Psyllid ID: psy13158

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------29
MVDHLVHVDLATLECYPSPCGPYSECRNINGGPSCSCRPGYIGSPPNCRPECVMNSECPSHEACIKIPECIQNSECPYDKACIREKCVDPCPGSCGYGAVCTVINHSNEKCQDPCPGSCGYNAECKVINHNPICSCSQGYIGDGFSGCYPKPPEVPPPPQQDVQEYVNPCVPSPCGLYSQCRDIGGSPSCSCLPNYIGAPPNCRPECLQNSECPNDKACIREKCADPCPGSCGYNAQCKVINHTPTCTCPDGFIGDAFLSCHPKPPERECLYWEIELDLVSFIFYIPDK
ccccccccccccccccccccccccEEEEcccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccEEEccccccccccccccccccccccccccccccccccccccccccccEEEccccccEEEcccccccccccccccccccccccccccccccccccccccccccccEEEEcccccEEEccccccccccccccccccccccccccccccccccEEEcccc
ccccccccccccccccccccccccEEEEccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccEEEEccccEEEEccccccccccccccccccccccccccccccccccccccccccccEEEEccccEEEEcccccccccccccccccccccccccccccccccccccccccccccEEEEccccEEEEcccccccccccccccccccccccccccccccHccccccccc
MVDHLVHVDLatlecypspcgpysecrninggpscscrpgyigsppncrpecvmnsecpsheacikipeciqnsecpydkacirekcvdpcpgscgygavctvinhsnekcqdpcpgscgynaeckvinhnpicscsqgyigdgfsgcypkppevppppqqdvqeyvnpcvpspcglysqcrdiggspscsclpnyigappncrpeclqnsecpndkacirekcadpcpgscgynaqckvinhtptctcpdgfigdaflschpkpperecLYWEIELDLVSFIFYIPDK
MVDHLVHVDLATLECYPSPCGPYSECRNINGGPSCSCRPGYIGSPPNCRPECVMNSECPSHEACIKIPECIQNSECPYDKACIREKCVDPCPGSCGYGAVCTVINHSNEKCQDPCPGSCGYNAECKVINHNPICSCSQGYIGDGFSGCYPKPPEVPPPPQQDVQEYVNPCVPSPCGLYSQCRDIGGSPSCSCLPNYIGAPPNCRPECLQNSECPNDKACIREKCADPCPGSCGYNAQCKVINHTPTCTCPDGFIGDAFLSCHPKPPERECLYWEIELDLVSFIFYIPDK
MVDHLVHVDLATLECYPSPCGPYSECRNINGGPSCSCRPGYIGSPPNCRPECVMNSECPSHEACIKIPECIQNSECPYDKACIREKCVDPCPGSCGYGAVCTVINHSNEKCQDPCPGSCGYNAECKVINHNPICSCSQGYIGDGFSGCYpkppevppppQQDVQEYVNPCVPSPCGLYSQCRDIGGSPSCSCLPNYIGAPPNCRPECLQNSECPNDKACIREKCADPCPGSCGYNAQCKVINHTPTCTCPDGFIGDAFLSCHPKPPERECLYWEIELDLVSFIFYIPDK
***HLVHVDLATLECYPSPCGPYSECRNINGGPSCSCRPGYIGSPPNCRPECVMNSECPSHEACIKIPECIQNSECPYDKACIREKCVDPCPGSCGYGAVCTVINHSNEKCQDPCPGSCGYNAECKVINHNPICSCSQGYIGDGFSGCY****************YVNPCVPSPCGLYSQCRDIGGSPSCSCLPNYIGAPPNCRPECLQNSECPNDKACIREKCADPCPGSCGYNAQCKVINHTPTCTCPDGFIGDAFLSCHPKPPERECLYWEIELDLVSFIFYI***
MVDHLVHVDLATLECYPSPCGPYSECRNINGGPSCSCRPGYIGSPPNCRPECVMNSECPSHEACIKIPECIQNSECPYDKACIREKCVDPCPGSCGYGAVCTVINHSNEKCQDPCPGSCGYNAECKVINHNPICSCSQGYIGDGFSGCYPKPPEVPPPPQQDVQEYVNPCVPSPCGLYSQCRDIGGSPSCSCLPNYIGAPPNCRPECLQNSECPNDKACIREKCADPCPGSCGYNAQCKVINHTPTCTCPDGFIGDAFLSCHPKPPERECLYWEIELDLVSFIFYIPD*
MVDHLVHVDLATLECYPSPCGPYSECRNINGGPSCSCRPGYIGSPPNCRPECVMNSECPSHEACIKIPECIQNSECPYDKACIREKCVDPCPGSCGYGAVCTVINHSNEKCQDPCPGSCGYNAECKVINHNPICSCSQGYIGDGFSGCYPKPPEVPPPPQQDVQEYVNPCVPSPCGLYSQCRDIGGSPSCSCLPNYIGAPPNCRPECLQNSECPNDKACIREKCADPCPGSCGYNAQCKVINHTPTCTCPDGFIGDAFLSCHPKPPERECLYWEIELDLVSFIFYIPDK
*V*HLVHVDLATLECYPSPCGPYSECRNINGGPSCSCRPGYIGSPPNCRPECVMNSECPSHEACIKIPECIQNSECPYDKACIREKCVDPCPGSCGYGAVCTVINHSNEKCQDPCPGSCGYNAECKVINHNPICSCSQGYIGDGFSGCYPKPPEVPPPPQQDVQEYVNPCVPSPCGLYSQCRDIGGSPSCSCLPNYIGAPPNCRPECLQNSECPNDKACIREKCADPCPGSCGYNAQCKVINHTPTCTCPDGFIGDAFLSCHPKPPERECLYWEIELDLVSFIFYIPDK
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVDHLVHVDLATLECYPSPCGPYSECRNINGGPSCSCRPGYIGSPPNCRPECVMNSECPSHEACIKIPECIQNSECPYDKACIREKCVDPCPGSCGYGAVCTVINHSNEKCQDPCPGSCGYNAECKVINHNPICSCSQGYIGDGFSGCYPKPPEVPPPPQQDVQEYVNPCVPSPCGLYSQCRDIGGSPSCSCLPNYIGAPPNCRPECLQNSECPNDKACIREKCADPCPGSCGYNAQCKVINHTPTCTCPDGFIGDAFLSCHPKPPERECLYWEIELDLVSFIFYIPDK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query289 2.2.26 [Sep-21-2011]
O88278 3313 Cadherin EGF LAG seven-pa no N/A 0.408 0.035 0.304 1e-05
Q9NYQ7 3312 Cadherin EGF LAG seven-pa no N/A 0.508 0.044 0.251 2e-05
Q91ZI0 3301 Cadherin EGF LAG seven-pa no N/A 0.501 0.043 0.261 5e-05
Q8R4U0 2559 Stabilin-2 OS=Mus musculu yes N/A 0.591 0.066 0.265 8e-05
Q8WWQ8 2551 Stabilin-2 OS=Homo sapien yes N/A 0.605 0.068 0.266 0.0001
Q8CFM6 1431 Stabilin-2 (Fragment) OS= no N/A 0.591 0.119 0.253 0.0003
P34576 3767 Transmembrane cell adhesi yes N/A 0.778 0.059 0.279 0.0009
>sp|O88278|CELR3_RAT Cadherin EGF LAG seven-pass G-type receptor 3 OS=Rattus norvegicus GN=Celsr3 PE=2 SV=1 Back     alignment and function desciption
 Score = 50.8 bits (120), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 43/141 (30%), Positives = 58/141 (41%), Gaps = 23/141 (16%)

Query: 133  ICSCSQGYIGDGFSGCYPKPPEVPPPPQQDVQ-----EYVNPCVPSPCGLYSQCRDIGGS 187
            +  C QG     ++G  P      PPP   +         NPC   PC  ++ C+D+  +
Sbjct: 1903 LVGCIQGV----WTGFTPFGSSALPPPSHRINVEPGCTVTNPCASGPCPPHANCKDLWQT 1958

Query: 188  PSCSCLPNYIGAPPNCRPECLQNSECPNDKACIREKCADP----CPGSCGYNAQ-CKVIN 242
             SC+C P Y G  P C   CL N  C N  +C R     P    C  + GY  Q C+   
Sbjct: 1959 FSCTCWPGYYG--PGCVDACLLNP-CQNQGSC-RHLQGGPHGYTCDCASGYFGQHCE--- 2011

Query: 243  HTPTCTCPDGFIGDAFLSCHP 263
            H     CP G+ G    +C P
Sbjct: 2012 HRMDQQCPRGWWGSP--TCGP 2030
Receptor that may have an important role in cell/cell signaling during nervous system formation.
Rattus norvegicus (taxid: 10116)
>sp|Q9NYQ7|CELR3_HUMAN Cadherin EGF LAG seven-pass G-type receptor 3 OS=Homo sapiens GN=CELSR3 PE=1 SV=2 Back     alignment and function description
>sp|Q91ZI0|CELR3_MOUSE Cadherin EGF LAG seven-pass G-type receptor 3 OS=Mus musculus GN=Celsr3 PE=2 SV=2 Back     alignment and function description
>sp|Q8R4U0|STAB2_MOUSE Stabilin-2 OS=Mus musculus GN=Stab2 PE=1 SV=1 Back     alignment and function description
>sp|Q8WWQ8|STAB2_HUMAN Stabilin-2 OS=Homo sapiens GN=STAB2 PE=1 SV=3 Back     alignment and function description
>sp|Q8CFM6|STAB2_RAT Stabilin-2 (Fragment) OS=Rattus norvegicus GN=Stab2 PE=1 SV=1 Back     alignment and function description
>sp|P34576|MUA3_CAEEL Transmembrane cell adhesion receptor mua-3 OS=Caenorhabditis elegans GN=mua-3 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query289
270013391 21117 hypothetical protein TcasGA2_TC011986 [T 0.757 0.010 0.556 4e-62
158299050 2257 AGAP010023-PA [Anopheles gambiae str. PE 0.712 0.091 0.543 1e-61
195052558 7303 GH13743 [Drosophila grimshawi] gi|193900 0.788 0.031 0.492 1e-61
328714521 16577 PREDICTED: hypothetical protein LOC10016 0.723 0.012 0.543 2e-61
158299052 3202 AGAP010024-PA [Anopheles gambiae str. PE 0.698 0.063 0.544 2e-61
442625920 18014 dumpy, isoform W [Drosophila melanogaste 0.705 0.011 0.527 4e-61
442625928 19560 dumpy, isoform AA [Drosophila melanogast 0.705 0.010 0.527 7e-61
442625918 20404 dumpy, isoform V [Drosophila melanogaste 0.705 0.009 0.527 1e-60
442625916 21657 dumpy, isoform U [Drosophila melanogaste 0.705 0.009 0.527 1e-60
442625914 22300 dumpy, isoform T [Drosophila melanogaste 0.705 0.009 0.527 1e-60
>gi|270013391|gb|EFA09839.1| hypothetical protein TcasGA2_TC011986 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  244 bits (622), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 147/264 (55%), Positives = 168/264 (63%), Gaps = 45/264 (17%)

Query: 6     VHVDLATLECYPSPCGPYSECRNINGGPSCSCRPGYIGSPPNCRPECVMNSECPSHEACI 65
             V  +  T  C PSPCGP S+CR +NG   CSC P YIGSPP CRPECV++SEC       
Sbjct: 15164 VKDETPTNPCQPSPCGPNSQCREVNGQAVCSCLPNYIGSPPGCRPECVVSSECAQ----- 15218

Query: 66    KIPECIQNSECPYDKACIREKCVDPCPGSCGYGAVCTVINHSNEKCQDPCPGSCGYNAEC 125
                          +KAC+ +KCVDP                        CPG+CG NA C
Sbjct: 15219 -------------NKACVNQKCVDP------------------------CPGTCGLNANC 15241

Query: 126   KVINHNPICSCSQGYIGDGFSGCYPKPPEVPPPPQQDVQEYVNPCVPSPCGLYSQCRDIG 185
             +VINH+PICSC  G+ GD FS C+P PP  P    + V+   NPCVPSPCG  S+CRDIG
Sbjct: 15242 QVINHSPICSCQAGFTGDPFSRCFPIPPPPPVQEPEPVR---NPCVPSPCGPNSECRDIG 15298

Query: 186   GSPSCSCLPNYIGAPPNCRPECLQNSECPNDKACIREKCADPCPGSCGYNAQCKVINHTP 245
             GSPSCSCLPNYIG+PPNCRPEC  NSEC ++ ACIREKC DPCPGSCG  AQC VINHTP
Sbjct: 15299 GSPSCSCLPNYIGSPPNCRPECTINSECSSNLACIREKCRDPCPGSCGSGAQCSVINHTP 15358

Query: 246   TCTCPDGFIGDAFLSCHPKPPERE 269
              CTCP+G+ GD F  C PKP E E
Sbjct: 15359 ICTCPEGYTGDPFSYCQPKPQEVE 15382

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|158299050|ref|XP_001689174.1| AGAP010023-PA [Anopheles gambiae str. PEST] gi|157014182|gb|EDO63447.1| AGAP010023-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|195052558|ref|XP_001993322.1| GH13743 [Drosophila grimshawi] gi|193900381|gb|EDV99247.1| GH13743 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|328714521|ref|XP_003245382.1| PREDICTED: hypothetical protein LOC100166039 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|158299052|ref|XP_319172.4| AGAP010024-PA [Anopheles gambiae str. PEST] gi|157014183|gb|EAA13876.4| AGAP010024-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|442625920|ref|NP_001260038.1| dumpy, isoform W [Drosophila melanogaster] gi|440213323|gb|AGB92574.1| dumpy, isoform W [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|442625928|ref|NP_001260042.1| dumpy, isoform AA [Drosophila melanogaster] gi|440213327|gb|AGB92578.1| dumpy, isoform AA [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|442625918|ref|NP_001260037.1| dumpy, isoform V [Drosophila melanogaster] gi|440213322|gb|AGB92573.1| dumpy, isoform V [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|442625916|ref|NP_001260036.1| dumpy, isoform U [Drosophila melanogaster] gi|440213321|gb|AGB92572.1| dumpy, isoform U [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|442625914|ref|NP_001260035.1| dumpy, isoform T [Drosophila melanogaster] gi|440213320|gb|AGB92571.1| dumpy, isoform T [Drosophila melanogaster] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query289
FB|FBgn005319622 dp "dumpy" [Drosophila melanog 0.837 11.0 0.494 9.2e-62
UNIPROTKB|E1BNX3 1148 Bt.112199 "Uncharacterized pro 0.761 0.191 0.295 4.4e-17
UNIPROTKB|J9NS51 2272 NOTCH1 "Uncharacterized protei 0.802 0.102 0.292 2.7e-16
UNIPROTKB|F1PDC7 2555 NOTCH1 "Uncharacterized protei 0.802 0.090 0.292 3.1e-16
UNIPROTKB|F1PJ40 1162 EMR1 "Uncharacterized protein" 0.737 0.183 0.302 3.2e-16
ZFIN|ZDB-GENE-041001-184 8328 si:dkey-30j22.1 "si:dkey-30j22 0.719 0.024 0.311 3.3e-16
MGI|MGI:97363 2531 Notch1 "notch 1" [Mus musculus 0.802 0.091 0.292 6.4e-16
RGD|3187 2531 Notch1 "notch 1" [Rattus norve 0.802 0.091 0.288 8.2e-16
UNIPROTKB|Q07008 2531 Notch1 "Neurogenic locus notch 0.802 0.091 0.288 8.2e-16
UNIPROTKB|F1MSM3 2534 NOTCH1 "Uncharacterized protei 0.802 0.091 0.288 1e-15
FB|FBgn0053196 dp "dumpy" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 658 (236.7 bits), Expect = 9.2e-62, P = 9.2e-62
 Identities = 128/259 (49%), Positives = 152/259 (58%)

Query:    17 PSPCGPYSECRNINGGPSCSCRPGYIGSP-PNCRPECVMNSECPSHEACIKIPECIQNSE 75
             P  CG  + C  +N  PSCSC  GY G P  +C PE V     P    C   P C  NS+
Sbjct: 14766 PGTCGQNALCNVLNHIPSCSCISGYSGDPYRSCVPEPVKEYVNP----CQPSP-CGPNSQ 14820

Query:    76 CPY--DKA---CIREKCVDP--CPGSCGYGAVCTVINHS-NEKCQDPCPGSCGYNAECKV 127
             C    ++A   C+ E    P  C   C   + C       N+KC DPCP +CG  A C+V
Sbjct: 14821 CREVNEQAICSCLPEYVGAPPVCRPECTISSECPADKACVNQKCVDPCPNTCGDQAICRV 14880

Query:   128 INHNPICSCSQGYIGDGFSGCYXXXXXXXXXXQQDVQEYVNPCVPSPCGLYSQCRDIGGS 187
             +NH+PICSC  GY GD F  C+          Q+     V+PCVP+PCG YSQCR  G +
Sbjct: 14881 VNHSPICSCRAGYTGDAFFRCFPKPPVPPTPVQKTP---VDPCVPTPCGPYSQCRSQGDA 14937

Query:   188 PSCSCLPNYIGAPPNCRPECLQNSECPNDKACIREKCADPCPGSCGYNAQCKVINHTPTC 247
             P+CSCL  YIGAPPNCRPEC  N+ECP+ +ACI EKC DPCPGSCGY A C VINHTP+C
Sbjct: 14938 PACSCLVGYIGAPPNCRPECRINAECPSSQACINEKCRDPCPGSCGYGAICNVINHTPSC 14997

Query:   248 TCPDGFIGDAFLSCHPKPP 266
             TCP G+ GD F  C P PP
Sbjct: 14998 TCPPGYSGDPFSQCQPVPP 15016
GO:0007475 "apposition of dorsal and ventral imaginal disc-derived wing surfaces" evidence=IMP
GO:0005578 "proteinaceous extracellular matrix" evidence=NAS
GO:0007424 "open tracheal system development" evidence=IMP
GO:0051539 "4 iron, 4 sulfur cluster binding" evidence=IEA
GO:0004867 "serine-type endopeptidase inhibitor activity" evidence=IEA
GO:0004519 "endonuclease activity" evidence=IEA
GO:0005509 "calcium ion binding" evidence=IEA
GO:0008362 "chitin-based embryonic cuticle biosynthetic process" evidence=IMP
GO:0040005 "chitin-based cuticle attachment to epithelium" evidence=IMP
GO:0031012 "extracellular matrix" evidence=ISM
GO:0005201 "extracellular matrix structural constituent" evidence=ISM
GO:0046331 "lateral inhibition" evidence=IMP
UNIPROTKB|E1BNX3 Bt.112199 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J9NS51 NOTCH1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1PDC7 NOTCH1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1PJ40 EMR1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041001-184 si:dkey-30j22.1 "si:dkey-30j22.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:97363 Notch1 "notch 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|3187 Notch1 "notch 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q07008 Notch1 "Neurogenic locus notch homolog protein 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1MSM3 NOTCH1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 289
KOG1214|consensus 1289 99.6
KOG1219|consensus 4289 99.4
KOG1214|consensus 1289 99.33
KOG1219|consensus 4289 99.18
KOG4289|consensus 2531 99.06
KOG1217|consensus487 98.96
KOG4289|consensus 2531 98.71
KOG1217|consensus 487 98.68
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 98.46
KOG4260|consensus350 98.43
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 98.2
smart0017939 EGF_CA Calcium-binding EGF-like domain. 98.14
KOG1225|consensus 525 98.13
KOG4260|consensus350 98.1
PF1294736 EGF_3: EGF domain; InterPro: IPR024731 This entry 97.93
PF1294736 EGF_3: EGF domain; InterPro: IPR024731 This entry 97.92
PF0000832 EGF: EGF-like domain This is a sub-family of the P 97.91
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 97.79
KOG1225|consensus 525 97.76
PF0000832 EGF: EGF-like domain This is a sub-family of the P 97.55
smart0017939 EGF_CA Calcium-binding EGF-like domain. 97.48
PF1266224 cEGF: Complement Clr-like EGF-like 97.25
smart0018135 EGF Epidermal growth factor-like domain. 97.13
PF06247197 Plasmod_Pvs28: Plasmodium ookinete surface protein 97.12
PF1266224 cEGF: Complement Clr-like EGF-like 97.02
cd0005336 EGF Epidermal growth factor domain, found in epide 97.02
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 96.95
cd0005336 EGF Epidermal growth factor domain, found in epide 96.57
smart0018135 EGF Epidermal growth factor-like domain. 96.31
PF1467036 FXa_inhibition: Coagulation Factor Xa inhibitory s 95.76
KOG1226|consensus 783 95.52
PF1467036 FXa_inhibition: Coagulation Factor Xa inhibitory s 95.28
PF0797432 EGF_2: EGF-like domain; InterPro: IPR013111 A sequ 95.15
PF1266113 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E 94.14
PF06247197 Plasmod_Pvs28: Plasmodium ookinete surface protein 93.61
PF0797432 EGF_2: EGF-like domain; InterPro: IPR013111 A sequ 93.12
KOG0994|consensus 1758 92.84
KOG0994|consensus 1758 92.82
PF1294637 EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 92.69
KOG1226|consensus 783 92.6
cd01475224 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, 91.39
PF1294637 EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 90.34
PF0168352 EB: EB module; InterPro: IPR006149 The EB domain h 86.32
smart0005163 DSL delta serrate ligand. 83.79
cd01475224 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, 81.92
>KOG1214|consensus Back     alignment and domain information 
Probab=99.60  E-value=6e-15  Score=138.18  Aligned_cols=166  Identities=30%  Similarity=0.716  Sum_probs=120.3

Q ss_pred             CcCCCC--CCCCCCCCeeeeCCC-CceeeCCCCccCCCCCCcccCCCCCCCCCCCccccCCCcccCCCCCCCCccccccc
Q psy13158         11 ATLECY--PSPCGPYSECRNING-GPSCSCRPGYIGSPPNCRPECVMNSECPSHEACIKIPECIQNSECPYDKACIREKC   87 (289)
Q Consensus        11 did~C~--~~~C~~~~~C~n~~g-s~~C~C~~Gf~g~~~~C~~~C~~~~~c~~~~~C~~~~~C~~~~~c~~~~~c~~~~c   87 (289)
                      .++.|.  ++-|..++.|...++ .|.|.|..||.|.|.+                |.+.++|...              
T Consensus       691 ~~npCy~gsh~cdt~a~C~pg~~~~~tcecs~g~~gdgr~----------------c~d~~eca~~--------------  740 (1289)
T KOG1214|consen  691 PVNPCYDGSHMCDTTARCHPGTGVDYTCECSSGYQGDGRN----------------CVDENECATG--------------  740 (1289)
T ss_pred             ccccceecCcccCCCccccCCCCcceEEEEeeccCCCCCC----------------CCChhhhccC--------------
Confidence            456666  566777788887764 6888888888887333                4444443322              


Q ss_pred             cCCCCCCCCCCCeeeeccCCCCcccCCCCCCCCCCCeeeecCCCceeecCCCCccCCC-CCCCCCCCCCCCCCCCCCccc
Q psy13158         88 VDPCPGSCGYGAVCTVINHSNEKCQDPCPGSCGYNAECKVINHNPICSCSQGYIGDGF-SGCYPKPPEVPPPPQQDVQEY  166 (289)
Q Consensus        88 ~~~C~g~~~~~~~C~~~~~~~~~c~~~c~~~C~~~~~C~~~~g~~~C~C~~G~~~~~~-~~C~~~~~~~~~~~~~~~~~~  166 (289)
                                                  ...|..+++|++..++|+|.|..||..... ..|.++..+          ..
T Consensus       741 ----------------------------~~~CGp~s~Cin~pg~~rceC~~gy~F~dd~~tCV~i~~p----------ap  782 (1289)
T KOG1214|consen  741 ----------------------------FHRCGPNSVCINLPGSYRCECRSGYEFADDRHTCVLITPP----------AP  782 (1289)
T ss_pred             ----------------------------CCCCCCCceeecCCCceeEEEeecceeccCCcceEEecCC----------CC
Confidence                                        356888999999999999999999875432 236444332          22


Q ss_pred             cCCCC--CCCCCCCC--eeeecC-CCCeeeCCCCcccCCCCCccCCCCCCCCCCCCccccCcccCCCCCCCCCCCeeeeC
Q psy13158        167 VNPCV--PSPCGLYS--QCRDIG-GSPSCSCLPNYIGAPPNCRPECLQNSECPNDKACIREKCADPCPGSCGYNAQCKVI  241 (289)
Q Consensus       167 ~~~C~--~~~C~~~~--~C~~~~-g~~~C~C~~G~~g~~~~c~~~C~~~~~C~~~~~c~~~~c~~~c~~~C~~~~~C~~~  241 (289)
                      ++.|.  .+.|...+  .|+... ++|.|.|.|||.|++..    |.++|+|..+              .|++.++|+|+
T Consensus       783 ~n~Ce~g~h~C~i~g~a~c~~hGgs~y~C~CLPGfsGDG~~----c~dvDeC~ps--------------rChp~A~Cynt  844 (1289)
T KOG1214|consen  783 ANPCEDGSHTCAIAGQARCVHHGGSTYSCACLPGFSGDGHQ----CTDVDECSPS--------------RCHPAATCYNT  844 (1289)
T ss_pred             CCccccCccccCcCCceEEEecCCceEEEeecCCccCCccc----cccccccCcc--------------ccCCCceEecC
Confidence            34454  23455444  455554 45999999999999764    4678999865              79999999999


Q ss_pred             CCCceeeCCCCCccCCCCCCCC
Q psy13158        242 NHTPTCTCPDGFIGDAFLSCHP  263 (289)
Q Consensus       242 ~g~~~C~C~~G~~g~~~~~C~~  263 (289)
                      .|+|.|.|.+||.|++.+ |.+
T Consensus       845 pgsfsC~C~pGy~GDGf~-CVP  865 (1289)
T KOG1214|consen  845 PGSFSCRCQPGYYGDGFQ-CVP  865 (1289)
T ss_pred             CCcceeecccCccCCCce-ecC
Confidence            999999999999999986 875

>KOG1219|consensus Back     alignment and domain information
>KOG1214|consensus Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>KOG1217|consensus Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>KOG1217|consensus Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>KOG4260|consensus Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>KOG1225|consensus Back     alignment and domain information
>KOG4260|consensus Back     alignment and domain information
>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins Back     alignment and domain information
>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>KOG1225|consensus Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>PF12662 cEGF: Complement Clr-like EGF-like Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>PF06247 Plasmod_Pvs28: Plasmodium ookinete surface protein Pvs28; InterPro: IPR010423 This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium Back     alignment and domain information
>PF12662 cEGF: Complement Clr-like EGF-like Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A Back     alignment and domain information
>KOG1226|consensus Back     alignment and domain information
>PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A Back     alignment and domain information
>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A Back     alignment and domain information
>PF06247 Plasmod_Pvs28: Plasmodium ookinete surface protein Pvs28; InterPro: IPR010423 This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium Back     alignment and domain information
>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>KOG0994|consensus Back     alignment and domain information
>KOG0994|consensus Back     alignment and domain information
>PF12946 EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 This EGF-like domain is found at the C terminus of the malaria parasite MSP1 protein Back     alignment and domain information
>KOG1226|consensus Back     alignment and domain information
>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity Back     alignment and domain information
>PF12946 EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 This EGF-like domain is found at the C terminus of the malaria parasite MSP1 protein Back     alignment and domain information
>PF01683 EB: EB module; InterPro: IPR006149 The EB domain has no known function Back     alignment and domain information
>smart00051 DSL delta serrate ligand Back     alignment and domain information
>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query289
2dtg_E 897 Insulin receptor; IR ectodomain, X-RAY crystallogr 1e-04
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 3e-04
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
 Score = 42.2 bits (98), Expect = 1e-04
 Identities = 42/241 (17%), Positives = 58/241 (24%), Gaps = 31/241 (12%)

Query: 36  SCRPGYIGSPPNCRPECVMNSECPSHEACIKIPECIQNSECPYDKAC-IREKCVDPCPGS 94
           S    +I    +   EC     CP      K           + + C     C   CP  
Sbjct: 139 SVEDNHIVLNKDDNEECG--DICPGTAKG-KTNCPATVINGQFVERCWTHSHCQKVCPTI 195

Query: 95  CGYGAVCTVINHSNEKCQDPCPGSCGYNAECKVINHNPICSCSQGYIGDGFSGCYPKPPE 154
           C               C   C G+C    +         C   + +  DG   C      
Sbjct: 196 CKSHG----CTAEGLCCHSECLGNCSQPDDPT------KCVACRNFYLDG--RCVE---T 240

Query: 155 VPPPPQQDVQEYVNPCVPSPCGLYSQCRDIGGSPSCSCLPNYIGAPPNCRPECLQNSECP 214
            PPP              S C           +        Y+     C PEC       
Sbjct: 241 CPPPYYHFQDWRCVNF--SFC---QDLHHKCKNSRRQGCHQYVIHNNKCIPECPSGYTMN 295

Query: 215 NDKACIREKCADPCPGSCGYNAQCKVINHTPT------CTCPDGFIGDAFLSCHPKPPER 268
           +        C  PCP  C      K I+   +      CT  +G +       +    E 
Sbjct: 296 SSNLLC-TPCLGPCPKVCHLLEGEKTIDSVTSAQELRGCTVINGSLIINIRGGNNLAAEL 354

Query: 269 E 269
           E
Sbjct: 355 E 355
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query289
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 99.8
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 99.8
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 99.8
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 99.7
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 99.69
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 99.68
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 99.67
2bou_A143 EGF-like module containing mucin-like hormone rece 99.67
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 99.66
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 99.64
2bou_A143 EGF-like module containing mucin-like hormone rece 99.57
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 99.52
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 99.5
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 99.49
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 99.45
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 99.43
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 99.37
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 99.29
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 99.23
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 99.22
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 99.22
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 99.21
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 99.17
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 99.17
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 99.16
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 99.14
1aut_L114 Activated protein C; serine proteinase, plasma cal 99.07
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 99.06
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 99.04
1aut_L114 Activated protein C; serine proteinase, plasma cal 99.03
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 99.01
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 99.01
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 99.0
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 99.0
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 98.95
2vh0_B134 Activated factor XA light chain; serine protease, 98.9
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 98.89
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 98.88
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 98.79
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 98.78
2vh0_B134 Activated factor XA light chain; serine protease, 98.76
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 98.75
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 98.71
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 98.69
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 98.66
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 98.66
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 98.63
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 98.59
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 98.56
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 98.52
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 98.52
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 98.5
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 98.39
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 98.38
3v65_B 386 Low-density lipoprotein receptor-related protein; 98.37
2k2s_B61 Micronemal protein 6; microneme protein complex, c 98.34
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 98.3
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 98.3
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 98.27
3v65_B 386 Low-density lipoprotein receptor-related protein; 98.25
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 98.19
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 98.06
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 98.04
1a3p_A45 Epidermal growth factor; disulfide connectivities, 97.99
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 97.98
2k2s_B61 Micronemal protein 6; microneme protein complex, c 97.97
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 97.96
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 97.91
2kl7_A71 Fibulin-4; secreted, calcium, disease mutation, di 97.87
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 97.81
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 97.8
2kl7_A71 Fibulin-4; secreted, calcium, disease mutation, di 97.78
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 97.76
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 97.74
1a3p_A45 Epidermal growth factor; disulfide connectivities, 97.74
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 97.71
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 97.69
1gl4_A285 Nidogen-1, entactin; immunoglobulin-like domain, e 97.61
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 97.58
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 97.57
1gl4_A 285 Nidogen-1, entactin; immunoglobulin-like domain, e 97.54
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 97.53
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 97.4
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 97.33
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 97.23
1nql_B53 Epidermal growth factor; cell surface receptor, ty 97.19
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 97.12
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 97.1
1nql_B53 Epidermal growth factor; cell surface receptor, ty 96.96
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 96.87
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 96.84
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 96.83
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 96.82
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 96.8
1ob1_C99 Major merozoite surface protein; immune system, im 96.62
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 96.61
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 96.54
1n1i_A105 Merozoite surface protein-1; MSP1, malaria, surfac 96.53
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 96.47
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 96.42
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 96.39
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 96.38
1q4g_A 553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 96.29
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 96.18
3nt1_A 587 Prostaglandin-endoperoxide synthase 2; prostagland 96.03
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 95.67
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 95.54
1ob1_C99 Major merozoite surface protein; immune system, im 95.51
2wph_E59 Coagulation factor IXA light chain; serine proteas 94.99
1n1i_A105 Merozoite surface protein-1; MSP1, malaria, surfac 94.97
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 94.91
2wph_E59 Coagulation factor IXA light chain; serine proteas 94.77
3cfw_A164 L-selectin; EGF, cell adhesion, EGF-like domain, g 94.14
3cfw_A164 L-selectin; EGF, cell adhesion, EGF-like domain, g 93.86
2fd6_A122 Urokinase-type plasminogen activator; UPAR, ATF, A 93.85
1szb_A170 Mannose binding lectin-associated serine protease- 93.74
1q4g_A 553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 93.58
2fd6_A122 Urokinase-type plasminogen activator; UPAR, ATF, A 93.5
3asi_A410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 92.79
3nt1_A 587 Prostaglandin-endoperoxide synthase 2; prostagland 92.35
1xdt_R79 Hbegf, heparin-binding epidermal growth factor; co 92.14
1iox_A50 Betacellulin; EGF-like fold, hormone/growth factor 92.04
3f1s_B283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 91.68
3e50_C50 Protransforming growth factor alpha; IDE, TGF-alph 91.61
1iox_A50 Betacellulin; EGF-like fold, hormone/growth factor 91.54
2rnl_A50 Amphiregulin; AR, colorectum cell-derived growth f 91.53
1nzi_A159 Complement C1S component; calcium, innate immunity 91.44
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 91.36
3e50_C50 Protransforming growth factor alpha; IDE, TGF-alph 90.08
2i9a_A145 Urokinase-type plasminogen activator; growth facto 90.03
2rnl_A50 Amphiregulin; AR, colorectum cell-derived growth f 89.24
1xdt_R79 Hbegf, heparin-binding epidermal growth factor; co 89.01
1g1t_A157 E-selectin; EGF, adhesion molecule, SLEX, immune s 88.72
3v64_C 349 Agrin; beta propeller, laminin-G, signaling, prote 88.31
3qcw_A1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 87.73
2ygo_A188 WIF-1, WNT inhibitory factor 1; signaling protein, 87.18
3f1s_B 283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 86.45
1szb_A170 Mannose binding lectin-associated serine protease- 86.4
2i9a_A145 Urokinase-type plasminogen activator; growth facto 85.89
3fby_A 551 COMP, cartilage oligomeric matrix protein; signatu 84.93
1g1t_A157 E-selectin; EGF, adhesion molecule, SLEX, immune s 83.11
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 81.96
1nzi_A159 Complement C1S component; calcium, innate immunity 81.65
3fby_A 551 COMP, cartilage oligomeric matrix protein; signatu 81.6
3asi_A 410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 80.54
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
Probab=99.80  E-value=8e-21  Score=155.25  Aligned_cols=150  Identities=22%  Similarity=0.470  Sum_probs=116.3

Q ss_pred             CCCCCCCCCeeeeCCCCceeeCCCCccCCCCCCcccCCCCCCCCCCCccccCCCcccCCCCCCCCccccccccCCCCCCC
Q psy13158         16 YPSPCGPYSECRNINGGPSCSCRPGYIGSPPNCRPECVMNSECPSHEACIKIPECIQNSECPYDKACIREKCVDPCPGSC   95 (289)
Q Consensus        16 ~~~~C~~~~~C~n~~gs~~C~C~~Gf~g~~~~C~~~C~~~~~c~~~~~C~~~~~C~~~~~c~~~~~c~~~~c~~~C~g~~   95 (289)
                      .++||. +++|+++.++|.|.|++||+|.               ++..|.++++|....                     
T Consensus         9 ~~~pC~-ng~C~~~~g~~~C~C~~G~~g~---------------~~~~C~~id~C~~~~---------------------   51 (186)
T 1z1y_A            9 VDTICX-NGQLVQMSNHFXCMCNEGLVHL---------------SENTCEEXNECXXET---------------------   51 (186)
T ss_dssp             TTCCCB-TEEEEECSSCEEEEECTTEEEE---------------ETTEEEECCCCSGGG---------------------
T ss_pred             CCCCCC-CCEeECCCCCeEeECCCCCccC---------------CCCccCCCCcccCCC---------------------
Confidence            368898 4699999999999999999986               123565555554220                     


Q ss_pred             CCCCeeeeccCCCCcccCCCCCCCCCCCeeeecC-----CCceeecCCCCccCCCCCCCCCCCCCCCCCCCCCccccCCC
Q psy13158         96 GYGAVCTVINHSNEKCQDPCPGSCGYNAECKVIN-----HNPICSCSQGYIGDGFSGCYPKPPEVPPPPQQDVQEYVNPC  170 (289)
Q Consensus        96 ~~~~~C~~~~~~~~~c~~~c~~~C~~~~~C~~~~-----g~~~C~C~~G~~~~~~~~C~~~~~~~~~~~~~~~~~~~~~C  170 (289)
                                       .  +++|.++++|++..     ++|.|.|++||.+....                  -.+++|
T Consensus        52 -----------------~--~~~C~~~~~C~~~~~~~~~g~y~C~C~~G~~g~~~~------------------C~~d~C   94 (186)
T 1z1y_A           52 -----------------L--GXACGEFGQCIENPDPAQVNMYXCGCIEGYTLXEDT------------------CVLDVC   94 (186)
T ss_dssp             -----------------T--TSEEETTEEEEECSSTTSSCSEEEEECTTEEEETTE------------------EEEGGG
T ss_pred             -----------------C--CCCCCCCCEeecCCCCcCCCCEECCCCCCCccCCCC------------------CCCCcC
Confidence                             0  14577778999988     89999999999987532                  237889


Q ss_pred             CCCCCCCCCeee----ecCCCCeeeCCCCcccC---CCCCccCCCCC--CCCCCCCccccCcccCCCCCCC-CCCCeeee
Q psy13158        171 VPSPCGLYSQCR----DIGGSPSCSCLPNYIGA---PPNCRPECLQN--SECPNDKACIREKCADPCPGSC-GYNAQCKV  240 (289)
Q Consensus       171 ~~~~C~~~~~C~----~~~g~~~C~C~~G~~g~---~~~c~~~C~~~--~~C~~~~~c~~~~c~~~c~~~C-~~~~~C~~  240 (289)
                      ...+|.+++.|+    ++.++|.|.|++||+|.   +..    |.++  ++|.               .+| .++++|++
T Consensus        95 ~~~~C~~~g~C~~~~~~~~g~~~C~C~~Gy~g~~~~~~~----C~~~~~~~C~---------------~~C~~~~~~C~n  155 (186)
T 1z1y_A           95 QYXNCGESGECIVEYLSEIQSAGCSCAIGXVPNPEDEXX----CTXTGETACQ---------------LXCNTDNEVCXN  155 (186)
T ss_dssp             TTCCCCTTEEEEEEEETTEEEEEEEECTEEEEETTTTTE----EEEEECCCCC---------------CCCCTTTEEEEE
T ss_pred             cCCCCCCCCEEeeCCcCCCCCceEECCCCCcccCCCCCc----ceEcCCCccc---------------ccccccCcceec
Confidence            888999889998    77889999999999983   233    3443  5664               268 78899999


Q ss_pred             CCCCceeeCCCCCccCCC
Q psy13158        241 INHTPTCTCPDGFIGDAF  258 (289)
Q Consensus       241 ~~g~~~C~C~~G~~g~~~  258 (289)
                      +.++|+|.|++||+|+..
T Consensus       156 ~~g~y~C~C~~G~~g~~~  173 (186)
T 1z1y_A          156 VEGVYXCQCMEGFTFDXE  173 (186)
T ss_dssp             ETTEEEEEECTTCEEETT
T ss_pred             CCCCeeeECCCCCccCcc
Confidence            999999999999999854
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A Back     alignment and structure
>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Back     alignment and structure
>1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Back     alignment and structure
>3cfw_A L-selectin; EGF, cell adhesion, EGF-like domain, glycoprotein, membrane, sushi, transmembrane; HET: NAG MAN BMA; 2.20A {Homo sapiens} Back     alignment and structure
>2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A Back     alignment and structure
>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Back     alignment and structure
>2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... Back     alignment and structure
>1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Back     alignment and structure
>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A Back     alignment and structure
>1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A Back     alignment and structure
>2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A Back     alignment and structure
>2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* Back     alignment and structure
>2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Back     alignment and structure
>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Back     alignment and structure
>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* Back     alignment and structure
>3fby_A COMP, cartilage oligomeric matrix protein; signature domain, cell adhesion, disease mutation, dwarfism, EGF-like domain, glycoprotein, secreted; HET: NAG MAN; 3.15A {Homo sapiens} Back     alignment and structure
>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Back     alignment and structure
>1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>3fby_A COMP, cartilage oligomeric matrix protein; signature domain, cell adhesion, disease mutation, dwarfism, EGF-like domain, glycoprotein, secreted; HET: NAG MAN; 3.15A {Homo sapiens} Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query289
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 98.95
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 98.93
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 98.9
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 98.85
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.8
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 98.72
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 98.66
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 98.65
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.64
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.64
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.55
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.48
d1apqa_53 Complement protease C1R {Human (Homo sapiens) [Tax 98.41
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 98.4
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 98.4
d1uzka243 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.39
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.37
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 98.34
d1dx5i340 Thrombomodulin, different EGF-like domains {Human 98.33
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 98.32
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 98.3
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 98.28
d1i0ua241 Low density lipoprotein (LDL) receptor, different 98.26
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 98.26
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 98.24
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 98.21
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 98.2
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 98.2
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.19
d1uzka243 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.11
d1apqa_53 Complement protease C1R {Human (Homo sapiens) [Tax 98.05
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 98.03
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 98.01
d1szba245 Mannose-binding protein associated serine protease 98.0
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.93
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 97.89
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 97.87
d1nt0a345 Mannose-binding protein associated serine protease 97.87
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 97.86
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 97.83
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 97.8
d1dx5i340 Thrombomodulin, different EGF-like domains {Human 97.7
d1i0ua241 Low density lipoprotein (LDL) receptor, different 97.65
d1nt0a345 Mannose-binding protein associated serine protease 97.6
d1szba245 Mannose-binding protein associated serine protease 97.56
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 97.55
d3bpse140 Low density lipoprotein (LDL) receptor, different 97.54
d1nzia242 Complement C1S component {Human (Homo sapiens) [Ta 97.49
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 97.45
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 97.42
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 97.35
d3bpse140 Low density lipoprotein (LDL) receptor, different 97.33
d1nzia242 Complement C1S component {Human (Homo sapiens) [Ta 97.32
d1emoa239 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.28
d1emoa239 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.0
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 96.9
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 96.77
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 96.32
d1kigl_51 Factor X, N-terminal module {Cow (Bos taurus) [Tax 96.21
d1autl250 Activated protein c (autoprothrombin IIa) {Human ( 95.64
d2p3ua151 Factor X, N-terminal module {Human (Homo sapiens) 95.42
d1k36a_46 Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI 95.31
d1kigl_51 Factor X, N-terminal module {Cow (Bos taurus) [Tax 95.3
d1autl250 Activated protein c (autoprothrombin IIa) {Human ( 95.16
d2p3ua151 Factor X, N-terminal module {Human (Homo sapiens) 94.93
d1k36a_46 Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI 94.71
d1moxc_49 Transforming growth factor alpha {Human (Homo sapi 94.22
d1ioxa_50 Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] 94.11
d1ioxa_50 Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] 94.06
d1ijqa250 Low density lipoprotein (LDL) receptor, different 93.56
d1ijqa250 Low density lipoprotein (LDL) receptor, different 93.18
d1moxc_49 Transforming growth factor alpha {Human (Homo sapi 92.98
d2i9aa140 Plasminogen activator (urokinase-type) {Human (Hom 92.42
d2i9aa140 Plasminogen activator (urokinase-type) {Human (Hom 91.75
d1rfnb_57 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 90.9
d1dx5i143 Thrombomodulin, different EGF-like domains {Human 90.69
d1rfnb_57 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 87.61
d2bz6l153 Coagulation factor VIIa {Human (Homo sapiens) [Tax 84.88
d1xdtr_41 Heparin-binding epidermal growth factor, HBEGF {Hu 84.36
d1xdtr_41 Heparin-binding epidermal growth factor, HBEGF {Hu 83.24
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: Knottins (small inhibitors, toxins, lectins)
superfamily: EGF/Laminin
family: EGF-type module
domain: Neurogenic locus notch homolog protein 1, Notch1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=98.95  E-value=3.2e-10  Score=66.89  Aligned_cols=38  Identities=34%  Similarity=0.803  Sum_probs=35.0

Q ss_pred             CCcCCCC--CCCCCCCCeeeeCCCCceeeCCCCccCCCCCCc
Q psy13158         10 LATLECY--PSPCGPYSECRNINGGPSCSCRPGYIGSPPNCR   49 (289)
Q Consensus        10 ~did~C~--~~~C~~~~~C~n~~gs~~C~C~~Gf~g~~~~C~   49 (289)
                      .|||||.  ++||.++|+|+++.++|.|.|++||+|.  +|+
T Consensus         1 qDideC~~~~~pC~n~g~C~n~~g~y~C~C~~G~~G~--~Ce   40 (42)
T d2vj3a1           1 QDVDECSLGANPCEHAGKCINTLGSFECQCLQGYTGP--RCE   40 (42)
T ss_dssp             CCCCTTTSSSCSSSTTCEEEECSSSEEEECCTTEEST--TSC
T ss_pred             CCCccccCCCCCCCCCcEeECCCCCEEeECCCCCcCC--CCc
Confidence            3899999  6899999999999999999999999998  765
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i1 g.3.11.1 (I:345-387) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure