Psyllid ID: psy13127

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60----
MANGIRPDIPGFLLQPFRKPKRIRTAFSPSQLLKLEHAFEKNHYVVGAERKQLAQSLSLTETQF
ccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHcccccccc
ccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHc
mangirpdipgfllqpfrkpkrirtafspsqlLKLEHAFEKNHYVVGAERKQLAQSLSLTETQF
mangirpdipgfllqpfrkpkrIRTAFSPSQLLKLEHAFEKNHYVVGAERKQLaqslsltetqf
MANGIRPDIPGFLLQPFRKPKRIRTAFSPSQLLKLEHAFEKNHYVVGAERKQLAQSLSLTETQF
**********GFLLQPFR***RIRTAFSPSQLLKLEHAFEKNHYVVG*****************
************************TAFSPSQLLKLEHAFEKNHYVVGAERKQLAQSLSLTET**
MANGIRPDIPGFLLQPFRKPKRIRTAFSPSQLLKLEHAFEKNHYVVGAERKQLAQ*********
****IRPDIPGFLLQPFRKPKRIRTAFSPSQLLKLEHAFEKNHYVVGAERKQLAQSLSLT****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MANGIRPDIPGFLLQPFRKPKRIRTAFSPSQLLKLEHAFEKNHYVVGAERKQLAQSLSLTETQF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query64 2.2.26 [Sep-21-2011]
P18488497 Homeotic protein empty sp no N/A 0.859 0.110 0.821 9e-19
Q04744253 Homeobox protein EMX2 OS= yes N/A 0.718 0.181 0.956 3e-18
Q04743252 Homeobox protein EMX2 OS= yes N/A 0.718 0.182 0.956 3e-18
Q17R00253 Homeobox protein EMX2 OS= yes N/A 0.718 0.181 0.956 3e-18
Q04741257 Homeobox protein EMX1 OS= no N/A 0.875 0.217 0.816 2e-17
Q04742257 Homeobox protein EMX1 OS= no N/A 0.875 0.217 0.816 2e-17
Q804S6231 Homeobox protein EMX1 OS= no N/A 0.812 0.225 0.849 7e-17
Q6GLB9233 Homeobox protein EMX1 OS= no N/A 0.812 0.223 0.849 1e-16
Q06615236 Homeobox protein notochor N/A N/A 0.703 0.190 0.622 2e-07
Q91770233 Homeobox protein not2 OS= N/A N/A 0.671 0.184 0.604 3e-07
>sp|P18488|EMS_DROME Homeotic protein empty spiracles OS=Drosophila melanogaster GN=ems PE=2 SV=2 Back     alignment and function desciption
 Score = 92.0 bits (227), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 50/56 (89%), Gaps = 1/56 (1%)

Query: 10  PG-FLLQPFRKPKRIRTAFSPSQLLKLEHAFEKNHYVVGAERKQLAQSLSLTETQF 64
           PG FL+ PFRKPKRIRTAFSPSQLLKLEHAFE N YVVGAERK LAQ+L+L+ETQ 
Sbjct: 380 PGSFLVPPFRKPKRIRTAFSPSQLLKLEHAFESNQYVVGAERKALAQNLNLSETQV 435
Acts as a homeotic selector gene controlling antennal and mandibular segment identity.
Drosophila melanogaster (taxid: 7227)
>sp|Q04744|EMX2_MOUSE Homeobox protein EMX2 OS=Mus musculus GN=Emx2 PE=2 SV=3 Back     alignment and function description
>sp|Q04743|EMX2_HUMAN Homeobox protein EMX2 OS=Homo sapiens GN=EMX2 PE=1 SV=2 Back     alignment and function description
>sp|Q17R00|EMX2_BOVIN Homeobox protein EMX2 OS=Bos taurus GN=EMX2 PE=2 SV=1 Back     alignment and function description
>sp|Q04741|EMX1_HUMAN Homeobox protein EMX1 OS=Homo sapiens GN=EMX1 PE=2 SV=2 Back     alignment and function description
>sp|Q04742|EMX1_MOUSE Homeobox protein EMX1 OS=Mus musculus GN=Emx1 PE=2 SV=2 Back     alignment and function description
>sp|Q804S6|EMX1_DANRE Homeobox protein EMX1 OS=Danio rerio GN=emx1 PE=2 SV=1 Back     alignment and function description
>sp|Q6GLB9|EMX1_XENTR Homeobox protein EMX1 OS=Xenopus tropicalis GN=emx1 PE=2 SV=1 Back     alignment and function description
>sp|Q06615|NOTO_XENLA Homeobox protein notochord OS=Xenopus laevis GN=noto PE=2 SV=1 Back     alignment and function description
>sp|Q91770|NOT2_XENLA Homeobox protein not2 OS=Xenopus laevis GN=not2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query64
193669354 356 PREDICTED: homeobox protein EMX1-like [A 0.890 0.160 1.0 2e-25
242009481 447 Homeobox protein Nkx-6.1, putative [Pedi 0.890 0.127 1.0 3e-25
307187352 481 Homeotic protein empty spiracles [Campon 0.906 0.120 0.965 5e-25
340725585 447 PREDICTED: hypothetical protein LOC10064 0.906 0.129 0.965 5e-25
328779292 449 PREDICTED: hypothetical protein LOC55209 0.906 0.129 0.965 5e-25
383851796 377 PREDICTED: uncharacterized protein LOC10 0.890 0.151 0.982 5e-25
332018457 668 Homeotic protein empty spiracle [Acromyr 0.906 0.086 0.965 6e-25
380024040 310 PREDICTED: uncharacterized protein LOC10 0.906 0.187 0.965 7e-25
167004254 294 empty spiracles [Tribolium castaneum] gi 0.890 0.193 1.0 8e-25
345491144 454 PREDICTED: hypothetical protein LOC10012 0.890 0.125 0.929 7e-24
>gi|193669354|ref|XP_001948495.1| PREDICTED: homeobox protein EMX1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 57/57 (100%), Positives = 57/57 (100%)

Query: 7   PDIPGFLLQPFRKPKRIRTAFSPSQLLKLEHAFEKNHYVVGAERKQLAQSLSLTETQ 63
           PDIPGFLLQPFRKPKRIRTAFSPSQLLKLEHAFEKNHYVVGAERKQLAQSLSLTETQ
Sbjct: 212 PDIPGFLLQPFRKPKRIRTAFSPSQLLKLEHAFEKNHYVVGAERKQLAQSLSLTETQ 268

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|242009481|ref|XP_002425514.1| Homeobox protein Nkx-6.1, putative [Pediculus humanus corporis] gi|212509369|gb|EEB12776.1| Homeobox protein Nkx-6.1, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|307187352|gb|EFN72480.1| Homeotic protein empty spiracles [Camponotus floridanus] Back     alignment and taxonomy information
>gi|340725585|ref|XP_003401149.1| PREDICTED: hypothetical protein LOC100642539 [Bombus terrestris] Back     alignment and taxonomy information
>gi|328779292|ref|XP_624481.3| PREDICTED: hypothetical protein LOC552099 [Apis mellifera] Back     alignment and taxonomy information
>gi|383851796|ref|XP_003701417.1| PREDICTED: uncharacterized protein LOC100876009 [Megachile rotundata] Back     alignment and taxonomy information
>gi|332018457|gb|EGI59047.1| Homeotic protein empty spiracle [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|380024040|ref|XP_003695815.1| PREDICTED: uncharacterized protein LOC100869792 [Apis florea] Back     alignment and taxonomy information
>gi|167004254|ref|NP_001107793.1| empty spiracles [Tribolium castaneum] gi|162793850|emb|CAP58696.1| empty spiracles [Tribolium castaneum] gi|270014246|gb|EFA10694.1| empty spiracles [Tribolium castaneum] Back     alignment and taxonomy information
>gi|345491144|ref|XP_003426540.1| PREDICTED: hypothetical protein LOC100123616 [Nasonia vitripennis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query64
FB|FBgn0008646 524 E5 "E5" [Drosophila melanogast 0.921 0.112 0.85 8e-21
UNIPROTKB|E1BT91247 LOC100858961 "Uncharacterized 0.718 0.186 0.956 2.8e-18
UNIPROTKB|E1B7Q1288 EMX1 "Uncharacterized protein" 0.875 0.194 0.816 2.8e-18
UNIPROTKB|Q17R00253 EMX2 "Homeobox protein EMX2" [ 0.718 0.181 0.956 2.8e-18
UNIPROTKB|E2RQP4253 EMX2 "Uncharacterized protein" 0.718 0.181 0.956 2.8e-18
UNIPROTKB|J9P485134 EMX2 "Uncharacterized protein" 0.718 0.343 0.956 2.8e-18
UNIPROTKB|J9P7A7168 EMX1 "Uncharacterized protein" 0.875 0.333 0.816 2.8e-18
UNIPROTKB|F8W1B5147 EMX1 "Homeobox protein EMX1" [ 0.875 0.380 0.816 2.8e-18
UNIPROTKB|Q04741257 EMX1 "Homeobox protein EMX1" [ 0.875 0.217 0.816 2.8e-18
UNIPROTKB|Q04743252 EMX2 "Homeobox protein EMX2" [ 0.718 0.182 0.956 2.8e-18
FB|FBgn0008646 E5 "E5" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 252 (93.8 bits), Expect = 8.0e-21, P = 8.0e-21
 Identities = 51/60 (85%), Positives = 53/60 (88%)

Query:     5 IRPDIPG-FLLQPFRKPKRIRTAFSPSQLLKLEHAFEKNHYVVGAERKQLAQSLSLTETQ 63
             I P  PG FL QPFRKPKR+RTAFSP+QLLKLEHAFE NHYVVGAERKQLAQ LSLTETQ
Sbjct:   287 IFPRFPGNFLFQPFRKPKRVRTAFSPTQLLKLEHAFEGNHYVVGAERKQLAQGLSLTETQ 346
GO:0005634 "nucleus" evidence=ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
GO:0043565 "sequence-specific DNA binding" evidence=IEA
UNIPROTKB|E1BT91 LOC100858961 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1B7Q1 EMX1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q17R00 EMX2 "Homeobox protein EMX2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RQP4 EMX2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9P485 EMX2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9P7A7 EMX1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F8W1B5 EMX1 "Homeobox protein EMX1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q04741 EMX1 "Homeobox protein EMX1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q04743 EMX2 "Homeobox protein EMX2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q04743EMX2_HUMANNo assigned EC number0.95650.71870.1825yesN/A
Q04744EMX2_MOUSENo assigned EC number0.95650.71870.1818yesN/A
Q17R00EMX2_BOVINNo assigned EC number0.95650.71870.1818yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query64
pfam0004657 pfam00046, Homeobox, Homeobox domain 1e-12
smart0038957 smart00389, HOX, Homeodomain 1e-11
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 3e-11
>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information 
 Score = 55.6 bits (135), Expect = 1e-12
 Identities = 23/43 (53%), Positives = 29/43 (67%)

Query: 21 KRIRTAFSPSQLLKLEHAFEKNHYVVGAERKQLAQSLSLTETQ 63
          +R RT F+P QL +LE  FEKN Y    ER++LA+ L LTE Q
Sbjct: 1  RRKRTTFTPEQLEELEKEFEKNRYPSAEEREELAKKLGLTERQ 43

Length = 57
>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information
>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 64
KOG0488|consensus309 99.55
KOG0842|consensus 307 99.42
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 99.42
KOG2251|consensus 228 99.38
KOG0484|consensus125 99.38
KOG0487|consensus308 99.36
KOG0843|consensus197 99.34
KOG0489|consensus261 99.31
KOG0850|consensus245 99.31
PF0004657 Homeobox: Homeobox domain not present here.; Inter 99.26
KOG0492|consensus246 99.18
KOG0485|consensus 268 99.17
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 99.1
KOG0494|consensus 332 99.07
KOG0493|consensus342 99.05
cd0008659 homeodomain Homeodomain; DNA binding domains invol 99.05
KOG0486|consensus 351 99.04
KOG0848|consensus317 99.03
KOG0491|consensus194 98.91
KOG0849|consensus 354 98.77
COG5576156 Homeodomain-containing transcription factor [Trans 98.66
KOG0490|consensus 235 98.66
KOG0844|consensus 408 98.62
KOG3802|consensus398 98.55
KOG0483|consensus 198 98.23
KOG2252|consensus558 97.98
KOG0847|consensus288 97.86
KOG4577|consensus 383 97.62
KOG0774|consensus334 97.21
KOG0775|consensus304 97.16
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 97.07
KOG1168|consensus385 96.35
KOG0490|consensus235 96.21
PF0496753 HTH_10: HTH DNA binding domain; InterPro: IPR00705 94.34
PF0421853 CENP-B_N: CENP-B N-terminal DNA-binding domain; In 94.1
COG3413215 Predicted DNA binding protein [General function pr 91.48
KOG1146|consensus 1406 86.41
PF1156956 Homez: Homeodomain leucine-zipper encoding, Homez; 83.65
>KOG0488|consensus Back     alignment and domain information 
Probab=99.55  E-value=9.4e-15  Score=89.23  Aligned_cols=47  Identities=49%  Similarity=0.704  Sum_probs=45.5

Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHhhcCCCCHHHHHHHHHHcCCCCcCC
Q psy13127         18 RKPKRIRTAFSPSQLLKLEHAFEKNHYVVGAERKQLAQSLSLTETQF   64 (64)
Q Consensus        18 ~~~rr~Rt~~t~~q~~~Le~~F~~~~~~~~~~r~~La~~l~l~~~qV   64 (64)
                      +|+|+.||.||..|+.+||+.|++.+|++..+|++||..|||+++||
T Consensus       170 kK~RksRTaFT~~Ql~~LEkrF~~QKYLS~~DR~~LA~~LgLTdaQV  216 (309)
T KOG0488|consen  170 KKRRKSRTAFSDHQLFELEKRFEKQKYLSVADRIELAASLGLTDAQV  216 (309)
T ss_pred             cccccchhhhhHHHHHHHHHHHHHhhcccHHHHHHHHHHcCCchhhH
Confidence            77888899999999999999999999999999999999999999997

>KOG0842|consensus Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>KOG2251|consensus Back     alignment and domain information
>KOG0484|consensus Back     alignment and domain information
>KOG0487|consensus Back     alignment and domain information
>KOG0843|consensus Back     alignment and domain information
>KOG0489|consensus Back     alignment and domain information
>KOG0850|consensus Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>KOG0492|consensus Back     alignment and domain information
>KOG0485|consensus Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>KOG0494|consensus Back     alignment and domain information
>KOG0493|consensus Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>KOG0486|consensus Back     alignment and domain information
>KOG0848|consensus Back     alignment and domain information
>KOG0491|consensus Back     alignment and domain information
>KOG0849|consensus Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG0844|consensus Back     alignment and domain information
>KOG3802|consensus Back     alignment and domain information
>KOG0483|consensus Back     alignment and domain information
>KOG2252|consensus Back     alignment and domain information
>KOG0847|consensus Back     alignment and domain information
>KOG4577|consensus Back     alignment and domain information
>KOG0774|consensus Back     alignment and domain information
>KOG0775|consensus Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>KOG1168|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>PF04967 HTH_10: HTH DNA binding domain; InterPro: IPR007050 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif Back     alignment and domain information
>PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere Back     alignment and domain information
>COG3413 Predicted DNA binding protein [General function prediction only] Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query64
1fjl_A81 Homeodomain From The Drosophila Paired Protein Boun 1e-05
1ig7_A58 Msx-1 HomeodomainDNA COMPLEX STRUCTURE Length = 58 4e-05
2m34_A71 Nmr Structure Of The Homeodomain Transcription Fact 9e-05
2hos_A63 Phage-selected Homeodomain Bound To Unmodified Dna 2e-04
1hdd_C61 Crystal Structure Of An Engrailed Homeodomain-Dna C 2e-04
2hdd_A61 Engrailed Homeodomain Q50k Variant Dna Complex Leng 3e-04
1p7j_A59 Crystal Structure Of Engrailed Homeodomain Mutant K 3e-04
1p7i_A59 Crystal Structure Of Engrailed Homeodomain Mutant K 3e-04
3hdd_A60 Engrailed Homeodomain Dna Complex Length = 60 3e-04
3a03_A56 Crystal Structure Of Hox11l1 Homeodomain Length = 5 5e-04
3a01_B67 Crystal Structure Of Aristaless And Clawless Homeod 5e-04
3cmy_A61 Structure Of A Homeodomain In Complex With Dna Leng 7e-04
2dmt_A80 Solution Structure Of The Homeobox Domain Of Homeob 7e-04
1du0_A57 Engrailed Homeodomain Q50a Variant Dna Complex Leng 8e-04
1enh_A54 Structural Studies Of The Engrailed Homeodomain Len 9e-04
>pdb|1FJL|A Chain A, Homeodomain From The Drosophila Paired Protein Bound To A Dna Oligonucleotide Length = 81 Back     alignment and structure 
Iteration: 1

 Score = 45.1 bits (105), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 33/52 (63%), Gaps = 2/52 (3%)
Query: 10 PGFLLQPFRKPKRIRTAFSPSQLLKLEHAFEKNHYVVGAERKQLAQSLSLTE 61
          PG  L+  RK +R RT FS SQL +LE AFE+  Y     R++LAQ  +LTE
Sbjct: 10 PGIALK--RKQRRSRTTFSASQLDELERAFERTQYPDIYTREELAQRTNLTE 59
>pdb|1IG7|A Chain A, Msx-1 HomeodomainDNA COMPLEX STRUCTURE Length = 58 Back     alignment and structure
>pdb|2M34|A Chain A, Nmr Structure Of The Homeodomain Transcription Factor Gbx1 From Homo Sapiens Length = 71 Back     alignment and structure
>pdb|2HOS|A Chain A, Phage-selected Homeodomain Bound To Unmodified Dna Length = 63 Back     alignment and structure
>pdb|1HDD|C Chain C, Crystal Structure Of An Engrailed Homeodomain-Dna Complex At 2.8 Angstroms Resolution: A Framework For Understanding Homeodomain-Dna Interactions Length = 61 Back     alignment and structure
>pdb|2HDD|A Chain A, Engrailed Homeodomain Q50k Variant Dna Complex Length = 61 Back     alignment and structure
>pdb|1P7J|A Chain A, Crystal Structure Of Engrailed Homeodomain Mutant K52e Length = 59 Back     alignment and structure
>pdb|1P7I|A Chain A, Crystal Structure Of Engrailed Homeodomain Mutant K52a Length = 59 Back     alignment and structure
>pdb|3HDD|A Chain A, Engrailed Homeodomain Dna Complex Length = 60 Back     alignment and structure
>pdb|3A03|A Chain A, Crystal Structure Of Hox11l1 Homeodomain Length = 56 Back     alignment and structure
>pdb|3A01|B Chain B, Crystal Structure Of Aristaless And Clawless Homeodomains Bo Length = 67 Back     alignment and structure
>pdb|3CMY|A Chain A, Structure Of A Homeodomain In Complex With Dna Length = 61 Back     alignment and structure
>pdb|2DMT|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Barh-Like 1 Length = 80 Back     alignment and structure
>pdb|1DU0|A Chain A, Engrailed Homeodomain Q50a Variant Dna Complex Length = 57 Back     alignment and structure
>pdb|1ENH|A Chain A, Structural Studies Of The Engrailed Homeodomain Length = 54 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query64
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 5e-15
3a01_A93 Homeodomain-containing protein; homeodomain, prote 2e-14
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 4e-14
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 6e-14
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 7e-14
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 7e-14
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 2e-13
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 2e-13
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 3e-13
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 4e-13
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 7e-13
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 2e-12
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 5e-12
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 5e-12
3d1n_I151 POU domain, class 6, transcription factor 1; prote 6e-12
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 9e-12
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 2e-11
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 5e-11
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 9e-11
1e3o_C160 Octamer-binding transcription factor 1; transcript 9e-11
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 1e-10
2xsd_C164 POU domain, class 3, transcription factor 1; trans 1e-10
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 1e-10
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 2e-10
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 3e-10
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 4e-10
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 4e-10
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 6e-10
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 7e-10
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 8e-10
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 9e-10
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 1e-09
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 1e-09
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 5e-09
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 1e-08
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 2e-08
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 3e-08
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 5e-08
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 5e-08
3a02_A60 Homeobox protein aristaless; homeodomain, developm 5e-08
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 2e-07
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 2e-07
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 2e-07
1lfb_A99 Liver transcription factor (LFB1); transcription r 2e-07
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 3e-07
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 5e-07
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 9e-07
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 1e-06
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 1e-06
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 2e-06
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 9e-06
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 2e-05
1uhs_A72 HOP, homeodomain only protein; structural genomics 3e-05
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 9e-04
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 69 Back     alignment and structure
 Score = 61.2 bits (149), Expect = 5e-15
 Identities = 16/45 (35%), Positives = 24/45 (53%)

Query: 19 KPKRIRTAFSPSQLLKLEHAFEKNHYVVGAERKQLAQSLSLTETQ 63
                +  S +Q+++LE  F    Y+   ER  LA++L LTETQ
Sbjct: 3  HHHHHHSHMSHTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQ 47
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Length = 93 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Length = 58 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Length = 56 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Length = 58 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Length = 77 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Length = 62 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Length = 61 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Length = 97 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 80 Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Length = 63 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Length = 88 Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Length = 81 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Length = 68 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Length = 60 Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Length = 194 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Length = 99 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Length = 73 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Length = 77 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Length = 221 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query64
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.64
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.59
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.59
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.58
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.56
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.56
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.55
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.54
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.53
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.53
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.52
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.51
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.51
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.51
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.51
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.51
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.51
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.5
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.5
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.49
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.49
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.49
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.49
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.49
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 99.49
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.48
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.48
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 99.47
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 99.47
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.47
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 99.47
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 99.47
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 99.46
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 99.46
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.45
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.44
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 99.44
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.42
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.41
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.4
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.39
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 99.39
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 99.39
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.39
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.38
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 99.36
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 99.35
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 99.35
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 99.34
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 99.34
1lfb_A99 Liver transcription factor (LFB1); transcription r 99.32
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.32
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 99.32
1e3o_C160 Octamer-binding transcription factor 1; transcript 99.32
3d1n_I151 POU domain, class 6, transcription factor 1; prote 99.31
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 99.31
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 99.31
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 99.29
2xsd_C164 POU domain, class 3, transcription factor 1; trans 99.29
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 99.28
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 99.27
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 99.26
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 99.23
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 99.23
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 99.21
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 99.21
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 99.15
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 99.15
2e19_A64 Transcription factor 8; homeobox domain, structura 99.09
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 99.09
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 99.06
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 99.06
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 98.89
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 98.87
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 98.55
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 98.44
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 98.41
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 89.48
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
Probab=99.64  E-value=9.3e-16  Score=77.02  Aligned_cols=49  Identities=41%  Similarity=0.604  Sum_probs=45.7

Q ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHhhcCCCCHHHHHHHHHHcCCCCcCC
Q psy13127         16 PFRKPKRIRTAFSPSQLLKLEHAFEKNHYVVGAERKQLAQSLSLTETQF   64 (64)
Q Consensus        16 ~~~~~rr~Rt~~t~~q~~~Le~~F~~~~~~~~~~r~~La~~l~l~~~qV   64 (64)
                      ..++.++.|+.||..|+..||..|..++||+..++.+||..|||++.||
T Consensus        13 ~~~~~rr~Rt~ft~~Q~~~Le~~F~~~~yp~~~~r~~LA~~l~L~~~qV   61 (80)
T 2dmt_A           13 KAKKGRRSRTVFTELQLMGLEKRFEKQKYLSTPDRIDLAESLGLSQLQV   61 (80)
T ss_dssp             CCCCCCCSCCCCCHHHHHHHHHHHHHCSSCCHHHHHHHHHHHCCCHHHH
T ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHhcCCCCHHHHHHHHHHhCCCHHHe
Confidence            4467888999999999999999999999999999999999999999875
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 64
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 1e-12
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 2e-12
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 3e-11
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 2e-10
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 2e-10
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 3e-10
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 4e-10
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 9e-10
d1s7ea150 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M 1e-09
d1lfba_78 a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN 2e-09
d1au7a158 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra 2e-09
d1vnda_77 a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi 3e-09
d1zq3p167 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl 6e-09
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 8e-09
d1le8a_53 a.4.1.1 (A:) Mating type protein A1 Homeodomain {B 1e-08
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 1e-08
d2cufa182 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM 2e-08
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 2e-08
d1e3oc157 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( 3e-08
d1ig7a_58 a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu 4e-08
d1jgga_57 a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( 7e-08
d1ocpa_67 a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus 2e-07
d1uhsa_72 a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse 2e-07
d1wi3a_71 a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom 4e-07
d1pufb_73 a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 4e-07
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 1e-06
d2ecba176 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote 1e-05
d1wh7a_80 a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha 2e-05
d1k61a_60 a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast 4e-05
d2cqxa159 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 1e-04
d1x2ma152 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 1e-04
d2ecca176 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein H 0.002
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Paired box protein pax6
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 54.4 bits (131), Expect = 1e-12
 Identities = 16/43 (37%), Positives = 25/43 (58%)

Query: 21 KRIRTAFSPSQLLKLEHAFEKNHYVVGAERKQLAQSLSLTETQ 63
          +R RT+F+  Q+  LE  FE+ HY     R++LA  + L E +
Sbjct: 2  QRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEAR 44
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query64
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.62
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.62
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.61
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.61
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.59
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.58
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.57
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.57
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.57
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.56
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.55
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.54
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.53
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.51
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.51
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.5
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.5
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.48
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.44
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.43
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.43
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.42
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 99.38
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 99.35
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 99.26
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 99.17
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 99.16
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 99.13
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 99.11
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 98.92
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 98.89
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 98.83
d1ijwc_47 HIN recombinase (DNA-binding domain) {Synthetic} 86.77
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein hox-b13
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.62  E-value=2.9e-16  Score=73.74  Aligned_cols=45  Identities=27%  Similarity=0.530  Sum_probs=42.4

Q ss_pred             CCCCCCCCCHHHHHHHHHHHhhcCCCCHHHHHHHHHHcCCCCcCC
Q psy13127         20 PKRIRTAFSPSQLLKLEHAFEKNHYVVGAERKQLAQSLSLTETQF   64 (64)
Q Consensus        20 ~rr~Rt~~t~~q~~~Le~~F~~~~~~~~~~r~~La~~l~l~~~qV   64 (64)
                      +++.|+.||..|+..||..|..++||+..++.+||..|||++.||
T Consensus         1 Grr~Rt~ft~~Q~~~Le~~F~~~~yp~~~~r~~LA~~l~l~~~qV   45 (58)
T d2craa1           1 GRKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQI   45 (58)
T ss_dssp             CCCSCCCSCHHHHHHHHHHHHHCSSCCHHHHHHHHHHTCCCHHHH
T ss_pred             CCCCCCCCCHHHHHHHHHHHhhcCCCCHHHHHHHHHHcCCCHHHe
Confidence            467899999999999999999999999999999999999999875
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ijwc_ a.4.1.2 (C:) HIN recombinase (DNA-binding domain) {Synthetic} Back     information, alignment and structure