YVNRKGLHSLNCLMVCDARGA 185
Query: 131 IYDVVASWPGSTHDSRIFQNSRVYSRFDRREIR-GLLLGDIGYAQNEFTFTPVRNPITPT 189
+ WPGS D + Q + + S+F+ + G LLGD + + TP+ P T
Sbjct: 186 LLSAETHWPGSMPDCNVLQQAALTSQFENELYKDGWLLGDSSFFLRTWLMTPLHIP--ET 243
Query: 190 PSQVAYNAAQIRTRNSVERLFGVLKRRFACL---RKKLANQPTTCSHIITACAVLHNIAI 246
P++ YN A T N +ER F ++ RF CL + L P SHII AC VLHNI++
Sbjct: 244 PAEYRYNMAHSATHNVIERTFRTIRSRFRCLDGSKGTLQYSPEKSSHIILACCVLHNISL 303
|
|
| MGI|MGI:2443194 Harbi1 "harbinger transposase derived 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040608-1 harbi1 "harbinger transposase derived 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q17QR8 HARBI1 "Putative nuclease HARBI1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| RGD|1584007 Harbi1 "harbinger transposase derived 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SIA2 HARBI1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RCW9 HARBI1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q96MB7 HARBI1 "Putative nuclease HARBI1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2143104 AT5G12010 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-060810-147 si:dkey-197c15.6 "si:dkey-197c15.6" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 286 | |||
| pfam13359 | 155 | pfam13359, DDE_4, DDE superfamily endonuclease | 5e-39 | |
| pfam04827 | 205 | pfam04827, Plant_tran, Plant transposon protein | 3e-05 |
| >gnl|CDD|222071 pfam13359, DDE_4, DDE superfamily endonuclease | Back alignment and domain information |
|---|
Score = 133 bits (338), Expect = 5e-39
Identities = 50/160 (31%), Positives = 71/160 (44%), Gaps = 13/160 (8%)
Query: 92 IDGTHVPIELPSI--ENGEHYRNRKHFYSINVQVIGGPNLEIYDVVASWPGSTHDSRIFQ 149
IDGT +PIE P E + Y K ++ V ++ P+ I V WPGS D RI +
Sbjct: 1 IDGTEIPIERPKSLEEQAQTYSGYKKHNTLKVLIVVDPDGRIIFVSVGWPGSVSDKRILE 60
Query: 150 NSRVYSRFDRREIRGLLLGDIGYAQNEFT-----FTPVRNPITPTPSQVAYNAAQIRTRN 204
NS + + + +L D G+ ++ P T +V +N R
Sbjct: 61 NSGLLEKLPPGDY---VLADRGFPLSDSLLAPPAKKPGGAQ--LTEEEVEFNRRIASARI 115
Query: 205 SVERLFGVLKRRFACLRKKLAN-QPTTCSHIITACAVLHN 243
VER+ G LK RF LR +L + TT I+ C LHN
Sbjct: 116 HVERVIGRLKGRFRILRGRLRISKLTTLDKIVLVCCALHN 155
|
This family of proteins are related to pfam00665 and are probably endonucleases of the DDE superfamily. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction. Length = 155 |
| >gnl|CDD|203098 pfam04827, Plant_tran, Plant transposon protein | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 286 | |||
| PF13359 | 158 | DDE_Tnp_4: DDE superfamily endonuclease | 100.0 | |
| KOG4585|consensus | 326 | 100.0 | ||
| PF04827 | 205 | Plant_tran: Plant transposon protein; InterPro: IP | 100.0 | |
| PF13613 | 53 | HTH_Tnp_4: Helix-turn-helix of DDE superfamily end | 99.3 | |
| PF13612 | 155 | DDE_Tnp_1_3: Transposase DDE domain | 99.28 | |
| PF01609 | 213 | DDE_Tnp_1: Transposase DDE domain; InterPro: IPR00 | 98.19 | |
| PF13586 | 88 | DDE_Tnp_1_2: Transposase DDE domain | 98.15 | |
| PF02796 | 45 | HTH_7: Helix-turn-helix domain of resolvase; Inter | 97.31 | |
| PF04545 | 50 | Sigma70_r4: Sigma-70, region 4; InterPro: IPR00763 | 97.08 | |
| PF13936 | 44 | HTH_38: Helix-turn-helix domain; PDB: 2W48_A. | 96.95 | |
| PF13011 | 85 | LZ_Tnp_IS481: leucine-zipper of insertion element | 96.84 | |
| PF04218 | 53 | CENP-B_N: CENP-B N-terminal DNA-binding domain; In | 96.69 | |
| PF13384 | 50 | HTH_23: Homeodomain-like domain; PDB: 2X48_C. | 96.37 | |
| PF13518 | 52 | HTH_28: Helix-turn-helix domain | 96.3 | |
| smart00351 | 125 | PAX Paired Box domain. | 96.14 | |
| PF05225 | 45 | HTH_psq: helix-turn-helix, Psq domain; InterPro: I | 96.09 | |
| cd00569 | 42 | HTH_Hin_like Helix-turn-helix domain of Hin and re | 95.91 | |
| PF08281 | 54 | Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013 | 95.81 | |
| PRK09413 | 121 | IS2 repressor TnpA; Reviewed | 95.67 | |
| PF01527 | 76 | HTH_Tnp_1: Transposase; InterPro: IPR002514 Transp | 95.65 | |
| cd00131 | 128 | PAX Paired Box domain | 95.63 | |
| cd06571 | 90 | Bac_DnaA_C C-terminal domain of bacterial DnaA pro | 95.47 | |
| PF13340 | 75 | DUF4096: Putative transposase of IS4/5 family (DUF | 95.4 | |
| smart00421 | 58 | HTH_LUXR helix_turn_helix, Lux Regulon. lux regulo | 95.15 | |
| COG3415 | 138 | Transposase and inactivated derivatives [DNA repli | 95.14 | |
| cd06171 | 55 | Sigma70_r4 Sigma70, region (SR) 4 refers to the mo | 95.12 | |
| PF12116 | 82 | SpoIIID: Stage III sporulation protein D; InterPro | 95.08 | |
| PRK00118 | 104 | putative DNA-binding protein; Validated | 94.75 | |
| PF13542 | 52 | HTH_Tnp_ISL3: Helix-turn-helix domain of transposa | 94.57 | |
| PRK04217 | 110 | hypothetical protein; Provisional | 94.45 | |
| PRK09639 | 166 | RNA polymerase sigma factor SigX; Provisional | 94.3 | |
| PRK12529 | 178 | RNA polymerase sigma factor; Provisional | 94.1 | |
| cd06170 | 57 | LuxR_C_like C-terminal DNA-binding domain of LuxR- | 94.05 | |
| TIGR03879 | 73 | near_KaiC_dom probable regulatory domain. This mod | 93.85 | |
| TIGR02531 | 88 | yecD_yerC TrpR-related protein YerC/YecD. This mod | 93.51 | |
| PRK06030 | 124 | hypothetical protein; Provisional | 93.35 | |
| PRK09652 | 182 | RNA polymerase sigma factor RpoE; Provisional | 93.14 | |
| TIGR02844 | 80 | spore_III_D sporulation transcriptional regulator | 93.12 | |
| PHA00675 | 78 | hypothetical protein | 92.98 | |
| PRK08301 | 234 | sporulation sigma factor SigE; Reviewed | 92.82 | |
| PRK05911 | 257 | RNA polymerase sigma factor sigma-28; Reviewed | 92.71 | |
| PF04967 | 53 | HTH_10: HTH DNA binding domain; InterPro: IPR00705 | 92.7 | |
| TIGR02985 | 161 | Sig70_bacteroi1 RNA polymerase sigma-70 factor, Ba | 92.69 | |
| PRK03975 | 141 | tfx putative transcriptional regulator; Provisiona | 92.61 | |
| TIGR00721 | 137 | tfx DNA-binding protein, Tfx family. Tfx from Meth | 92.59 | |
| PHA00542 | 82 | putative Cro-like protein | 92.47 | |
| PF13412 | 48 | HTH_24: Winged helix-turn-helix DNA-binding; PDB: | 92.45 | |
| TIGR02952 | 170 | Sig70_famx2 RNA polymerase sigma-70 factor, TIGR02 | 92.34 | |
| PF07374 | 100 | DUF1492: Protein of unknown function (DUF1492); In | 92.27 | |
| PRK07037 | 163 | extracytoplasmic-function sigma-70 factor; Validat | 92.22 | |
| TIGR02960 | 324 | SigX5 RNA polymerase sigma-70 factor, TIGR02960 fa | 92.2 | |
| PRK09641 | 187 | RNA polymerase sigma factor SigW; Provisional | 92.16 | |
| PF01325 | 60 | Fe_dep_repress: Iron dependent repressor, N-termin | 92.16 | |
| TIGR02937 | 158 | sigma70-ECF RNA polymerase sigma factor, sigma-70 | 92.12 | |
| PRK09638 | 176 | RNA polymerase sigma factor SigY; Reviewed | 92.1 | |
| PRK12547 | 164 | RNA polymerase sigma factor; Provisional | 92.03 | |
| PRK15320 | 251 | transcriptional activator SprB; Provisional | 92.03 | |
| TIGR02989 | 159 | Sig-70_gvs1 RNA polymerase sigma-70 factor, Rhodop | 91.96 | |
| PRK12514 | 179 | RNA polymerase sigma factor; Provisional | 91.96 | |
| PRK12511 | 182 | RNA polymerase sigma factor; Provisional | 91.93 | |
| PRK12519 | 194 | RNA polymerase sigma factor; Provisional | 91.93 | |
| TIGR01321 | 94 | TrpR trp operon repressor, proteobacterial. This m | 91.92 | |
| PF12802 | 62 | MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP | 91.72 | |
| PRK12524 | 196 | RNA polymerase sigma factor; Provisional | 91.71 | |
| PRK12530 | 189 | RNA polymerase sigma factor; Provisional | 91.7 | |
| PF01022 | 47 | HTH_5: Bacterial regulatory protein, arsR family; | 91.66 | |
| PF13730 | 55 | HTH_36: Helix-turn-helix domain | 91.64 | |
| PF00356 | 46 | LacI: Bacterial regulatory proteins, lacI family; | 91.61 | |
| PF01047 | 59 | MarR: MarR family; InterPro: IPR000835 The MarR-ty | 91.61 | |
| PRK12515 | 189 | RNA polymerase sigma factor; Provisional | 91.6 | |
| PRK05803 | 233 | sporulation sigma factor SigK; Reviewed | 91.56 | |
| PRK09415 | 179 | RNA polymerase factor sigma C; Reviewed | 91.56 | |
| PRK12533 | 216 | RNA polymerase sigma factor; Provisional | 91.56 | |
| PF08279 | 55 | HTH_11: HTH domain; InterPro: IPR013196 Winged hel | 91.52 | |
| PF13551 | 112 | HTH_29: Winged helix-turn helix | 91.44 | |
| COG2963 | 116 | Transposase and inactivated derivatives [DNA repli | 91.41 | |
| PRK12537 | 182 | RNA polymerase sigma factor; Provisional | 91.4 | |
| PRK12531 | 194 | RNA polymerase sigma factor; Provisional | 91.31 | |
| PRK15418 | 318 | transcriptional regulator LsrR; Provisional | 91.3 | |
| TIGR02392 | 270 | rpoH_proteo alternative sigma factor RpoH. A sigma | 91.3 | |
| PRK12512 | 184 | RNA polymerase sigma factor; Provisional | 91.23 | |
| PRK12516 | 187 | RNA polymerase sigma factor; Provisional | 91.18 | |
| TIGR02939 | 190 | RpoE_Sigma70 RNA polymerase sigma factor RpoE. A s | 91.13 | |
| PRK09047 | 161 | RNA polymerase factor sigma-70; Validated | 91.07 | |
| PRK11924 | 179 | RNA polymerase sigma factor; Provisional | 91.0 | |
| PRK05602 | 186 | RNA polymerase sigma factor; Reviewed | 90.9 | |
| PRK12534 | 187 | RNA polymerase sigma factor; Provisional | 90.85 | |
| TIGR02948 | 187 | SigW_bacill RNA polymerase sigma-W factor. This si | 90.85 | |
| PRK09643 | 192 | RNA polymerase sigma factor SigM; Reviewed | 90.82 | |
| PF00196 | 58 | GerE: Bacterial regulatory proteins, luxR family; | 90.75 | |
| TIGR02950 | 154 | SigM_subfam RNA polymerase sigma factor, SigM fami | 90.69 | |
| PRK11923 | 193 | algU RNA polymerase sigma factor AlgU; Provisional | 90.59 | |
| PRK06596 | 284 | RNA polymerase factor sigma-32; Reviewed | 90.57 | |
| PRK07408 | 256 | RNA polymerase sigma factor SigF; Reviewed | 90.53 | |
| TIGR02983 | 162 | SigE-fam_strep RNA polymerase sigma-70 factor, sig | 90.39 | |
| TIGR03001 | 244 | Sig-70_gmx1 RNA polymerase sigma-70 factor, Myxoco | 90.35 | |
| PRK12546 | 188 | RNA polymerase sigma factor; Provisional | 90.07 | |
| cd00092 | 67 | HTH_CRP helix_turn_helix, cAMP Regulatory protein | 90.06 | |
| TIGR02984 | 189 | Sig-70_plancto1 RNA polymerase sigma-70 factor, Pl | 90.03 | |
| TIGR02980 | 227 | SigBFG RNA polymerase sigma-70 factor, sigma-B/F/G | 90.03 | |
| PRK05572 | 252 | sporulation sigma factor SigF; Validated | 90.03 | |
| PF08299 | 70 | Bac_DnaA_C: Bacterial dnaA protein helix-turn-heli | 89.98 | |
| PRK06811 | 189 | RNA polymerase factor sigma-70; Validated | 89.96 | |
| PRK12540 | 182 | RNA polymerase sigma factor; Provisional | 89.93 | |
| TIGR02954 | 169 | Sig70_famx3 RNA polymerase sigma-70 factor, TIGR02 | 89.91 | |
| TIGR02393 | 238 | RpoD_Cterm RNA polymerase sigma factor RpoD, C-ter | 89.8 | |
| PRK12532 | 195 | RNA polymerase sigma factor; Provisional | 89.79 | |
| TIGR01636 | 134 | phage_rinA phage transcriptional activator, RinA f | 89.73 | |
| TIGR02835 | 234 | spore_sigmaE RNA polymerase sigma-E factor. Member | 89.72 | |
| PF01710 | 119 | HTH_Tnp_IS630: Transposase; InterPro: IPR002622 Tr | 89.71 | |
| PRK06759 | 154 | RNA polymerase factor sigma-70; Validated | 89.63 | |
| PRK06704 | 228 | RNA polymerase factor sigma-70; Validated | 89.6 | |
| PRK12544 | 206 | RNA polymerase sigma factor; Provisional | 89.56 | |
| PRK08583 | 257 | RNA polymerase sigma factor SigB; Validated | 89.51 | |
| TIGR02885 | 231 | spore_sigF RNA polymerase sigma-F factor. Members | 89.4 | |
| PRK08215 | 258 | sporulation sigma factor SigG; Reviewed | 89.31 | |
| PRK12523 | 172 | RNA polymerase sigma factor; Reviewed | 89.29 | |
| PRK07500 | 289 | rpoH2 RNA polymerase factor sigma-32; Reviewed | 89.27 | |
| TIGR02957 | 281 | SigX4 RNA polymerase sigma-70 factor, TIGR02957 fa | 89.07 | |
| PRK12539 | 184 | RNA polymerase sigma factor; Provisional | 89.04 | |
| PRK12528 | 161 | RNA polymerase sigma factor; Provisional | 89.03 | |
| PRK09645 | 173 | RNA polymerase sigma factor SigL; Provisional | 89.0 | |
| PF01371 | 87 | Trp_repressor: Trp repressor protein; InterPro: IP | 88.97 | |
| PRK12520 | 191 | RNA polymerase sigma factor; Provisional | 88.91 | |
| TIGR02999 | 183 | Sig-70_X6 RNA polymerase sigma factor, TIGR02999 f | 88.8 | |
| COG2739 | 105 | Uncharacterized protein conserved in bacteria [Fun | 88.73 | |
| TIGR02943 | 188 | Sig70_famx1 RNA polymerase sigma-70 factor, TIGR02 | 88.66 | |
| TIGR02850 | 254 | spore_sigG RNA polymerase sigma-G factor. Members | 88.64 | |
| TIGR02846 | 227 | spore_sigmaK RNA polymerase sigma-K factor. The sp | 88.61 | |
| PRK09637 | 181 | RNA polymerase sigma factor SigZ; Provisional | 88.53 | |
| PRK06930 | 170 | positive control sigma-like factor; Validated | 88.37 | |
| PRK12522 | 173 | RNA polymerase sigma factor; Provisional | 88.32 | |
| TIGR02394 | 285 | rpoS_proteo RNA polymerase sigma factor RpoS. A si | 88.17 | |
| PRK06986 | 236 | fliA flagellar biosynthesis sigma factor; Validate | 88.15 | |
| PRK09636 | 293 | RNA polymerase sigma factor SigJ; Provisional | 88.02 | |
| PF05344 | 65 | DUF746: Domain of Unknown Function (DUF746); Inter | 88.0 | |
| PRK12525 | 168 | RNA polymerase sigma factor; Provisional | 87.84 | |
| PF09339 | 52 | HTH_IclR: IclR helix-turn-helix domain; InterPro: | 87.8 | |
| PRK07405 | 317 | RNA polymerase sigma factor SigD; Validated | 87.78 | |
| COG3293 | 124 | Transposase and inactivated derivatives [DNA repli | 87.71 | |
| COG1595 | 182 | RpoE DNA-directed RNA polymerase specialized sigma | 87.47 | |
| PRK07670 | 251 | RNA polymerase sigma factor SigD; Validated | 87.47 | |
| PF00126 | 60 | HTH_1: Bacterial regulatory helix-turn-helix prote | 87.33 | |
| COG1191 | 247 | FliA DNA-directed RNA polymerase specialized sigma | 87.05 | |
| PRK09642 | 160 | RNA polymerase sigma factor SigW; Reviewed | 87.01 | |
| PF04297 | 101 | UPF0122: Putative helix-turn-helix protein, YlxM / | 87.0 | |
| PRK09648 | 189 | RNA polymerase sigma factor SigD; Reviewed | 86.96 | |
| TIGR02941 | 255 | Sigma_B RNA polymerase sigma-B factor. This sigma | 86.86 | |
| smart00346 | 91 | HTH_ICLR helix_turn_helix isocitrate lyase regulat | 86.85 | |
| PRK13919 | 186 | putative RNA polymerase sigma E protein; Provision | 86.83 | |
| PRK09649 | 185 | RNA polymerase sigma factor SigC; Reviewed | 86.78 | |
| PF13545 | 76 | HTH_Crp_2: Crp-like helix-turn-helix domain; PDB: | 86.75 | |
| PRK12527 | 159 | RNA polymerase sigma factor; Reviewed | 86.69 | |
| PRK08295 | 208 | RNA polymerase factor sigma-70; Validated | 86.68 | |
| PRK07122 | 264 | RNA polymerase sigma factor SigF; Reviewed | 86.67 | |
| PRK12542 | 185 | RNA polymerase sigma factor; Provisional | 86.56 | |
| PRK12536 | 181 | RNA polymerase sigma factor; Provisional | 86.48 | |
| PF00325 | 32 | Crp: Bacterial regulatory proteins, crp family; In | 86.47 | |
| TIGR02479 | 224 | FliA_WhiG RNA polymerase sigma factor, FliA/WhiG f | 86.38 | |
| PF09862 | 113 | DUF2089: Protein of unknown function (DUF2089); In | 86.33 | |
| PRK09635 | 290 | sigI RNA polymerase sigma factor SigI; Provisional | 86.23 | |
| smart00550 | 68 | Zalpha Z-DNA-binding domain in adenosine deaminase | 86.22 | |
| PRK12541 | 161 | RNA polymerase sigma factor; Provisional | 86.06 | |
| PRK12543 | 179 | RNA polymerase sigma factor; Provisional | 85.88 | |
| PRK09644 | 165 | RNA polymerase sigma factor SigM; Provisional | 85.72 | |
| PF13751 | 125 | DDE_Tnp_1_6: Transposase DDE domain | 85.67 | |
| PF13560 | 64 | HTH_31: Helix-turn-helix domain; PDB: 3F51_C 3F52_ | 85.45 | |
| COG2390 | 321 | DeoR Transcriptional regulator, contains sigma fac | 85.38 | |
| PF09607 | 58 | BrkDBD: Brinker DNA-binding domain; InterPro: IPR0 | 85.32 | |
| PRK12535 | 196 | RNA polymerase sigma factor; Provisional | 85.32 | |
| PRK12526 | 206 | RNA polymerase sigma factor; Provisional | 85.27 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 85.09 | |
| PF13610 | 140 | DDE_Tnp_IS240: DDE domain | 84.92 | |
| PRK05657 | 325 | RNA polymerase sigma factor RpoS; Validated | 84.86 | |
| PRK12545 | 201 | RNA polymerase sigma factor; Provisional | 84.84 | |
| PRK11922 | 231 | RNA polymerase sigma factor; Provisional | 84.84 | |
| TIGR02959 | 170 | SigZ RNA polymerase sigma factor, SigZ family. Thi | 84.82 | |
| TIGR03697 | 193 | NtcA_cyano global nitrogen regulator NtcA, cyanoba | 84.66 | |
| PRK12517 | 188 | RNA polymerase sigma factor; Provisional | 84.57 | |
| PRK15201 | 198 | fimbriae regulatory protein FimW; Provisional | 84.3 | |
| PRK07406 | 373 | RNA polymerase sigma factor RpoD; Validated | 84.25 | |
| TIGR01610 | 95 | phage_O_Nterm phage replication protein O, N-termi | 84.09 | |
| PRK03573 | 144 | transcriptional regulator SlyA; Provisional | 83.93 | |
| cd00090 | 78 | HTH_ARSR Arsenical Resistance Operon Repressor and | 83.87 | |
| PF01381 | 55 | HTH_3: Helix-turn-helix; InterPro: IPR001387 This | 83.79 | |
| PRK12427 | 231 | flagellar biosynthesis sigma factor; Provisional | 83.73 | |
| PF13463 | 68 | HTH_27: Winged helix DNA-binding domain; PDB: 3GFL | 83.73 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 83.62 | |
| PRK07598 | 415 | RNA polymerase sigma factor SigC; Validated | 83.61 | |
| PRK09646 | 194 | RNA polymerase sigma factor SigK; Reviewed | 83.52 | |
| TIGR02859 | 198 | spore_sigH RNA polymerase sigma-H factor. Members | 83.49 | |
| PRK12538 | 233 | RNA polymerase sigma factor; Provisional | 83.36 | |
| PF06056 | 58 | Terminase_5: Putative ATPase subunit of terminase | 83.2 | |
| PRK11512 | 144 | DNA-binding transcriptional repressor MarR; Provis | 83.2 | |
| smart00345 | 60 | HTH_GNTR helix_turn_helix gluconate operon transcr | 83.11 | |
| PF07638 | 185 | Sigma70_ECF: ECF sigma factor | 83.1 | |
| PRK13870 | 234 | transcriptional regulator TraR; Provisional | 83.06 | |
| PRK11753 | 211 | DNA-binding transcriptional dual regulator Crp; Pr | 83.01 | |
| PF00872 | 381 | Transposase_mut: Transposase, Mutator family; Inte | 82.81 | |
| PRK15411 | 207 | rcsA colanic acid capsular biosynthesis activation | 82.78 | |
| TIGR02947 | 193 | SigH_actino RNA polymerase sigma-70 factor, TIGR02 | 82.57 | |
| PRK14086 | 617 | dnaA chromosomal replication initiation protein; P | 82.52 | |
| PF01978 | 68 | TrmB: Sugar-specific transcriptional regulator Trm | 82.49 | |
| PRK09210 | 367 | RNA polymerase sigma factor RpoD; Validated | 82.27 | |
| PRK08241 | 339 | RNA polymerase factor sigma-70; Validated | 82.26 | |
| PRK06288 | 268 | RNA polymerase sigma factor WhiG; Reviewed | 82.24 | |
| PRK09640 | 188 | RNA polymerase sigma factor SigX; Reviewed | 82.14 | |
| PRK05949 | 327 | RNA polymerase sigma factor; Validated | 81.85 | |
| smart00419 | 48 | HTH_CRP helix_turn_helix, cAMP Regulatory protein. | 81.58 | |
| PF10668 | 60 | Phage_terminase: Phage terminase small subunit; In | 81.53 | |
| smart00418 | 66 | HTH_ARSR helix_turn_helix, Arsenical Resistance Op | 81.53 | |
| PRK09651 | 172 | RNA polymerase sigma factor FecI; Provisional | 81.43 | |
| PF00165 | 42 | HTH_AraC: Bacterial regulatory helix-turn-helix pr | 81.24 | |
| PRK09647 | 203 | RNA polymerase sigma factor SigE; Reviewed | 81.24 | |
| PF05263 | 130 | DUF722: Protein of unknown function (DUF722); Inte | 81.16 | |
| PRK10402 | 226 | DNA-binding transcriptional activator YeiL; Provis | 81.11 | |
| PF04703 | 62 | FaeA: FaeA-like protein; PDB: 2JT1_A 2HTJ_A. | 81.01 | |
| PHA02591 | 83 | hypothetical protein; Provisional | 80.96 | |
| PF12840 | 61 | HTH_20: Helix-turn-helix domain; PDB: 1ULY_A 2CWE_ | 80.84 | |
| PF13404 | 42 | HTH_AsnC-type: AsnC-type helix-turn-helix domain; | 80.28 | |
| smart00347 | 101 | HTH_MARR helix_turn_helix multiple antibiotic resi | 80.23 |
| >PF13359 DDE_Tnp_4: DDE superfamily endonuclease | Back alignment and domain information |
|---|
Probab=100.00 E-value=1e-38 Score=256.56 Aligned_cols=152 Identities=43% Similarity=0.690 Sum_probs=139.6
Q ss_pred eeeeEEEecCCCC--CCccccccCCCccccceeeecCCCccEEEeccCCCCccccccccccchhhhhcc-ccccceEEEc
Q psy13113 92 IDGTHVPIELPSI--ENGEHYRNRKHFYSINVQVIGGPNLEIYDVVASWPGSTHDSRIFQNSRVYSRFD-RREIRGLLLG 168 (286)
Q Consensus 92 iDgt~i~i~~P~~--~~~~~y~~~k~~~s~~~q~vvd~~g~i~~~~~~~~Gs~~D~~~~~~s~l~~~l~-~~~~~~~llg 168 (286)
||||+|++++|.. .+...|+++|+.|++|+|++||++|+|++++.++||++||..+|++|++...++ ..+.++++||
T Consensus 1 iDgt~v~i~~P~~~~~~~~~y~~~k~~~~~~~q~v~d~~g~i~~v~~~~~Gs~~D~~i~~~s~~~~~l~~~~~~~~~~l~ 80 (158)
T PF13359_consen 1 IDGTHVPIQRPSDKEEQREFYSGKKKNHSLKVQIVCDPDGRIIYVSVGWPGSVHDSTIFRQSGLLDRLEQAFPPGEYLLG 80 (158)
T ss_pred CccEEEEEEeCCccccccccccCCCCcceEeEEEEEeccceeEeeecccccccccccccccccccceeecccccCccccc
Confidence 7999999999943 378899999999999999999999999999999999999999999999988876 2222789999
Q ss_pred cccCCCCCcccccccCC--CCCChhhHHhHHHHHHHHHHHHHHHHHHHhhhhhhhccccCC-ccchHHHHHHHHHHHh
Q psy13113 169 DIGYAQNEFTFTPVRNP--ITPTPSQVAYNAAQIRTRNSVERLFGVLKRRFACLRKKLANQ-PTTCSHIITACAVLHN 243 (286)
Q Consensus 169 D~gY~~~~~l~~p~~~~--~~l~~~~~~~N~~~~~~R~~vE~~~~~lK~rf~~L~~~~~~~-~~~~~~ii~a~~~LhN 243 (286)
|+||++.+++++|++++ ..++++|+.||+.+++.|++||++||+||+||++|..+++.+ +..+.++|.+||+|||
T Consensus 81 D~gy~~~~~~~~P~~~~~~~~l~~~e~~~N~~~s~~R~~vE~~~~~lK~rf~~l~~~~~~~~~~~~~~ii~~~~~LhN 158 (158)
T PF13359_consen 81 DSGYPLSPYLLTPYKKPKGRELTPEEKEFNRRHSSARIIVERAFGRLKSRFRILRGRLRLSRPEKAPQIILACCVLHN 158 (158)
T ss_pred cccccccccccccccccccccccccccchhccccceeeeeHHHHHHHHHhcccCCcccCCCcHhHHHHHHheeEEEEC
Confidence 99999999999999843 348899999999999999999999999999999999899998 9999999999999999
|
|
| >KOG4585|consensus | Back alignment and domain information |
|---|
| >PF04827 Plant_tran: Plant transposon protein; InterPro: IPR006912 This entry represents a putative Harbinger transposase-derived nuclease, which is thought to have nuclease activity | Back alignment and domain information |
|---|
| >PF13613 HTH_Tnp_4: Helix-turn-helix of DDE superfamily endonuclease | Back alignment and domain information |
|---|
| >PF13612 DDE_Tnp_1_3: Transposase DDE domain | Back alignment and domain information |
|---|
| >PF01609 DDE_Tnp_1: Transposase DDE domain; InterPro: IPR002559 Autonomous mobile genetic elements such as transposon or insertion sequences (IS) encode an enzyme, transposase, that is required for excising and inserting the mobile element | Back alignment and domain information |
|---|
| >PF13586 DDE_Tnp_1_2: Transposase DDE domain | Back alignment and domain information |
|---|
| >PF02796 HTH_7: Helix-turn-helix domain of resolvase; InterPro: IPR006120 Site-specific recombination plays an important role in DNA rearrangement in prokaryotic organisms | Back alignment and domain information |
|---|
| >PF04545 Sigma70_r4: Sigma-70, region 4; InterPro: IPR007630 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription | Back alignment and domain information |
|---|
| >PF13936 HTH_38: Helix-turn-helix domain; PDB: 2W48_A | Back alignment and domain information |
|---|
| >PF13011 LZ_Tnp_IS481: leucine-zipper of insertion element IS481 | Back alignment and domain information |
|---|
| >PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere | Back alignment and domain information |
|---|
| >PF13384 HTH_23: Homeodomain-like domain; PDB: 2X48_C | Back alignment and domain information |
|---|
| >PF13518 HTH_28: Helix-turn-helix domain | Back alignment and domain information |
|---|
| >smart00351 PAX Paired Box domain | Back alignment and domain information |
|---|
| >PF05225 HTH_psq: helix-turn-helix, Psq domain; InterPro: IPR007889 This DNA-binding motif is found in four copies in the pipsqueak protein of Drosophila melanogaster [] | Back alignment and domain information |
|---|
| >cd00569 HTH_Hin_like Helix-turn-helix domain of Hin and related proteins, a family of DNA-binding domains unique to bacteria and represented by the Hin protein of Salmonella | Back alignment and domain information |
|---|
| >PF08281 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013249 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription | Back alignment and domain information |
|---|
| >PRK09413 IS2 repressor TnpA; Reviewed | Back alignment and domain information |
|---|
| >PF01527 HTH_Tnp_1: Transposase; InterPro: IPR002514 Transposase proteins are necessary for efficient DNA transposition | Back alignment and domain information |
|---|
| >cd00131 PAX Paired Box domain | Back alignment and domain information |
|---|
| >cd06571 Bac_DnaA_C C-terminal domain of bacterial DnaA proteins | Back alignment and domain information |
|---|
| >PF13340 DUF4096: Putative transposase of IS4/5 family (DUF4096) | Back alignment and domain information |
|---|
| >smart00421 HTH_LUXR helix_turn_helix, Lux Regulon | Back alignment and domain information |
|---|
| >COG3415 Transposase and inactivated derivatives [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >cd06171 Sigma70_r4 Sigma70, region (SR) 4 refers to the most C-terminal of four conserved domains found in Escherichia coli (Ec) sigma70, the main housekeeping sigma, and related sigma-factors (SFs) | Back alignment and domain information |
|---|
| >PF12116 SpoIIID: Stage III sporulation protein D; InterPro: IPR014208 Members of this entry represent the transcriptional regulator SpoIIID, or stage III sporulation protein D | Back alignment and domain information |
|---|
| >PRK00118 putative DNA-binding protein; Validated | Back alignment and domain information |
|---|
| >PF13542 HTH_Tnp_ISL3: Helix-turn-helix domain of transposase family ISL3 | Back alignment and domain information |
|---|
| >PRK04217 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK09639 RNA polymerase sigma factor SigX; Provisional | Back alignment and domain information |
|---|
| >PRK12529 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >cd06170 LuxR_C_like C-terminal DNA-binding domain of LuxR-like proteins | Back alignment and domain information |
|---|
| >TIGR03879 near_KaiC_dom probable regulatory domain | Back alignment and domain information |
|---|
| >TIGR02531 yecD_yerC TrpR-related protein YerC/YecD | Back alignment and domain information |
|---|
| >PRK06030 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK09652 RNA polymerase sigma factor RpoE; Provisional | Back alignment and domain information |
|---|
| >TIGR02844 spore_III_D sporulation transcriptional regulator SpoIIID | Back alignment and domain information |
|---|
| >PHA00675 hypothetical protein | Back alignment and domain information |
|---|
| >PRK08301 sporulation sigma factor SigE; Reviewed | Back alignment and domain information |
|---|
| >PRK05911 RNA polymerase sigma factor sigma-28; Reviewed | Back alignment and domain information |
|---|
| >PF04967 HTH_10: HTH DNA binding domain; InterPro: IPR007050 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif | Back alignment and domain information |
|---|
| >TIGR02985 Sig70_bacteroi1 RNA polymerase sigma-70 factor, Bacteroides expansion family 1 | Back alignment and domain information |
|---|
| >PRK03975 tfx putative transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >TIGR00721 tfx DNA-binding protein, Tfx family | Back alignment and domain information |
|---|
| >PHA00542 putative Cro-like protein | Back alignment and domain information |
|---|
| >PF13412 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 1I1G_B 2IA0_B 3I4P_A 2GQQ_A 2L4A_A 2CFX_B 2DBB_B 2EFO_A 2EFQ_A 2PN6_A | Back alignment and domain information |
|---|
| >TIGR02952 Sig70_famx2 RNA polymerase sigma-70 factor, TIGR02952 family | Back alignment and domain information |
|---|
| >PF07374 DUF1492: Protein of unknown function (DUF1492); InterPro: IPR010861 This entry is represented by Streptococcus phage 7201, Orf19 | Back alignment and domain information |
|---|
| >PRK07037 extracytoplasmic-function sigma-70 factor; Validated | Back alignment and domain information |
|---|
| >TIGR02960 SigX5 RNA polymerase sigma-70 factor, TIGR02960 family | Back alignment and domain information |
|---|
| >PRK09641 RNA polymerase sigma factor SigW; Provisional | Back alignment and domain information |
|---|
| >PF01325 Fe_dep_repress: Iron dependent repressor, N-terminal DNA binding domain; InterPro: IPR022687 The DtxR-type HTH domain is a DNA-binding, winged helix-turn-helix (wHTH) domain of about 65 residues present in metalloregulators of the DtxR/MntR family | Back alignment and domain information |
|---|
| >TIGR02937 sigma70-ECF RNA polymerase sigma factor, sigma-70 family | Back alignment and domain information |
|---|
| >PRK09638 RNA polymerase sigma factor SigY; Reviewed | Back alignment and domain information |
|---|
| >PRK12547 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK15320 transcriptional activator SprB; Provisional | Back alignment and domain information |
|---|
| >TIGR02989 Sig-70_gvs1 RNA polymerase sigma-70 factor, Rhodopirellula/Verrucomicrobium family | Back alignment and domain information |
|---|
| >PRK12514 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK12511 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK12519 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >TIGR01321 TrpR trp operon repressor, proteobacterial | Back alignment and domain information |
|---|
| >PF12802 MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP4_B 3KP2_A 3KP5_A 3KP3_B 3KP7_A 3NQO_B 3K0L_B | Back alignment and domain information |
|---|
| >PRK12524 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK12530 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PF01022 HTH_5: Bacterial regulatory protein, arsR family; InterPro: IPR001845 Bacterial transcription regulatory proteins that bind DNA via a helix-turn-helix (HTH) motif can be grouped into families on the basis of sequence similarities | Back alignment and domain information |
|---|
| >PF13730 HTH_36: Helix-turn-helix domain | Back alignment and domain information |
|---|
| >PF00356 LacI: Bacterial regulatory proteins, lacI family; InterPro: IPR000843 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif | Back alignment and domain information |
|---|
| >PF01047 MarR: MarR family; InterPro: IPR000835 The MarR-type HTH domain is a DNA-binding, winged helix-turn-helix (wHTH) domain of about 135 amino acids present in transcription regulators of the MarR/SlyA family, involved in the development of antibiotic resistance | Back alignment and domain information |
|---|
| >PRK12515 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK05803 sporulation sigma factor SigK; Reviewed | Back alignment and domain information |
|---|
| >PRK09415 RNA polymerase factor sigma C; Reviewed | Back alignment and domain information |
|---|
| >PRK12533 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PF08279 HTH_11: HTH domain; InterPro: IPR013196 Winged helix DNA-binding proteins share a related winged helix-turn-helix DNA-binding motif, where the "wings", or loops, are small beta-sheets | Back alignment and domain information |
|---|
| >PF13551 HTH_29: Winged helix-turn helix | Back alignment and domain information |
|---|
| >COG2963 Transposase and inactivated derivatives [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK12537 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK12531 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK15418 transcriptional regulator LsrR; Provisional | Back alignment and domain information |
|---|
| >TIGR02392 rpoH_proteo alternative sigma factor RpoH | Back alignment and domain information |
|---|
| >PRK12512 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK12516 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >TIGR02939 RpoE_Sigma70 RNA polymerase sigma factor RpoE | Back alignment and domain information |
|---|
| >PRK09047 RNA polymerase factor sigma-70; Validated | Back alignment and domain information |
|---|
| >PRK11924 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK05602 RNA polymerase sigma factor; Reviewed | Back alignment and domain information |
|---|
| >PRK12534 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >TIGR02948 SigW_bacill RNA polymerase sigma-W factor | Back alignment and domain information |
|---|
| >PRK09643 RNA polymerase sigma factor SigM; Reviewed | Back alignment and domain information |
|---|
| >PF00196 GerE: Bacterial regulatory proteins, luxR family; InterPro: IPR000792 This domain is a DNA-binding, helix-turn-helix (HTH) domain of about 65 amino acids, present in transcription regulators of the LuxR/FixJ family of response regulators | Back alignment and domain information |
|---|
| >TIGR02950 SigM_subfam RNA polymerase sigma factor, SigM family | Back alignment and domain information |
|---|
| >PRK11923 algU RNA polymerase sigma factor AlgU; Provisional | Back alignment and domain information |
|---|
| >PRK06596 RNA polymerase factor sigma-32; Reviewed | Back alignment and domain information |
|---|
| >PRK07408 RNA polymerase sigma factor SigF; Reviewed | Back alignment and domain information |
|---|
| >TIGR02983 SigE-fam_strep RNA polymerase sigma-70 factor, sigma-E family | Back alignment and domain information |
|---|
| >TIGR03001 Sig-70_gmx1 RNA polymerase sigma-70 factor, Myxococcales family 1 | Back alignment and domain information |
|---|
| >PRK12546 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >cd00092 HTH_CRP helix_turn_helix, cAMP Regulatory protein C-terminus; DNA binding domain of prokaryotic regulatory proteins belonging to the catabolite activator protein family | Back alignment and domain information |
|---|
| >TIGR02984 Sig-70_plancto1 RNA polymerase sigma-70 factor, Planctomycetaceae-specific subfamily 1 | Back alignment and domain information |
|---|
| >TIGR02980 SigBFG RNA polymerase sigma-70 factor, sigma-B/F/G subfamily | Back alignment and domain information |
|---|
| >PRK05572 sporulation sigma factor SigF; Validated | Back alignment and domain information |
|---|
| >PF08299 Bac_DnaA_C: Bacterial dnaA protein helix-turn-helix; InterPro: IPR013159 This entry represents the C-terminal domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >PRK06811 RNA polymerase factor sigma-70; Validated | Back alignment and domain information |
|---|
| >PRK12540 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >TIGR02954 Sig70_famx3 RNA polymerase sigma-70 factor, TIGR02954 family | Back alignment and domain information |
|---|
| >TIGR02393 RpoD_Cterm RNA polymerase sigma factor RpoD, C-terminal domain | Back alignment and domain information |
|---|
| >PRK12532 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >TIGR01636 phage_rinA phage transcriptional activator, RinA family | Back alignment and domain information |
|---|
| >TIGR02835 spore_sigmaE RNA polymerase sigma-E factor | Back alignment and domain information |
|---|
| >PF01710 HTH_Tnp_IS630: Transposase; InterPro: IPR002622 Transposase proteins are necessary for efficient DNA transposition | Back alignment and domain information |
|---|
| >PRK06759 RNA polymerase factor sigma-70; Validated | Back alignment and domain information |
|---|
| >PRK06704 RNA polymerase factor sigma-70; Validated | Back alignment and domain information |
|---|
| >PRK12544 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK08583 RNA polymerase sigma factor SigB; Validated | Back alignment and domain information |
|---|
| >TIGR02885 spore_sigF RNA polymerase sigma-F factor | Back alignment and domain information |
|---|
| >PRK08215 sporulation sigma factor SigG; Reviewed | Back alignment and domain information |
|---|
| >PRK12523 RNA polymerase sigma factor; Reviewed | Back alignment and domain information |
|---|
| >PRK07500 rpoH2 RNA polymerase factor sigma-32; Reviewed | Back alignment and domain information |
|---|
| >TIGR02957 SigX4 RNA polymerase sigma-70 factor, TIGR02957 family | Back alignment and domain information |
|---|
| >PRK12539 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK12528 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK09645 RNA polymerase sigma factor SigL; Provisional | Back alignment and domain information |
|---|
| >PF01371 Trp_repressor: Trp repressor protein; InterPro: IPR000831 The Trp repressor (TrpR) binds to at least five operators in the Escherichia coli genome, repressing gene expression | Back alignment and domain information |
|---|
| >PRK12520 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >TIGR02999 Sig-70_X6 RNA polymerase sigma factor, TIGR02999 family | Back alignment and domain information |
|---|
| >COG2739 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >TIGR02943 Sig70_famx1 RNA polymerase sigma-70 factor, TIGR02943 family | Back alignment and domain information |
|---|
| >TIGR02850 spore_sigG RNA polymerase sigma-G factor | Back alignment and domain information |
|---|
| >TIGR02846 spore_sigmaK RNA polymerase sigma-K factor | Back alignment and domain information |
|---|
| >PRK09637 RNA polymerase sigma factor SigZ; Provisional | Back alignment and domain information |
|---|
| >PRK06930 positive control sigma-like factor; Validated | Back alignment and domain information |
|---|
| >PRK12522 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >TIGR02394 rpoS_proteo RNA polymerase sigma factor RpoS | Back alignment and domain information |
|---|
| >PRK06986 fliA flagellar biosynthesis sigma factor; Validated | Back alignment and domain information |
|---|
| >PRK09636 RNA polymerase sigma factor SigJ; Provisional | Back alignment and domain information |
|---|
| >PF05344 DUF746: Domain of Unknown Function (DUF746); InterPro: IPR008008 This is a short conserved region found in some transposons | Back alignment and domain information |
|---|
| >PRK12525 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PF09339 HTH_IclR: IclR helix-turn-helix domain; InterPro: IPR005471 The many bacterial transcription regulation proteins which bind DNA through a 'helix-turn-helix' motif can be classified into subfamilies on the basis of sequence similarities | Back alignment and domain information |
|---|
| >PRK07405 RNA polymerase sigma factor SigD; Validated | Back alignment and domain information |
|---|
| >COG3293 Transposase and inactivated derivatives [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG1595 RpoE DNA-directed RNA polymerase specialized sigma subunit, sigma24 homolog [Transcription] | Back alignment and domain information |
|---|
| >PRK07670 RNA polymerase sigma factor SigD; Validated | Back alignment and domain information |
|---|
| >PF00126 HTH_1: Bacterial regulatory helix-turn-helix protein, lysR family; InterPro: IPR000847 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif | Back alignment and domain information |
|---|
| >COG1191 FliA DNA-directed RNA polymerase specialized sigma subunit [Transcription] | Back alignment and domain information |
|---|
| >PRK09642 RNA polymerase sigma factor SigW; Reviewed | Back alignment and domain information |
|---|
| >PF04297 UPF0122: Putative helix-turn-helix protein, YlxM / p13 like; InterPro: IPR007394 Members of this family are predicted to contain a helix-turn-helix motif, for example residues 37-55 in Mycoplasma mycoides p13 (O05290 from SWISSPROT) | Back alignment and domain information |
|---|
| >PRK09648 RNA polymerase sigma factor SigD; Reviewed | Back alignment and domain information |
|---|
| >TIGR02941 Sigma_B RNA polymerase sigma-B factor | Back alignment and domain information |
|---|
| >smart00346 HTH_ICLR helix_turn_helix isocitrate lyase regulation | Back alignment and domain information |
|---|
| >PRK13919 putative RNA polymerase sigma E protein; Provisional | Back alignment and domain information |
|---|
| >PRK09649 RNA polymerase sigma factor SigC; Reviewed | Back alignment and domain information |
|---|
| >PF13545 HTH_Crp_2: Crp-like helix-turn-helix domain; PDB: 3LA2_A 3LA3_B 3LA7_A 3B02_A 3E97_A 2H6C_B 1OMI_A 2BGC_H 2BEO_A 2GAU_A | Back alignment and domain information |
|---|
| >PRK12527 RNA polymerase sigma factor; Reviewed | Back alignment and domain information |
|---|
| >PRK08295 RNA polymerase factor sigma-70; Validated | Back alignment and domain information |
|---|
| >PRK07122 RNA polymerase sigma factor SigF; Reviewed | Back alignment and domain information |
|---|
| >PRK12542 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK12536 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PF00325 Crp: Bacterial regulatory proteins, crp family; InterPro: IPR001808 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif | Back alignment and domain information |
|---|
| >TIGR02479 FliA_WhiG RNA polymerase sigma factor, FliA/WhiG family | Back alignment and domain information |
|---|
| >PF09862 DUF2089: Protein of unknown function (DUF2089); InterPro: IPR018658 This family consists of various hypothetical prokaryotic proteins | Back alignment and domain information |
|---|
| >PRK09635 sigI RNA polymerase sigma factor SigI; Provisional | Back alignment and domain information |
|---|
| >smart00550 Zalpha Z-DNA-binding domain in adenosine deaminases | Back alignment and domain information |
|---|
| >PRK12541 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK12543 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK09644 RNA polymerase sigma factor SigM; Provisional | Back alignment and domain information |
|---|
| >PF13751 DDE_Tnp_1_6: Transposase DDE domain | Back alignment and domain information |
|---|
| >PF13560 HTH_31: Helix-turn-helix domain; PDB: 3F51_C 3F52_A 3PXP_A 2OFY_A | Back alignment and domain information |
|---|
| >COG2390 DeoR Transcriptional regulator, contains sigma factor-related N-terminal domain [Transcription] | Back alignment and domain information |
|---|
| >PF09607 BrkDBD: Brinker DNA-binding domain; InterPro: IPR018586 This DNA-binding domain is the first approx | Back alignment and domain information |
|---|
| >PRK12535 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK12526 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PF13610 DDE_Tnp_IS240: DDE domain | Back alignment and domain information |
|---|
| >PRK05657 RNA polymerase sigma factor RpoS; Validated | Back alignment and domain information |
|---|
| >PRK12545 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK11922 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >TIGR02959 SigZ RNA polymerase sigma factor, SigZ family | Back alignment and domain information |
|---|
| >TIGR03697 NtcA_cyano global nitrogen regulator NtcA, cyanobacterial | Back alignment and domain information |
|---|
| >PRK12517 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK15201 fimbriae regulatory protein FimW; Provisional | Back alignment and domain information |
|---|
| >PRK07406 RNA polymerase sigma factor RpoD; Validated | Back alignment and domain information |
|---|
| >TIGR01610 phage_O_Nterm phage replication protein O, N-terminal domain | Back alignment and domain information |
|---|
| >PRK03573 transcriptional regulator SlyA; Provisional | Back alignment and domain information |
|---|
| >cd00090 HTH_ARSR Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors | Back alignment and domain information |
|---|
| >PF01381 HTH_3: Helix-turn-helix; InterPro: IPR001387 This is large family of DNA binding helix-turn helix proteins that include a bacterial plasmid copy control protein, bacterial methylases, various bacteriophage transcription control proteins and a vegetative specific protein from Dictyostelium discoideum (Slime mould) | Back alignment and domain information |
|---|
| >PRK12427 flagellar biosynthesis sigma factor; Provisional | Back alignment and domain information |
|---|
| >PF13463 HTH_27: Winged helix DNA-binding domain; PDB: 3GFL_A 2YR2_B 3GFM_A 3GFJ_A 3GF2_A 3GEZ_A 2GXG_A 3GFI_A 2EB7_A | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >PRK07598 RNA polymerase sigma factor SigC; Validated | Back alignment and domain information |
|---|
| >PRK09646 RNA polymerase sigma factor SigK; Reviewed | Back alignment and domain information |
|---|
| >TIGR02859 spore_sigH RNA polymerase sigma-H factor | Back alignment and domain information |
|---|
| >PRK12538 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PF06056 Terminase_5: Putative ATPase subunit of terminase (gpP-like); InterPro: IPR010332 This family of proteins are annotated as ATPase subunits of phage terminase after [] | Back alignment and domain information |
|---|
| >PRK11512 DNA-binding transcriptional repressor MarR; Provisional | Back alignment and domain information |
|---|
| >smart00345 HTH_GNTR helix_turn_helix gluconate operon transcriptional repressor | Back alignment and domain information |
|---|
| >PF07638 Sigma70_ECF: ECF sigma factor | Back alignment and domain information |
|---|
| >PRK13870 transcriptional regulator TraR; Provisional | Back alignment and domain information |
|---|
| >PRK11753 DNA-binding transcriptional dual regulator Crp; Provisional | Back alignment and domain information |
|---|
| >PF00872 Transposase_mut: Transposase, Mutator family; InterPro: IPR001207 Autonomous mobile genetic elements such as transposon or insertion sequences (IS) encode an enzyme, transposase, that is required for excising and inserting the mobile element | Back alignment and domain information |
|---|
| >PRK15411 rcsA colanic acid capsular biosynthesis activation protein A; Provisional | Back alignment and domain information |
|---|
| >TIGR02947 SigH_actino RNA polymerase sigma-70 factor, TIGR02947 family | Back alignment and domain information |
|---|
| >PRK14086 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PF01978 TrmB: Sugar-specific transcriptional regulator TrmB; InterPro: IPR002831 TrmB, is a protein of 38,800 apparent molecular weight, that is involved in the maltose-specific regulation of the trehalose/maltose ABC transport operon in Thermococcus litoralis | Back alignment and domain information |
|---|
| >PRK09210 RNA polymerase sigma factor RpoD; Validated | Back alignment and domain information |
|---|
| >PRK08241 RNA polymerase factor sigma-70; Validated | Back alignment and domain information |
|---|
| >PRK06288 RNA polymerase sigma factor WhiG; Reviewed | Back alignment and domain information |
|---|
| >PRK09640 RNA polymerase sigma factor SigX; Reviewed | Back alignment and domain information |
|---|
| >PRK05949 RNA polymerase sigma factor; Validated | Back alignment and domain information |
|---|
| >smart00419 HTH_CRP helix_turn_helix, cAMP Regulatory protein | Back alignment and domain information |
|---|
| >PF10668 Phage_terminase: Phage terminase small subunit; InterPro: IPR018925 This entry describes the terminase small subunit from Enterococcus phage phiFL1A, related proteins in other bacteriophage, and prophage regions of bacterial genomes | Back alignment and domain information |
|---|
| >smart00418 HTH_ARSR helix_turn_helix, Arsenical Resistance Operon Repressor | Back alignment and domain information |
|---|
| >PRK09651 RNA polymerase sigma factor FecI; Provisional | Back alignment and domain information |
|---|
| >PF00165 HTH_AraC: Bacterial regulatory helix-turn-helix proteins, AraC family; PDB: 1WPK_A 1ZGW_A 1U8B_A | Back alignment and domain information |
|---|
| >PRK09647 RNA polymerase sigma factor SigE; Reviewed | Back alignment and domain information |
|---|
| >PF05263 DUF722: Protein of unknown function (DUF722); InterPro: IPR007927 This entry is represented by Bacteriophage bIL285, Orf38 | Back alignment and domain information |
|---|
| >PRK10402 DNA-binding transcriptional activator YeiL; Provisional | Back alignment and domain information |
|---|
| >PF04703 FaeA: FaeA-like protein; PDB: 2JT1_A 2HTJ_A | Back alignment and domain information |
|---|
| >PHA02591 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF12840 HTH_20: Helix-turn-helix domain; PDB: 1ULY_A 2CWE_A 1Y0U_B 2QUF_B 2QLZ_C 2OQG_B 2ZKZ_C 3PQK_A 3PQJ_D 3F6O_B | Back alignment and domain information |
|---|
| >PF13404 HTH_AsnC-type: AsnC-type helix-turn-helix domain; PDB: 2ZNY_E 2ZNZ_G 1RI7_A 2CYY_A 2E1C_A 2VC1_B 2QZ8_A 2W29_C 2IVM_B 2VBX_B | Back alignment and domain information |
|---|
| >smart00347 HTH_MARR helix_turn_helix multiple antibiotic resistance protein | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 286 | |||
| 1tc3_C | 51 | Protein (TC3 transposase); DNA binding, helix-turn | 97.18 | |
| 2glo_A | 59 | Brinker CG9653-PA; protein-DNA complex, helix-turn | 97.07 | |
| 1jko_C | 52 | HIN recombinase, DNA-invertase HIN; water-mediated | 96.3 | |
| 2jn6_A | 97 | Protein CGL2762, transposase; GFT PSI-2, protein s | 96.27 | |
| 1tty_A | 87 | Sigma-A, RNA polymerase sigma factor RPOD; helix-t | 95.85 | |
| 1ku3_A | 73 | Sigma factor SIGA; helix-turn-helix, transcription | 95.85 | |
| 2jrt_A | 95 | Uncharacterized protein; solution, structure, NESG | 95.85 | |
| 2p7v_B | 68 | Sigma-70, RNA polymerase sigma factor RPOD; RSD, r | 95.75 | |
| 2elh_A | 87 | CG11849-PA, LD40883P; structural genomics, NPPSFA, | 95.73 | |
| 2o8x_A | 70 | Probable RNA polymerase sigma-C factor; promoter r | 95.62 | |
| 3hug_A | 92 | RNA polymerase sigma factor; ECF sigma factor, zin | 95.24 | |
| 3t72_q | 99 | RNA polymerase sigma factor RPOD, DNA-directed RN | 95.06 | |
| 2x48_A | 55 | CAG38821; archeal virus, viral protein; 2.60A {Sul | 94.97 | |
| 1u78_A | 141 | TC3 transposase, transposable element TC3 transpos | 94.94 | |
| 1fse_A | 74 | GERE; helix-turn-helix DNA-binding protein transcr | 94.74 | |
| 1k78_A | 149 | Paired box protein PAX5; paired domain, ETS domain | 94.7 | |
| 2rn7_A | 108 | IS629 ORFA; helix, all alpha, unknown function, st | 94.69 | |
| 1hlv_A | 131 | CENP-B, major centromere autoantigen B; helix-turn | 94.63 | |
| 1jhg_A | 101 | Trp operon repressor; complex (regulatory protein- | 94.48 | |
| 1pdn_C | 128 | Protein (PRD paired); protein-DNA complex, double | 94.39 | |
| 3c57_A | 95 | Two component transcriptional regulatory protein; | 94.23 | |
| 1je8_A | 82 | Nitrate/nitrite response regulator protein NARL; p | 94.1 | |
| 1j1v_A | 94 | Chromosomal replication initiator protein DNAA, 5' | 94.06 | |
| 1p4w_A | 99 | RCSB; solution structure, DNA binding domain, DNA | 94.04 | |
| 1s7o_A | 113 | Hypothetical UPF0122 protein SPY1201/SPYM3_0842/SP | 93.9 | |
| 2jpc_A | 61 | SSRB; DNA binding protein, structural genomics, PS | 93.43 | |
| 2w7n_A | 101 | TRFB transcriptional repressor protein; INCP, plas | 93.4 | |
| 1x3u_A | 79 | Transcriptional regulatory protein FIXJ; helix-tur | 93.1 | |
| 3ulq_B | 90 | Transcriptional regulatory protein COMA; tetratric | 93.0 | |
| 1or7_A | 194 | Sigma-24, RNA polymerase sigma-E factor; regulatio | 92.85 | |
| 2k27_A | 159 | Paired box protein PAX-8; paired domain, solution | 92.71 | |
| 1iuf_A | 144 | Centromere ABP1 protein; riken structural genomics | 92.71 | |
| 2rnj_A | 91 | Response regulator protein VRAR; HTH LUXR-type dom | 92.64 | |
| 1rp3_A | 239 | RNA polymerase sigma factor sigma-28 (FLIA); trans | 92.6 | |
| 1xsv_A | 113 | Hypothetical UPF0122 protein SAV1236; helix-turn-h | 92.27 | |
| 3pvv_A | 101 | Chromosomal replication initiator protein DNAA; he | 91.97 | |
| 2oa4_A | 101 | SIR5; structure, structural genomics, PSI-2, prote | 90.7 | |
| 3mzy_A | 164 | RNA polymerase sigma-H factor; PSI, MCSG, structur | 90.57 | |
| 4dyq_A | 140 | Gene 1 protein; GP1, octamer, DNA-binding, viral p | 90.52 | |
| 2q1z_A | 184 | RPOE, ECF SIGE; ECF sigma factor, cupin fold, zinc | 90.07 | |
| 2dk5_A | 91 | DNA-directed RNA polymerase III 39 kDa polypeptide | 89.87 | |
| 2cob_A | 70 | LCOR protein; MLR2, KIAA1795, helix-turn-helix, st | 89.69 | |
| 2d1h_A | 109 | ST1889, 109AA long hypothetical transcriptional re | 89.22 | |
| 1zx4_A | 192 | P1 PARB, plasmid partition PAR B protein, PARB; tr | 89.19 | |
| 1qgp_A | 77 | Protein (double stranded RNA adenosine deaminase); | 88.96 | |
| 2heo_A | 67 | Z-DNA binding protein 1; protein DLM1-Z-DNA comple | 88.69 | |
| 3frw_A | 107 | Putative Trp repressor protein; structural genomic | 88.59 | |
| 3mky_B | 189 | Protein SOPB; partition, F plasmid, centromere, DN | 88.4 | |
| 3kor_A | 119 | Possible Trp repressor; putative DNA-binding Trp r | 88.31 | |
| 1qbj_A | 81 | Protein (double-stranded RNA specific adenosine D | 88.21 | |
| 2l1p_A | 83 | DNA-binding protein SATB1; PSI-biology, NESG, stru | 87.95 | |
| 2ao9_A | 155 | Phage protein; structural genomics, nine-fold NCS. | 87.88 | |
| 2qvo_A | 95 | Uncharacterized protein AF_1382; PSI, structural g | 87.8 | |
| 1uxc_A | 65 | FRUR (1-57), fructose repressor; DNA-binding prote | 87.57 | |
| 2l0k_A | 93 | Stage III sporulation protein D; SPOIIID, solution | 87.08 | |
| 2cw1_A | 65 | SN4M; lambda CRO fold, de novo protein; NMR {Synth | 87.06 | |
| 2p5k_A | 64 | Arginine repressor; DNA-binding domain, winged hel | 87.02 | |
| 1oyi_A | 82 | Double-stranded RNA-binding protein; (alpha+beta) | 86.46 | |
| 3dv8_A | 220 | Transcriptional regulator, CRP/FNR family; cyclic | 86.44 | |
| 1y0u_A | 96 | Arsenical resistance operon repressor, putative; s | 86.42 | |
| 3ech_A | 142 | MEXR, multidrug resistance operon repressor; winge | 86.25 | |
| 2lfw_A | 157 | PHYR sigma-like domain; signal transduction, respo | 86.01 | |
| 2ia0_A | 171 | Putative HTH-type transcriptional regulator PF086; | 85.86 | |
| 2x4h_A | 139 | Hypothetical protein SSO2273; transcription; 2.30A | 85.81 | |
| 3r0a_A | 123 | Putative transcriptional regulator; structural gen | 85.78 | |
| 1sfx_A | 109 | Conserved hypothetical protein AF2008; structural | 85.77 | |
| 1xn7_A | 78 | Hypothetical protein YHGG; alpha+beta, GFT structu | 85.54 | |
| 2jt1_A | 77 | PEFI protein; solution structure, winged helix-tur | 85.43 | |
| 2pij_A | 67 | Prophage PFL 6 CRO; transcription factor, helix-tu | 85.41 | |
| 4aik_A | 151 | Transcriptional regulator SLYA; transcription, tra | 85.38 | |
| 4ham_A | 134 | LMO2241 protein; structural genomics, PSI-biology, | 85.17 | |
| 1l9z_H | 438 | Sigma factor SIGA; helix-turn-helix, coiled-coil, | 85.17 | |
| 2e1c_A | 171 | Putative HTH-type transcriptional regulator PH151; | 84.97 | |
| 2pg4_A | 95 | Uncharacterized protein; structural genomics, join | 84.65 | |
| 1r71_A | 178 | Transcriptional repressor protein KORB; INCP, plas | 84.63 | |
| 3ryp_A | 210 | Catabolite gene activator; CAMP receptor protein ( | 84.42 | |
| 2htj_A | 81 | P fimbrial regulatory protein KS71A; winged helix- | 84.17 | |
| 1on2_A | 142 | Transcriptional regulator MNTR; helix-turn-helix, | 84.16 | |
| 1tbx_A | 99 | ORF F-93, hypothetical 11.0 kDa protein; sulfolobu | 84.16 | |
| 2gxg_A | 146 | 146AA long hypothetical transcriptional regulator; | 84.11 | |
| 2rdp_A | 150 | Putative transcriptional regulator MARR; PFAM PF01 | 83.92 | |
| 3g3z_A | 145 | NMB1585, transcriptional regulator, MARR family; t | 83.79 | |
| 3bpv_A | 138 | Transcriptional regulator; MARR, DNA binding, tran | 83.69 | |
| 2fmy_A | 220 | COOA, carbon monoxide oxidation system transcripti | 83.67 | |
| 2nnn_A | 140 | Probable transcriptional regulator; structural gen | 83.65 | |
| 3b02_A | 195 | Transcriptional regulator, CRP family; structural | 83.65 | |
| 1jgs_A | 138 | Multiple antibiotic resistance protein MARR; trans | 83.53 | |
| 2oz6_A | 207 | Virulence factor regulator; winged helix, helix-tu | 83.51 | |
| 1ku9_A | 152 | Hypothetical protein MJ223; putative transcription | 83.4 | |
| 3clo_A | 258 | Transcriptional regulator; NP_811094.1, bacterial | 83.39 | |
| 1r1u_A | 106 | CZRA, repressor protein; zinc, DNA binding, transc | 83.38 | |
| 3bro_A | 141 | Transcriptional regulator; helix_TURN_helix, multi | 83.31 | |
| 3oop_A | 143 | LIN2960 protein; protein structure initiative, PSI | 83.29 | |
| 2lkp_A | 119 | Transcriptional regulator, ARSR family; symmetric | 83.24 | |
| 2zcw_A | 202 | TTHA1359, transcriptional regulator, FNR/CRP famil | 83.22 | |
| 2pex_A | 153 | Transcriptional regulator OHRR; transcription regu | 82.96 | |
| 2fbi_A | 142 | Probable transcriptional regulator; MARR, APC5816, | 82.85 | |
| 3iwz_A | 230 | CAP-like, catabolite activation-like protein; XCC, | 82.8 | |
| 3la7_A | 243 | Global nitrogen regulator; activator, DNA-binding, | 82.49 | |
| 3cuo_A | 99 | Uncharacterized HTH-type transcriptional regulato; | 82.42 | |
| 2a61_A | 145 | Transcriptional regulator TM0710; APC4350, MCSG, m | 82.4 | |
| 3nrv_A | 148 | Putative transcriptional regulator (MARR/EMRR FAM; | 82.39 | |
| 2l8n_A | 67 | Transcriptional repressor CYTR; bacterial gene rep | 82.32 | |
| 2fbh_A | 146 | Transcriptional regulator PA3341; MARR, transcript | 82.29 | |
| 2a6h_F | 423 | RNA polymerase sigma factor RPOD; RNA polymerase h | 82.26 | |
| 3k0l_A | 162 | Repressor protein; helix-turn-helix, structural ge | 82.23 | |
| 1l3l_A | 234 | Transcriptional activator protein TRAR; helix-turn | 82.21 | |
| 1z91_A | 147 | Organic hydroperoxide resistance transcriptional; | 82.13 | |
| 2q0o_A | 236 | Probable transcriptional activator protein TRAR; h | 82.11 | |
| 1u78_A | 141 | TC3 transposase, transposable element TC3 transpos | 81.87 | |
| 2frh_A | 127 | SARA, staphylococcal accessory regulator A; winged | 81.66 | |
| 4ev0_A | 216 | Transcription regulator, CRP family; CAMP binding, | 81.59 | |
| 2cyy_A | 151 | Putative HTH-type transcriptional regulator PH151; | 81.53 | |
| 3bdd_A | 142 | Regulatory protein MARR; putative multiple antibio | 81.49 | |
| 1zyb_A | 232 | Transcription regulator, CRP family; NP_813211.1, | 81.31 | |
| 2w48_A | 315 | Sorbitol operon regulator; SORC, activator, repres | 81.21 | |
| 1rzs_A | 61 | Antirepressor, regulatory protein CRO; helix-turn- | 81.17 | |
| 2fa5_A | 162 | Transcriptional regulator MARR/EMRR family; multip | 81.01 | |
| 2k02_A | 87 | Ferrous iron transport protein C; FEOC, iron-sulfu | 81.0 | |
| 2oqg_A | 114 | Possible transcriptional regulator, ARSR family P; | 80.68 | |
| 2ofy_A | 86 | Putative XRE-family transcriptional regulator; tra | 80.67 | |
| 3tgn_A | 146 | ADC operon repressor ADCR; helix-turn-helix, trans | 80.62 | |
| 2cfx_A | 144 | HTH-type transcriptional regulator LRPC; transcrip | 80.55 | |
| 3cjn_A | 162 | Transcriptional regulator, MARR family; silicibact | 80.4 | |
| 4hbl_A | 149 | Transcriptional regulator, MARR family; HTH, trans | 80.39 | |
| 1ft9_A | 222 | Carbon monoxide oxidation system transcription reg | 80.37 | |
| 2eth_A | 154 | Transcriptional regulator, putative, MAR family; M | 80.37 | |
| 1sfu_A | 75 | 34L protein; protein/Z-DNA complex, DNA binding pr | 80.19 | |
| 3szt_A | 237 | QCSR, quorum-sensing control repressor; quorum sen | 80.15 | |
| 2hin_A | 71 | GP39, repressor protein; transcription factor, dim | 80.14 | |
| 3eco_A | 139 | MEPR; mutlidrug efflux pump regulator winged helix | 80.12 | |
| 2w25_A | 150 | Probable transcriptional regulatory protein; trans | 80.09 | |
| 1i1g_A | 141 | Transcriptional regulator LRPA; helix-turn-helix, | 80.05 |
| >1tc3_C Protein (TC3 transposase); DNA binding, helix-turn-helix, TC1/mariner family, complex (transposase/DNA), DNA binding protein/DNA complex; HET: DNA; 2.45A {Caenorhabditis elegans} SCOP: a.4.1.2 | Back alignment and structure |
|---|
Probab=97.18 E-value=0.0009 Score=40.76 Aligned_cols=44 Identities=11% Similarity=-0.072 Sum_probs=35.8
Q ss_pred CCCCCCCHHHHHHHHHHHhhcCCChHhhhhhccccHhHHHHHHHH
Q psy13113 8 ARGVIHSPVVKLLAVLRFYATGNFQIDSEDYHDISQSTICRLVAK 52 (286)
Q Consensus 8 ~~~~~~~~~~~l~~~L~~L~~~~~~~~l~~~Fgvs~stv~~~~~~ 52 (286)
+|+..++.+++..+... +..|.+..++|..+|||.+||++++++
T Consensus 1 GR~~~l~~~~~~~i~~~-~~~g~s~~~IA~~lgis~~Tv~~~~~~ 44 (51)
T 1tc3_C 1 PRGSALSDTERAQLDVM-KLLNVSLHEMSRKISRSRHCIRVYLKD 44 (51)
T ss_dssp CCSCCCCHHHHHHHHHH-HHTTCCHHHHHHHHTCCHHHHHHHHHC
T ss_pred CCCCCCCHHHHHHHHHH-HHcCCCHHHHHHHHCcCHHHHHHHHhh
Confidence 45667888887666554 467899999999999999999998864
|
| >2glo_A Brinker CG9653-PA; protein-DNA complex, helix-turn-helix motif, transcription/DNA complex; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1jko_C HIN recombinase, DNA-invertase HIN; water-mediated recognition, protein-DNA complex, A10G mutant, DNA binding protein/DNA complex; 2.24A {Synthetic} SCOP: a.4.1.2 PDB: 1ijw_C* 1jj6_C* 1jj8_C* 1hcr_A 1jkp_C 1jkq_C 1jkr_C | Back alignment and structure |
|---|
| >2jn6_A Protein CGL2762, transposase; GFT PSI-2, protein structure, structural genomics, protein structure initiative; NMR {Corynebacterium glutamicum} SCOP: a.4.1.19 | Back alignment and structure |
|---|
| >1tty_A Sigma-A, RNA polymerase sigma factor RPOD; helix-turn-helix, transcription; NMR {Thermotoga maritima} SCOP: a.4.13.2 | Back alignment and structure |
|---|
| >1ku3_A Sigma factor SIGA; helix-turn-helix, transcription; 1.80A {Thermus aquaticus} SCOP: a.4.13.2 PDB: 1ku7_A 1rio_H 3n97_A* | Back alignment and structure |
|---|
| >2jrt_A Uncharacterized protein; solution, structure, NESG, PSI, target RHR5, structural genomics, protein structure initiative; NMR {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >2p7v_B Sigma-70, RNA polymerase sigma factor RPOD; RSD, regulator of sigma 70, sigma 70 domain 4, transcription, regulation, helix-turn-helix; 2.60A {Escherichia coli} SCOP: a.4.13.2 | Back alignment and structure |
|---|
| >2elh_A CG11849-PA, LD40883P; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2o8x_A Probable RNA polymerase sigma-C factor; promoter recognition, transcription regulation, helix-turn-H motif, transcription; 3.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3hug_A RNA polymerase sigma factor; ECF sigma factor, zinc binding anti-sigma factor, oxidative transcription regulation; 2.35A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3t72_q RNA polymerase sigma factor RPOD, DNA-directed RN polymerase subunit beta; winged-helix motif, transcription activation, DNA-binding; 4.33A {Escherichia coli} PDB: 1tlh_B | Back alignment and structure |
|---|
| >2x48_A CAG38821; archeal virus, viral protein; 2.60A {Sulfolobus islandicus rod-shaped virusorganism_taxid} | Back alignment and structure |
|---|
| >1u78_A TC3 transposase, transposable element TC3 transposase; transposon DNA, bipartite DNA-binding, HTH- motif, DNA binding protein/DNA complex; 2.69A {Caenorhabditis elegans} SCOP: a.4.1.2 a.4.1.2 | Back alignment and structure |
|---|
| >1fse_A GERE; helix-turn-helix DNA-binding protein transcriptional regulat transcription; 2.05A {Bacillus subtilis} SCOP: a.4.6.2 | Back alignment and structure |
|---|
| >1k78_A Paired box protein PAX5; paired domain, ETS domain, transcription factor, transcription/DNA complex; 2.25A {Homo sapiens} SCOP: a.4.1.5 a.4.1.5 PDB: 1mdm_A 6pax_A | Back alignment and structure |
|---|
| >2rn7_A IS629 ORFA; helix, all alpha, unknown function, structural genomics, PSI-2, protein structure initiative; NMR {Shigella flexneri} | Back alignment and structure |
|---|
| >1hlv_A CENP-B, major centromere autoantigen B; helix-turn-helix, protein-DNA complex, riken structural genomics/proteomics initiative, RSGI; 2.50A {Homo sapiens} SCOP: a.4.1.7 a.4.1.7 PDB: 1bw6_A | Back alignment and structure |
|---|
| >1jhg_A Trp operon repressor; complex (regulatory protein-peptide), DNA-binding regulatory complex (regulatory protein-peptide) complex; HET: TRP; 1.30A {Escherichia coli} SCOP: a.4.12.1 PDB: 1co0_A* 1mi7_R 1p6z_R 1wrp_R* 1zt9_A* 2oz9_R* 3ssw_R 3wrp_A 1rcs_A* 1wrs_R* 1wrt_R 2xdi_A 3ssx_R* 1trr_A* 1tro_A* | Back alignment and structure |
|---|
| >1pdn_C Protein (PRD paired); protein-DNA complex, double helix, PAX, paired domain, DNA-binding protein, gene regulation/DNA complex; HET: DNA; 2.50A {Drosophila melanogaster} SCOP: a.4.1.5 | Back alignment and structure |
|---|
| >3c57_A Two component transcriptional regulatory protein; response regulator, two-component regulatory system, DNA-BIN protein; 1.70A {Mycobacterium tuberculosis} PDB: 1zlk_A 1zlj_A | Back alignment and structure |
|---|
| >1je8_A Nitrate/nitrite response regulator protein NARL; protein-DNA complex, two-component response regulator, helix-turn-helix, DNA bending; 2.12A {Escherichia coli} SCOP: a.4.6.2 PDB: 1zg1_A 1zg5_A | Back alignment and structure |
|---|
| >1j1v_A Chromosomal replication initiator protein DNAA, 5'-D(*CP*CP*TP*GP*TP*GP*GP*AP*TP*AP*AP*CP*A)-3'; protein-DNA complex; 2.10A {Escherichia coli} SCOP: a.4.12.2 | Back alignment and structure |
|---|
| >1p4w_A RCSB; solution structure, DNA binding domain, DNA binding protein; NMR {Erwinia amylovora} SCOP: a.4.6.2 | Back alignment and structure |
|---|
| >1s7o_A Hypothetical UPF0122 protein SPY1201/SPYM3_0842/SPS1042/SPYM18_1152; putative DNA binding protein, structural genomics; 2.31A {Streptococcus pyogenes serotype M3} SCOP: a.4.13.3 | Back alignment and structure |
|---|
| >2jpc_A SSRB; DNA binding protein, structural genomics, PSI-2, protein structure initiative; NMR {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2w7n_A TRFB transcriptional repressor protein; INCP, plasmid, repressor, DNA-binding, transcription/DNA; HET: BRU; 1.85A {Escherichia coli} | Back alignment and structure |
|---|
| >1x3u_A Transcriptional regulatory protein FIXJ; helix-turn-helix; NMR {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3ulq_B Transcriptional regulatory protein COMA; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} PDB: 2krf_A | Back alignment and structure |
|---|
| >1or7_A Sigma-24, RNA polymerase sigma-E factor; regulation, DNA-binding, transmembrane, transcription; 2.00A {Escherichia coli} SCOP: a.4.13.2 a.177.1.1 PDB: 2h27_A | Back alignment and structure |
|---|
| >2k27_A Paired box protein PAX-8; paired domain, solution structure, triple frequency, 3D NMR, induced FIT, alternative splicing, developmental protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1iuf_A Centromere ABP1 protein; riken structural genomics/proteomics initiative, RSGI, structural genomics, DNA binding protein; NMR {Schizosaccharomyces pombe} SCOP: a.4.1.7 a.4.1.7 | Back alignment and structure |
|---|
| >2rnj_A Response regulator protein VRAR; HTH LUXR-type domain, DNA binding domain, activator, antibiotic resistance, cytoplasm, DNA-binding; NMR {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1rp3_A RNA polymerase sigma factor sigma-28 (FLIA); transcription; 2.30A {Aquifex aeolicus} SCOP: a.4.13.1 a.4.13.2 a.177.1.1 PDB: 1sc5_A | Back alignment and structure |
|---|
| >1xsv_A Hypothetical UPF0122 protein SAV1236; helix-turn-helix, putative DNA-binding protein, signal recognition particle, unknown function; 1.70A {Staphylococcus aureus subsp} SCOP: a.4.13.3 | Back alignment and structure |
|---|
| >3pvv_A Chromosomal replication initiator protein DNAA; helix-turn-helix motif, interacting with DNAA-BOX, DNAA-box; HET: DNA; 2.00A {Mycobacterium tuberculosis} PDB: 3pvp_A* | Back alignment and structure |
|---|
| >2oa4_A SIR5; structure, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Silicibacter pomeroyi} SCOP: a.4.12.3 | Back alignment and structure |
|---|
| >3mzy_A RNA polymerase sigma-H factor; PSI, MCSG, structural genomics, midwest center for structura genomics, protein structure initiative; 2.50A {Fusobacterium nucleatum subsp} | Back alignment and structure |
|---|
| >4dyq_A Gene 1 protein; GP1, octamer, DNA-binding, viral protein; 1.50A {Shigella phage SF6} PDB: 4dyc_A 4dyr_A 3hef_A 4dzj_A 4dzp_A | Back alignment and structure |
|---|
| >2dk5_A DNA-directed RNA polymerase III 39 kDa polypeptide; structural genomics, winged helix domain, NPPSFA; NMR {Homo sapiens} SCOP: a.4.5.85 | Back alignment and structure |
|---|
| >2cob_A LCOR protein; MLR2, KIAA1795, helix-turn-helix, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.15 | Back alignment and structure |
|---|
| >2d1h_A ST1889, 109AA long hypothetical transcriptional regulator; helix-turn-helix, intermolecular and intramolecular S-S bond structural genomics; 2.05A {Sulfolobus tokodaii} SCOP: a.4.5.50 | Back alignment and structure |
|---|
| >1zx4_A P1 PARB, plasmid partition PAR B protein, PARB; translation; HET: CIT; 2.98A {Enterobacteria phage P1} PDB: 2ntz_A | Back alignment and structure |
|---|
| >1qgp_A Protein (double stranded RNA adenosine deaminase); Z-alpha-Z-DNA binding domain, RNA-editing, Z-DNA recognition, ADAR1, helix- turn-helix; NMR {Homo sapiens} SCOP: a.4.5.19 | Back alignment and structure |
|---|
| >2heo_A Z-DNA binding protein 1; protein DLM1-Z-DNA complex, immune system-DNA complex; 1.70A {Mus musculus} PDB: 1j75_A | Back alignment and structure |
|---|
| >3frw_A Putative Trp repressor protein; structural genomics, APC21159, PSI-2, P structure initiative; 2.05A {Ruminococcus obeum atcc 29174} PDB: 3g1c_A | Back alignment and structure |
|---|
| >3mky_B Protein SOPB; partition, F plasmid, centromere, DNA binding protein- complex; HET: DNA; 2.86A {Escherichia coli} PDB: 3mkw_B* 3mkz_A* | Back alignment and structure |
|---|
| >3kor_A Possible Trp repressor; putative DNA-binding Trp repressor, TRPR like protein, struc genomics, transcription; 1.60A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1qbj_A Protein (double-stranded RNA specific adenosine D (ADAR1)); protein-Z-DNA complex, hydrolase-DNA complex; HET: DNA; 2.10A {Homo sapiens} SCOP: a.4.5.19 PDB: 3f21_A* 3f22_A* 3f23_A* 3irr_A* 3irq_D* 2gxb_A 2acj_A 2l54_A | Back alignment and structure |
|---|
| >2l1p_A DNA-binding protein SATB1; PSI-biology, NESG, structural genomics, protein structure in northeast structural genomics consortium; NMR {Homo sapiens} PDB: 3nzl_A* | Back alignment and structure |
|---|
| >2ao9_A Phage protein; structural genomics, nine-fold NCS., PSI, protein structure initiative, midwest center for structural genomics, MCSG, U function; 1.90A {Bacillus cereus} SCOP: a.4.1.17 | Back alignment and structure |
|---|
| >2qvo_A Uncharacterized protein AF_1382; PSI, structural genomics, southeast collaboratory for structural genomics; 1.85A {Archaeoglobus fulgidus dsm 4304} PDB: 3o3k_A 3ov8_A | Back alignment and structure |
|---|
| >1uxc_A FRUR (1-57), fructose repressor; DNA-binding protein, LACI family, transc regulation; NMR {Escherichia coli} SCOP: a.35.1.5 PDB: 1uxd_A | Back alignment and structure |
|---|
| >2l0k_A Stage III sporulation protein D; SPOIIID, solution structure, DNA binding, bacillus subti transcription factor, transcription; NMR {Bacillus subtilis} | Back alignment and structure |
|---|
| >2cw1_A SN4M; lambda CRO fold, de novo protein; NMR {Synthetic} SCOP: k.46.1.1 | Back alignment and structure |
|---|
| >2p5k_A Arginine repressor; DNA-binding domain, winged helix-turn-helix (WHTH), DNA binding protein; 1.00A {Bacillus subtilis} SCOP: a.4.5.3 PDB: 2p5l_C* | Back alignment and structure |
|---|
| >1oyi_A Double-stranded RNA-binding protein; (alpha+beta) helix-turn-helix, viral protein; NMR {Vaccinia virus} SCOP: a.4.5.19 | Back alignment and structure |
|---|
| >3dv8_A Transcriptional regulator, CRP/FNR family; cyclic nucleotide-binding domain, structural genomics, joint for structural genomics; 2.55A {Eubacterium rectale atcc 33656} | Back alignment and structure |
|---|
| >1y0u_A Arsenical resistance operon repressor, putative; structural genomics, protein structure initiative, PSI; HET: MSE; 1.60A {Archaeoglobus fulgidus} SCOP: a.4.5.5 | Back alignment and structure |
|---|
| >3ech_A MEXR, multidrug resistance operon repressor; winged helix, helix-turn-helix, protein-peptide complex; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.28 PDB: 1lnw_A 3mex_A | Back alignment and structure |
|---|
| >2lfw_A PHYR sigma-like domain; signal transduction, response regulator, sigma factor mimicr sigma factor, general stress response, signaling protein; NMR {Sphingomonas SP} | Back alignment and structure |
|---|
| >2ia0_A Putative HTH-type transcriptional regulator PF086; ASNC, PSI, structural genomics, southeast collaboratory for structural genomics; 2.37A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2x4h_A Hypothetical protein SSO2273; transcription; 2.30A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3r0a_A Putative transcriptional regulator; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.31A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >1sfx_A Conserved hypothetical protein AF2008; structural genomics, HTH MOT protein structure initiative, midwest center for structural genomics; 1.55A {Archaeoglobus fulgidus} SCOP: a.4.5.50 | Back alignment and structure |
|---|
| >1xn7_A Hypothetical protein YHGG; alpha+beta, GFT structural genomics, protein structure initiative, PSI, NESG; NMR {Escherichia coli} SCOP: a.4.5.62 | Back alignment and structure |
|---|
| >2jt1_A PEFI protein; solution structure, winged helix-turn-helix, transcripti regulatory protein, structural genomics, PSI-2; NMR {Salmonella typhimurium LT2} | Back alignment and structure |
|---|
| >2pij_A Prophage PFL 6 CRO; transcription factor, helix-turn-helix, structural evolution, transcription; 1.70A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >4aik_A Transcriptional regulator SLYA; transcription, transcription factor; 1.85A {Yersinia pseudotuberculosis} PDB: 4aih_A 4aij_A 3qpt_A* 3q5f_A* | Back alignment and structure |
|---|
| >4ham_A LMO2241 protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, winged helix-turn-helix, four helix bundle; 1.91A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1l9z_H Sigma factor SIGA; helix-turn-helix, coiled-coil, transcription/DNA complex; 6.50A {Thermus aquaticus} SCOP: i.8.1.1 | Back alignment and structure |
|---|
| >2pg4_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, DNA binding protein; HET: MSE CIT; 2.21A {Aeropyrum pernix} SCOP: a.4.5.48 | Back alignment and structure |
|---|
| >1r71_A Transcriptional repressor protein KORB; INCP, plasmid partitioning, protein-DNA complex, heilx-turn- helix motif, transcription factor; HET: BRU; 2.20A {Escherichia coli} SCOP: a.4.14.1 | Back alignment and structure |
|---|
| >3ryp_A Catabolite gene activator; CAMP receptor protein (CRP), allostery, DNA binding cyclic A transcription regulator; HET: CMP; 1.60A {Escherichia coli} PDB: 2cgp_A* 3hif_A 1g6n_A* 3ryr_A* 1i5z_A* 1j59_A* 1lb2_A* 1run_A* 1zrc_A* 1zrd_A* 1zre_A* 1zrf_A* 2gzw_A* 2wc2_A 3iyd_G* 3n4m_A* 3qop_A* 3rdi_A* 3rou_A* 3rpq_A* ... | Back alignment and structure |
|---|
| >2htj_A P fimbrial regulatory protein KS71A; winged helix-turn-helix, PAP PILI, transcription activator; NMR {Escherichia coli} SCOP: a.4.5.73 | Back alignment and structure |
|---|
| >1on2_A Transcriptional regulator MNTR; helix-turn-helix, DNA-binding protein, metalloregulatory protein; 1.61A {Bacillus subtilis} SCOP: a.4.5.24 a.76.1.1 PDB: 2ev0_A 1on1_A 2ev5_A 2ev6_A* 2f5c_A 2f5d_A 2f5e_A 2f5f_A 2hyf_A* 2hyg_D 3r60_A* 3r61_A* | Back alignment and structure |
|---|
| >1tbx_A ORF F-93, hypothetical 11.0 kDa protein; sulfolobus spindle virus, winged helix, fusellovirus; 2.70A {Sulfolobus virus 1} SCOP: a.4.5.48 | Back alignment and structure |
|---|
| >2gxg_A 146AA long hypothetical transcriptional regulator; winged helix; 1.45A {Sulfolobus tokodaii} PDB: 2eb7_A 2yr2_A 3gez_A 3gf2_A* 3gfi_A 3gfm_A 3gfj_A 3gfl_A | Back alignment and structure |
|---|
| >2rdp_A Putative transcriptional regulator MARR; PFAM PF01047, winged-helix binding motif, structural genomics, PSI-2; 2.30A {Geobacillus stearothermophilus} | Back alignment and structure |
|---|
| >3g3z_A NMB1585, transcriptional regulator, MARR family; transcription factor, structur genomics, oxford protein production facility; 2.10A {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >3bpv_A Transcriptional regulator; MARR, DNA binding, transcription factor, winged helix motif, DNA-binding; 1.40A {Methanobacterium thermoautotrophicum} PDB: 3bpx_A* | Back alignment and structure |
|---|
| >2fmy_A COOA, carbon monoxide oxidation system transcription RE COOA-1; DNA transcription regulator, DNA binding protein; HET: HEM; 2.20A {Carboxydothermus hydrogenoformans} PDB: 2hkx_A* | Back alignment and structure |
|---|
| >2nnn_A Probable transcriptional regulator; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3b02_A Transcriptional regulator, CRP family; structural genomics, riken structural genomics/proteomics in RSGI; 1.92A {Thermus thermophilus} PDB: 2zdb_A | Back alignment and structure |
|---|
| >1jgs_A Multiple antibiotic resistance protein MARR; transcription regulation, DNA-binding, repressor, transcription; HET: SAL; 2.30A {Escherichia coli} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >2oz6_A Virulence factor regulator; winged helix, helix-turn-helix, transcription factor, CAMP-B proteins, CAMP receptor protein; HET: CMP; 2.80A {Pseudomonas aeruginosa} SCOP: a.4.5.4 b.82.3.2 | Back alignment and structure |
|---|
| >1ku9_A Hypothetical protein MJ223; putative transcription factor, homodimeric winged-helix fold, structural genomics, PSI; 2.80A {Methanocaldococcus jannaschii} SCOP: a.4.5.36 | Back alignment and structure |
|---|
| >3clo_A Transcriptional regulator; NP_811094.1, bacterial regulatory proteins, LUXR family, structural genomics; 2.04A {Bacteroides thetaiotaomicron vpi-5482} | Back alignment and structure |
|---|
| >1r1u_A CZRA, repressor protein; zinc, DNA binding, transcriptional regulation, winged HTH protein, transcription repressor; 2.00A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 1r1v_A 2kjb_A 2kjc_A | Back alignment and structure |
|---|
| >3bro_A Transcriptional regulator; helix_TURN_helix, multiple antibiotic resistance protein (MA structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.04A {Oenococcus oeni} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >3oop_A LIN2960 protein; protein structure initiative, PSI-2, structural genomics, MI center for structural genomics, MCSG, unknown function; 1.78A {Listeria innocua} | Back alignment and structure |
|---|
| >2lkp_A Transcriptional regulator, ARSR family; symmetric homodimer, NI(II) binding protein, DNA binding Pro transcription regulator; NMR {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2zcw_A TTHA1359, transcriptional regulator, FNR/CRP family; stationary phase, DNA-binding, transcription regulation; 1.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2pex_A Transcriptional regulator OHRR; transcription regulator; 1.90A {Xanthomonas campestris} PDB: 2pfb_A | Back alignment and structure |
|---|
| >2fbi_A Probable transcriptional regulator; MARR, APC5816, structural genomic protein structure initiative; 2.10A {Pseudomonas aeruginosa} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >3iwz_A CAP-like, catabolite activation-like protein; XCC, pathogenicity, CRP, CLP, C-DI-GMP receptor, quorum SENS binding, transcription; 2.30A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3la7_A Global nitrogen regulator; activator, DNA-binding, transcription, transcription regulation; HET: BOG; 1.90A {Anabaena} PDB: 3la2_A* 3la3_A* 2xko_A* 2xgx_A* 2xhk_A* 2xkp_A* | Back alignment and structure |
|---|
| >3cuo_A Uncharacterized HTH-type transcriptional regulato; DNA-binding transcriptional regulator, structural genomics, MCSG; 2.00A {Escherichia coli K12} | Back alignment and structure |
|---|
| >2a61_A Transcriptional regulator TM0710; APC4350, MCSG, midwest center for structural genomics, PSI, protein structure initiative, MARR; 1.80A {Thermotoga maritima} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >3nrv_A Putative transcriptional regulator (MARR/EMRR FAM; PSI-2, protein structure initiati structural genomics; HET: MSE; 2.00A {Acinetobacter SP} | Back alignment and structure |
|---|
| >2l8n_A Transcriptional repressor CYTR; bacterial gene repressor, helix turn helix binding domain, L family, transcription regulation, binding protein; NMR {Escherichia coli} PDB: 2lcv_A | Back alignment and structure |
|---|
| >2fbh_A Transcriptional regulator PA3341; MARR, transcription regulator, APC5857, structural genomics, protein structure initiative; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >2a6h_F RNA polymerase sigma factor RPOD; RNA polymerase holoenzyme, streptolydigin, antibiotic, transcription regulation; HET: STD; 2.40A {Thermus thermophilus} SCOP: a.4.13.1 a.4.13.2 a.177.1.1 PDB: 1smy_F* 1zyr_F* 1iw7_F* 2a69_F* 2a6e_F 2a68_F* 2be5_F* 2cw0_F 3eql_F* 3dxj_F* 1l9u_H | Back alignment and structure |
|---|
| >3k0l_A Repressor protein; helix-turn-helix, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.35A {Acinetobacter SP} | Back alignment and structure |
|---|
| >1l3l_A Transcriptional activator protein TRAR; helix-turn-helix DNA binding motif, alpha/beta/alpha sandwich; HET: LAE; 1.66A {Agrobacterium tumefaciens} SCOP: a.4.6.2 d.110.5.1 PDB: 1h0m_A* | Back alignment and structure |
|---|
| >1z91_A Organic hydroperoxide resistance transcriptional; OHRR, MARR family, bacterial transcription factor, DNA bindi protein; 2.50A {Bacillus subtilis} SCOP: a.4.5.28 PDB: 1z9c_A* | Back alignment and structure |
|---|
| >2q0o_A Probable transcriptional activator protein TRAR; helix-turn-helix, two-helix coiled coil; HET: LAE; 2.00A {Rhizobium SP} | Back alignment and structure |
|---|
| >1u78_A TC3 transposase, transposable element TC3 transposase; transposon DNA, bipartite DNA-binding, HTH- motif, DNA binding protein/DNA complex; 2.69A {Caenorhabditis elegans} SCOP: a.4.1.2 a.4.1.2 | Back alignment and structure |
|---|
| >2frh_A SARA, staphylococcal accessory regulator A; winged-helix protein, divalent metal binding, transcription; 2.50A {Staphylococcus aureus} SCOP: a.4.5.28 PDB: 2fnp_A 1fzp_D | Back alignment and structure |
|---|
| >4ev0_A Transcription regulator, CRP family; CAMP binding, winged helix-turn-helix motif, DNA binding, transcription activator; HET: CMP; 2.40A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2cyy_A Putative HTH-type transcriptional regulator PH151; structural genomics, pyrococcus horikosii OT3, NPPSFA; HET: MSE GLN; 1.80A {Pyrococcus horikoshii} SCOP: a.4.5.32 d.58.4.2 | Back alignment and structure |
|---|
| >3bdd_A Regulatory protein MARR; putative multiple antibiotic-resistance repressor, structura genomics, joint center for structural genomics, JCSG; 2.20A {Streptococcus suis} | Back alignment and structure |
|---|
| >1zyb_A Transcription regulator, CRP family; NP_813211.1, structural genomics, joint center for structura genomics, JCSG; 2.15A {Bacteroides thetaiotaomicron} SCOP: a.4.5.4 b.82.3.2 | Back alignment and structure |
|---|
| >2w48_A Sorbitol operon regulator; SORC, activator, repressor, DNA-binding, transcription, transcription regulator, transcription regulation; 3.20A {Klebsiella pneumoniae} | Back alignment and structure |
|---|
| >1rzs_A Antirepressor, regulatory protein CRO; helix-turn-helix, DNA-binding protein, structural evolution, transcription; NMR {Enterobacteria phage P22} SCOP: a.35.1.2 | Back alignment and structure |
|---|
| >2fa5_A Transcriptional regulator MARR/EMRR family; multiple antibiotics resistance repressor, XCC structural genomics, X-RAY diffraction; 1.80A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >2k02_A Ferrous iron transport protein C; FEOC, iron-sulfur, metal-binding, metal binding protein; NMR {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >2oqg_A Possible transcriptional regulator, ARSR family P; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 1.54A {Rhodococcus SP} | Back alignment and structure |
|---|
| >2ofy_A Putative XRE-family transcriptional regulator; transcription regulator, structural genomics, PS protein structure initiative; 1.70A {Rhodococcus SP} SCOP: a.35.1.3 | Back alignment and structure |
|---|
| >3tgn_A ADC operon repressor ADCR; helix-turn-helix, transcriptional regulator, transcription; 2.00A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >2cfx_A HTH-type transcriptional regulator LRPC; transcriptional regulation, DNA binding, FFRP; 2.4A {Bacillus subtilis} SCOP: a.4.5.32 d.58.4.2 | Back alignment and structure |
|---|
| >3cjn_A Transcriptional regulator, MARR family; silicibacter pomeroy structural genomics, PSI-2, protein structure initiative; 1.95A {Silicibacter pomeroyi dss-3} | Back alignment and structure |
|---|
| >4hbl_A Transcriptional regulator, MARR family; HTH, transcription factor, DNA binding; 2.50A {Staphylococcus epidermidis} | Back alignment and structure |
|---|
| >1ft9_A Carbon monoxide oxidation system transcription regulator; heme sensor, catabolite gene activator protein; HET: HEM; 2.60A {Rhodospirillum rubrum} SCOP: a.4.5.4 b.82.3.1 | Back alignment and structure |
|---|
| >2eth_A Transcriptional regulator, putative, MAR family; MARR family, structural genomics, joint center for structura genomics, JCSG; 2.30A {Thermotoga maritima} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >1sfu_A 34L protein; protein/Z-DNA complex, DNA binding protein/DNA complex; 2.00A {Yaba-like disease virus} SCOP: a.4.5.19 | Back alignment and structure |
|---|
| >3szt_A QCSR, quorum-sensing control repressor; quorum sensing acyl-homoserine lactone, helix-turn-helix, transcription factor, 3-OXO-C12 HSL; HET: OHN; 2.55A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2hin_A GP39, repressor protein; transcription factor, dimer interface, helix-turn-helix; 1.05A {Enterobacteria phage N15} PDB: 3qws_A | Back alignment and structure |
|---|
| >3eco_A MEPR; mutlidrug efflux pump regulator winged helix-turn-helix motif, DNA-binding, transcription, transcription regulation; 2.40A {Staphylococcus aureus} SCOP: a.4.5.0 | Back alignment and structure |
|---|
| >2w25_A Probable transcriptional regulatory protein; transcription regulation, mutant, RV3291C, Glu104Ala, DNA-binding; 2.15A {Mycobacterium tuberculosis} PDB: 2vbw_A* 2vbx_A* 2vby_A* 2vbz_A* 2vc0_A 2vc1_A 2w24_A 2ivm_A 2w29_A 2qz8_A | Back alignment and structure |
|---|
| >1i1g_A Transcriptional regulator LRPA; helix-turn-helix, LRP/ASNC family; 2.90A {Pyrococcus furiosus} SCOP: a.4.5.32 d.58.4.2 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 286 | |||
| d1ijwc_ | 47 | HIN recombinase (DNA-binding domain) {Synthetic} | 97.87 | |
| d1hlva1 | 66 | DNA-binding domain of centromere binding protein B | 97.17 | |
| d1rp3a2 | 71 | Sigma factor sigma-28 (FliA) {Aquifex aeolicus [Ta | 96.17 | |
| d1k78a1 | 63 | Pax-5 {Human (Homo sapiens) [TaxId: 9606]} | 95.57 | |
| d1pdnc_ | 123 | Paired protein (prd) {Fruit fly (Drosophila melano | 95.2 | |
| d2jn6a1 | 89 | Uncharacterized protein Cgl2762 {Corynebacterium g | 95.19 | |
| d1or7a1 | 68 | SigmaE factor (RpoE) {Escherichia coli [TaxId: 562 | 94.72 | |
| d1s7oa_ | 106 | Hypothetical protein SPy1201 {Streptococcus pyogen | 94.5 | |
| d1i5za1 | 69 | Catabolite gene activator protein (CAP), C-termina | 94.36 | |
| d1fsea_ | 67 | Germination protein GerE {Bacillus subtilis [TaxId | 93.88 | |
| d1a04a1 | 67 | Nitrate/nitrite response regulator (NarL) {Escheri | 93.22 | |
| d1ku3a_ | 61 | Sigma70 (SigA, RpoD) {Thermus aquaticus [TaxId: 27 | 93.14 | |
| d1xsva_ | 106 | Hypothetical protein SAV1236 {Staphylococcus aureu | 93.01 | |
| d1l3la1 | 65 | Quorum-sensing transcription factor TraR, C-termin | 92.96 | |
| d1ft9a1 | 80 | CO-sensing protein CooA, C-terminal domain {Rhodos | 92.85 | |
| d1zyba1 | 73 | Probable transcription regulator BT4300, C-termina | 92.38 | |
| d3e5ua1 | 80 | Chlorophenol reduction protein CprK {Desulfitobact | 92.28 | |
| d2gaua1 | 81 | Transcriptional regulator PG0396, C-terminal domai | 92.01 | |
| d2ofya1 | 82 | Putative transcriptional regulator RHA1_ro04071 {R | 91.77 | |
| d1yioa1 | 70 | Response regulatory protein StyR, C-terminal domai | 91.77 | |
| d1ttya_ | 87 | Sigma70 (SigA, RpoD) {Thermotoga maritima [TaxId: | 91.68 | |
| d1biaa1 | 63 | Biotin repressor, N-terminal domain {Escherichia c | 90.98 | |
| d1gdta1 | 43 | gamma,delta resolvase (C-terminal domain) {Escheri | 90.9 | |
| d2p7vb1 | 68 | Sigma70 (SigA, RpoD) {Escherichia coli [TaxId: 562 | 90.69 | |
| d2zcwa1 | 82 | Transcriptional regulator TTHA1359, C-terminal dom | 90.59 | |
| d2hsga1 | 57 | Glucose-resistance amylase regulator CcpA, N-termi | 90.38 | |
| d1qpza1 | 57 | Purine repressor (PurR), N-terminal domain {Escher | 90.37 | |
| d1p4wa_ | 87 | Transcriptional regulator RcsB {Erwinia amylovora | 90.12 | |
| d2ppxa1 | 62 | Uncharacterized protein Atu1735 {Agrobacterium tum | 89.68 | |
| d1z05a1 | 71 | Transcriptional regulator VC2007 N-terminal domain | 88.84 | |
| d1efaa1 | 59 | Lac repressor (LacR), N-terminal domain {Escherich | 88.66 | |
| d1uxda_ | 59 | Fructose repressor (FruR), N-terminal domain {Esch | 88.53 | |
| d2auwa1 | 67 | Hypothetical protein NE0471 C-terminal domain {Nit | 88.41 | |
| d2d1ha1 | 109 | Hypothetical transcriptional regulator ST1889 {Sul | 88.07 | |
| d1r71a_ | 114 | Transcriptional repressor protein KorB DNA-binding | 87.5 | |
| d1j5ya1 | 65 | Putative transcriptional regulator TM1602, N-termi | 87.41 | |
| d1l8qa1 | 110 | Chromosomal replication initiation factor DnaA C-t | 87.25 | |
| d1j1va_ | 94 | Chromosomal replication initiation factor DnaA C-t | 87.03 | |
| d2ev0a1 | 61 | Manganese transport regulator MntR {Bacillus subti | 85.86 | |
| d2etha1 | 140 | Putative transcriptional regulator TM0816 {Thermot | 84.32 | |
| d2o38a1 | 89 | Hypothetical protein RPA3824 {Rhodopseudomonas pal | 84.1 | |
| d1d5ya1 | 54 | Rob transcription factor, N-terminal domain {Esche | 83.56 | |
| d1mkma1 | 75 | Transcriptional regulator IclR, N-terminal domain | 83.42 | |
| d1lnwa_ | 141 | MexR repressor {Pseudomonas aeruginosa [TaxId: 287 | 83.37 | |
| d2isya1 | 63 | Iron-dependent regulator IdeR {Mycobacterium tuber | 82.79 | |
| d2a61a1 | 139 | Transcriptional regulator TM0710 {Thermotoga marit | 82.51 | |
| d1z6ra1 | 70 | Mlc protein N-terminal domain {Escherichia coli [T | 81.92 | |
| d1vz0a1 | 93 | Putative partitioning protein ParB/Spo0J {Thermus | 81.91 | |
| d1utxa_ | 66 | Putative transcription regulator CylR2 {Enterococc | 81.87 | |
| d2oa4a1 | 93 | Uncharacterized protein SPO1678 {Silicibacter pome | 81.65 | |
| d1z91a1 | 137 | Organic hydroperoxide resistance transcriptional r | 81.62 | |
| d1bl0a1 | 54 | MarA {Escherichia coli [TaxId: 562]} | 80.97 | |
| d2bgca1 | 100 | Listeriolysin regulatory protein PrfA, C-terminal | 80.88 | |
| d1i1ga1 | 60 | LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 80.86 | |
| d1j9ia_ | 68 | Terminase gpNU1 subunit domain {Bacteriophage lamb | 80.85 | |
| d2hr3a1 | 145 | Probable transcriptional regulator PA3067 {Pseudom | 80.85 | |
| d3deua1 | 140 | Transcriptional regulator SlyA {Salmonella typhimu | 80.17 |
| >d1ijwc_ a.4.1.2 (C:) HIN recombinase (DNA-binding domain) {Synthetic} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: Homeodomain-like family: Recombinase DNA-binding domain domain: HIN recombinase (DNA-binding domain) species: Synthetic
Probab=97.87 E-value=9.8e-06 Score=48.15 Aligned_cols=42 Identities=17% Similarity=0.112 Sum_probs=36.8
Q ss_pred CCCCCCCHHHHHHHHHHHhhcCCChHhhhhhccccHhHHHHHH
Q psy13113 8 ARGVIHSPVVKLLAVLRFYATGNFQIDSEDYHDISQSTICRLV 50 (286)
Q Consensus 8 ~~~~~~~~~~~l~~~L~~L~~~~~~~~l~~~Fgvs~stv~~~~ 50 (286)
||++.++. +|+..+..+++.|.+..++|..||||++|+++++
T Consensus 1 GR~~~lt~-~q~~~a~~l~~~G~s~~~iA~~~gVSr~TiYry~ 42 (47)
T d1ijwc_ 1 GRPRAINK-HEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYF 42 (47)
T ss_dssp CCCCSSCH-HHHHHHHHHHHTTCCHHHHHHHHTCCHHHHHHHS
T ss_pred CCCCcCCH-HHHHHHHHHHHCCCCHHHHHHHHCcCHHHHHhhC
Confidence 46667776 6788888889999999999999999999999986
|
| >d1hlva1 a.4.1.7 (A:1-66) DNA-binding domain of centromere binding protein B (CENP-B) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rp3a2 a.4.13.2 (A:164-234) Sigma factor sigma-28 (FliA) {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1k78a1 a.4.1.5 (A:19-81) Pax-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pdnc_ a.4.1.5 (C:) Paired protein (prd) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2jn6a1 a.4.1.19 (A:1-89) Uncharacterized protein Cgl2762 {Corynebacterium glutamicum [TaxId: 1718]} | Back information, alignment and structure |
|---|
| >d1or7a1 a.4.13.2 (A:120-187) SigmaE factor (RpoE) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1s7oa_ a.4.13.3 (A:) Hypothetical protein SPy1201 {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1i5za1 a.4.5.4 (A:138-206) Catabolite gene activator protein (CAP), C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fsea_ a.4.6.2 (A:) Germination protein GerE {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1a04a1 a.4.6.2 (A:150-216) Nitrate/nitrite response regulator (NarL) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ku3a_ a.4.13.2 (A:) Sigma70 (SigA, RpoD) {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1xsva_ a.4.13.3 (A:) Hypothetical protein SAV1236 {Staphylococcus aureus, strain Mu50 / ATCC 700699 [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1l3la1 a.4.6.2 (A:170-234) Quorum-sensing transcription factor TraR, C-terminal domain {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1ft9a1 a.4.5.4 (A:134-213) CO-sensing protein CooA, C-terminal domain {Rhodospirillum rubrum [TaxId: 1085]} | Back information, alignment and structure |
|---|
| >d1zyba1 a.4.5.4 (A:148-220) Probable transcription regulator BT4300, C-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d3e5ua1 a.4.5.4 (A:148-227) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]} | Back information, alignment and structure |
|---|
| >d2gaua1 a.4.5.4 (A:152-232) Transcriptional regulator PG0396, C-terminal domain {Porphyromonas gingivalis [TaxId: 837]} | Back information, alignment and structure |
|---|
| >d2ofya1 a.35.1.3 (A:3-84) Putative transcriptional regulator RHA1_ro04071 {Rhodococcus sp. RHA1 [TaxId: 101510]} | Back information, alignment and structure |
|---|
| >d1yioa1 a.4.6.2 (A:131-200) Response regulatory protein StyR, C-terminal domain {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1ttya_ a.4.13.2 (A:) Sigma70 (SigA, RpoD) {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1biaa1 a.4.5.1 (A:1-63) Biotin repressor, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gdta1 a.4.1.2 (A:141-183) gamma,delta resolvase (C-terminal domain) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2p7vb1 a.4.13.2 (B:546-613) Sigma70 (SigA, RpoD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2hsga1 a.35.1.5 (A:2-58) Glucose-resistance amylase regulator CcpA, N-terminal domain {Bacillus megaterium [TaxId: 1404]} | Back information, alignment and structure |
|---|
| >d1qpza1 a.35.1.5 (A:2-58) Purine repressor (PurR), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p4wa_ a.4.6.2 (A:) Transcriptional regulator RcsB {Erwinia amylovora [TaxId: 552]} | Back information, alignment and structure |
|---|
| >d2ppxa1 a.35.1.3 (A:30-91) Uncharacterized protein Atu1735 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1z05a1 a.4.5.63 (A:10-80) Transcriptional regulator VC2007 N-terminal domain {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1efaa1 a.35.1.5 (A:2-60) Lac repressor (LacR), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uxda_ a.35.1.5 (A:) Fructose repressor (FruR), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2auwa1 a.35.1.10 (A:88-154) Hypothetical protein NE0471 C-terminal domain {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d2d1ha1 a.4.5.50 (A:1-109) Hypothetical transcriptional regulator ST1889 {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d1r71a_ a.4.14.1 (A:) Transcriptional repressor protein KorB DNA-binding domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1j5ya1 a.4.5.1 (A:3-67) Putative transcriptional regulator TM1602, N-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1l8qa1 a.4.12.2 (A:290-399) Chromosomal replication initiation factor DnaA C-terminal domain IV {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1j1va_ a.4.12.2 (A:) Chromosomal replication initiation factor DnaA C-terminal domain IV {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ev0a1 a.4.5.24 (A:2-62) Manganese transport regulator MntR {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2etha1 a.4.5.28 (A:1-140) Putative transcriptional regulator TM0816 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2o38a1 a.35.1.13 (A:28-116) Hypothetical protein RPA3824 {Rhodopseudomonas palustris [TaxId: 1076]} | Back information, alignment and structure |
|---|
| >d1d5ya1 a.4.1.8 (A:3-56) Rob transcription factor, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mkma1 a.4.5.33 (A:1-75) Transcriptional regulator IclR, N-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1lnwa_ a.4.5.28 (A:) MexR repressor {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2isya1 a.4.5.24 (A:2-64) Iron-dependent regulator IdeR {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2a61a1 a.4.5.28 (A:5-143) Transcriptional regulator TM0710 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1z6ra1 a.4.5.63 (A:12-81) Mlc protein N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vz0a1 a.4.14.1 (A:116-208) Putative partitioning protein ParB/Spo0J {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1utxa_ a.35.1.3 (A:) Putative transcription regulator CylR2 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2oa4a1 a.4.12.3 (A:1-93) Uncharacterized protein SPO1678 {Silicibacter pomeroyi [TaxId: 89184]} | Back information, alignment and structure |
|---|
| >d1z91a1 a.4.5.28 (A:8-144) Organic hydroperoxide resistance transcriptional regulator OhrR {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1bl0a1 a.4.1.8 (A:9-62) MarA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bgca1 a.4.5.4 (A:138-237) Listeriolysin regulatory protein PrfA, C-terminal domain {Bacteria (Listeria monocytogenes) [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1i1ga1 a.4.5.32 (A:2-61) LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1j9ia_ a.6.1.5 (A:) Terminase gpNU1 subunit domain {Bacteriophage lambda [TaxId: 10710]} | Back information, alignment and structure |
|---|
| >d2hr3a1 a.4.5.28 (A:2-146) Probable transcriptional regulator PA3067 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d3deua1 a.4.5.28 (A:2-141) Transcriptional regulator SlyA {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|