Psyllid ID: psy13308


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160------
NYITWCDPTTYREVTKVRHGAVAPWPLNIYLTYKKKLTVQHRLKTLKWLEKSLDQVYKDVDKCCQSLSERLEKNNFFFKDKPTELDALLFGHIYAVLTTPLPNNRFASTIRAYPNLVEHCTRIEQNYFKKDSTEAKYFLWLTNLSSVVVRQWTSDLEVGGSISQLT
ccEEccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcHHcccccccHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHccccccHHHHHHHHccHHHHHHHHHHHHcccccccHHHHHHHHHcccccccccccccHHHHHccccccc
cEEEEEccccHHHccHHHHccccccccHHHcHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHccccccHHHHHHHHccHHHHHHHHHHHHHHcccccHHHHHHHHHHHcEEEEEEEccccccccccHHccc
nyitwcdpttyrevtkvrhgavapwplniyLTYKKKLTVQHRLKTLKWLEKSLDQVYKDVDKCCQSLSERLeknnfffkdkptELDALLFGHIYAvlttplpnnrfastirayPNLVEHCTRIEqnyfkkdstEAKYFLWLTNLSSVVVRQWtsdlevggsisqlt
nyitwcdpttyrevtkvrhgavapwplNIYLTYKKKLTVQHRLKTLKWLEKSLDQVYKDVDKCCQSLSERLEKNNFFFKDKPTELDALLFGHIYAVLTTPLPNNRFASTIRAYPNLVEHCTRIEQNYFKKDSTEAKYFLWLTNLSSVVVRQWTsdlevggsisqlt
NYITWCDPTTYREVTKVRHGAVAPWPLNIYLTYKKKLTVQHRLKTLKWLEKSLDQVYKDVDKCCQSLSERLEKNNFFFKDKPTELDALLFGHIYAVLTTPLPNNRFASTIRAYPNLVEHCTRIEQNYFKKDSTEAKYFLWLTNLSSVVVRQWTSDLEVGGSISQLT
*YITWCDPTTYREVTKVRHGAVAPWPLNIYLTYKKKLTVQHRLKTLKWLEKSLDQVYKDVDKCCQSLSERLEKNNFFFKDKPTELDALLFGHIYAVLTTPLPNNRFASTIRAYPNLVEHCTRIEQNYFKKDSTEAKYFLWLTNLSSVVVRQWTSDLEV********
NYITWCDPTTYREVTKVRHGAVAPWPLNIYLTYKKKLTVQHRLKTLKWLEKSLDQVYKDVDKCCQSLSERLEKNNFFFKDKPTELDALLFGHIYAVLTTPLPNNRFASTIRAYPNLVEHCTRIEQNYFKKDST************************VGGSIS*L*
NYITWCDPTTYREVTKVRHGAVAPWPLNIYLTYKKKLTVQHRLKTLKWLEKSLDQVYKDVDKCCQSLSERLEKNNFFFKDKPTELDALLFGHIYAVLTTPLPNNRFASTIRAYPNLVEHCTRIEQNYFKKDSTEAKYFLWLTNLSSVVVRQWTSDLEVGGSISQLT
NYITWCDPTTYREVTKVRHGAVAPWPLNIYLTYKKKLTVQHRLKTLKWLEKSLDQVYKDVDKCCQSLSERLEKNNFFFKDKPTELDALLFGHIYAVLTTPLPNNRFASTIRAYPNLVEHCTRIEQNYFKKDSTEAKYFLWLTNLSSVVVRQWTSDLEVGGSI****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NYITWCDPTTYREVTKVRHGAVAPWPLNIYLTYKKKLTVQHRLKTLKWLEKSLDQVYKDVDKCCQSLSERLEKNNFFFKDKPTELDALLFGHIYAVLTTPLPNNRFASTIRAYPNLVEHCTRIEQNYFKKDSTEAKYFLWLTNLSSVVVRQWTSDLEVGGSISQLT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query166 2.2.26 [Sep-21-2011]
Q2L969267 Metaxin-2 OS=Sus scrofa G yes N/A 0.789 0.490 0.488 4e-36
O75431263 Metaxin-2 OS=Homo sapiens yes N/A 0.771 0.486 0.492 7e-36
O88441263 Metaxin-2 OS=Mus musculus yes N/A 0.771 0.486 0.484 5e-35
Q4VBW0313 Metaxin-3 OS=Danio rerio no N/A 0.795 0.421 0.304 7e-15
P47802317 Metaxin-1 OS=Mus musculus no N/A 0.783 0.410 0.323 8e-15
P34599230 Metaxin-2 homolog OS=Caen no N/A 0.584 0.421 0.381 1e-14
Q27HK4317 Metaxin-1 OS=Sus scrofa G no N/A 0.783 0.410 0.301 5e-13
Q4R3I0317 Metaxin-1 OS=Macaca fasci N/A N/A 0.783 0.410 0.316 1e-12
A8XWD1312 Metaxin-1 homolog OS=Caen N/A N/A 0.759 0.403 0.338 1e-12
O45503312 Metaxin-1 homolog OS=Caen no N/A 0.759 0.403 0.330 4e-12
>sp|Q2L969|MTX2_PIG Metaxin-2 OS=Sus scrofa GN=MTX2 PE=2 SV=1 Back     alignment and function desciption
 Score =  150 bits (379), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 64/131 (48%), Positives = 91/131 (69%)

Query: 2   YITWCDPTTYREVTKVRHGAVAPWPLNIYLTYKKKLTVQHRLKTLKWLEKSLDQVYKDVD 61
           Y+ WCD  T  E+T  R+G+  PWPLN  L Y+K+  V+ ++K + W  K+LDQV +DVD
Sbjct: 128 YLQWCDEATVGEITHARYGSPYPWPLNHILAYQKQWEVKRKMKAIGWGNKTLDQVLEDVD 187

Query: 62  KCCQSLSERLEKNNFFFKDKPTELDALLFGHIYAVLTTPLPNNRFASTIRAYPNLVEHCT 121
           +CCQ+LS+RL    +FF  +PTELDAL+FGH+Y +LTT L N+  +  ++ Y NL+  C 
Sbjct: 188 QCCQALSQRLGTQPYFFNKQPTELDALVFGHLYTILTTQLTNDELSEKVKNYSNLLAFCR 247

Query: 122 RIEQNYFKKDS 132
           RIEQ+YF+  S
Sbjct: 248 RIEQHYFEDHS 258




Involved in transport of proteins into the mitochondrion.
Sus scrofa (taxid: 9823)
>sp|O75431|MTX2_HUMAN Metaxin-2 OS=Homo sapiens GN=MTX2 PE=1 SV=1 Back     alignment and function description
>sp|O88441|MTX2_MOUSE Metaxin-2 OS=Mus musculus GN=Mtx2 PE=1 SV=1 Back     alignment and function description
>sp|Q4VBW0|MTX3_DANRE Metaxin-3 OS=Danio rerio GN=mtx3 PE=2 SV=2 Back     alignment and function description
>sp|P47802|MTX1_MOUSE Metaxin-1 OS=Mus musculus GN=Mtx1 PE=1 SV=1 Back     alignment and function description
>sp|P34599|MTX2_CAEEL Metaxin-2 homolog OS=Caenorhabditis elegans GN=mtx-2 PE=2 SV=3 Back     alignment and function description
>sp|Q27HK4|MTX1_PIG Metaxin-1 OS=Sus scrofa GN=MTX1 PE=2 SV=1 Back     alignment and function description
>sp|Q4R3I0|MTX1_MACFA Metaxin-1 OS=Macaca fascicularis GN=MTX1 PE=2 SV=1 Back     alignment and function description
>sp|A8XWD1|MTX1_CAEBR Metaxin-1 homolog OS=Caenorhabditis briggsae GN=mtx-1 PE=3 SV=1 Back     alignment and function description
>sp|O45503|MTX1_CAEEL Metaxin-1 homolog OS=Caenorhabditis elegans GN=mtx-1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query166
321468529 272 hypothetical protein DAPPUDRAFT_304425 [ 0.777 0.474 0.550 2e-38
270009997 312 hypothetical protein TcasGA2_TC009327 [T 0.789 0.419 0.511 8e-37
91085775259 PREDICTED: similar to metaxin 2 [Triboli 0.789 0.505 0.511 8e-37
307194092 314 Metaxin-2 [Harpegnathos saltator] 0.813 0.429 0.525 1e-36
255742481 276 metaxin 2 [Callorhinchus milii] gi|38791 0.813 0.489 0.466 4e-35
155372199264 metaxin-2 [Bos taurus] gi|426220821|ref| 0.813 0.511 0.474 5e-35
440895806251 Metaxin-2, partial [Bos grunniens mutus] 0.813 0.537 0.474 8e-35
56605654263 metaxin-2 [Rattus norvegicus] gi|5556278 0.771 0.486 0.492 1e-34
332209411263 PREDICTED: metaxin-2 isoform 1 [Nomascus 0.771 0.486 0.492 1e-34
444723475 389 Metaxin-2 [Tupaia chinensis] 0.771 0.329 0.5 1e-34
>gi|321468529|gb|EFX79513.1| hypothetical protein DAPPUDRAFT_304425 [Daphnia pulex] Back     alignment and taxonomy information
 Score =  163 bits (412), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 97/129 (75%)

Query: 2   YITWCDPTTYREVTKVRHGAVAPWPLNIYLTYKKKLTVQHRLKTLKWLEKSLDQVYKDVD 61
           YI+WCD T   EVT  R+G+V  WPLN  LT++K+  V  +L  L W+ K+LD+VY+DVD
Sbjct: 130 YISWCDETVLNEVTGPRYGSVYSWPLNTLLTWRKQKQVAKKLTALGWITKTLDEVYEDVD 189

Query: 62  KCCQSLSERLEKNNFFFKDKPTELDALLFGHIYAVLTTPLPNNRFASTIRAYPNLVEHCT 121
            CC +LSERL  + +FF D+ TELDA++FGH++ +LTTPLP+NR AS +R+YPNLVE C 
Sbjct: 190 HCCNALSERLGNHLYFFNDRCTELDAVVFGHVFTLLTTPLPDNRLASIVRSYPNLVEACQ 249

Query: 122 RIEQNYFKK 130
            +E+ YF+K
Sbjct: 250 FLEKTYFQK 258




Source: Daphnia pulex

Species: Daphnia pulex

Genus: Daphnia

Family: Daphniidae

Order: Diplostraca

Class: Branchiopoda

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|270009997|gb|EFA06445.1| hypothetical protein TcasGA2_TC009327 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|91085775|ref|XP_974308.1| PREDICTED: similar to metaxin 2 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|307194092|gb|EFN76553.1| Metaxin-2 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|255742481|gb|ACU32593.1| metaxin 2 [Callorhinchus milii] gi|387915910|gb|AFK11564.1| metaxin 2 [Callorhinchus milii] Back     alignment and taxonomy information
>gi|155372199|ref|NP_001094710.1| metaxin-2 [Bos taurus] gi|426220821|ref|XP_004004610.1| PREDICTED: metaxin-2 [Ovis aries] gi|151554696|gb|AAI48005.1| MTX2 protein [Bos taurus] gi|296490655|tpg|DAA32768.1| TPA: metaxin 2 [Bos taurus] Back     alignment and taxonomy information
>gi|440895806|gb|ELR47905.1| Metaxin-2, partial [Bos grunniens mutus] Back     alignment and taxonomy information
>gi|56605654|ref|NP_001008287.1| metaxin-2 [Rattus norvegicus] gi|55562783|gb|AAH86360.1| Metaxin 2 [Rattus norvegicus] gi|149022298|gb|EDL79192.1| metaxin 2 [Rattus norvegicus] Back     alignment and taxonomy information
>gi|332209411|ref|XP_003253805.1| PREDICTED: metaxin-2 isoform 1 [Nomascus leucogenys] Back     alignment and taxonomy information
>gi|444723475|gb|ELW64130.1| Metaxin-2 [Tupaia chinensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query166
UNIPROTKB|A6QLL2264 MTX2 "MTX2 protein" [Bos tauru 0.813 0.511 0.474 1.3e-34
RGD|1306473263 Mtx2 "metaxin 2" [Rattus norve 0.771 0.486 0.492 1.7e-34
UNIPROTKB|Q2L969267 MTX2 "Metaxin-2" [Sus scrofa ( 0.789 0.490 0.488 2.8e-34
UNIPROTKB|O75431263 MTX2 "Metaxin-2" [Homo sapiens 0.771 0.486 0.492 3.6e-34
UNIPROTKB|Q8IZ68253 MTX2 "Metaxin-2" [Homo sapiens 0.771 0.505 0.492 3.6e-34
UNIPROTKB|E2RML8267 MTX2 "Uncharacterized protein" 0.771 0.479 0.492 4.6e-34
MGI|MGI:1859652263 Mtx2 "metaxin 2" [Mus musculus 0.771 0.486 0.484 2.5e-33
UNIPROTKB|E1BVN1268 MTX2 "Uncharacterized protein" 0.807 0.5 0.459 1.1e-32
FB|FBgn0036920269 CG8004 [Drosophila melanogaste 0.771 0.475 0.396 9.7e-25
UNIPROTKB|C9JAZ1229 MTX2 "Metaxin-2" [Homo sapiens 0.530 0.384 0.5 1.9e-24
UNIPROTKB|A6QLL2 MTX2 "MTX2 protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 375 (137.1 bits), Expect = 1.3e-34, P = 1.3e-34
 Identities = 64/135 (47%), Positives = 93/135 (68%)

Query:     2 YITWCDPTTYREVTKVRHGAVAPWPLNIYLTYKKKLTVQHRLKTLKWLEKSLDQVYKDVD 61
             Y+ WCD  T  E+T  R+G+  PWPLN  L Y+K+  V+ ++K + W  K+LDQV +DVD
Sbjct:   128 YLQWCDDATVGEITHARYGSPYPWPLNHILAYQKQWEVKRKMKAIGWGNKTLDQVLEDVD 187

Query:    62 KCCQSLSERLEKNNFFFKDKPTELDALLFGHIYAVLTTPLPNNRFASTIRAYPNLVEHCT 121
             +CCQ+LS+RL    +FF  +PTELDAL+FGH+Y +LTT + N+  +  ++ Y NL+  C 
Sbjct:   188 QCCQALSQRLGTQPYFFNKQPTELDALVFGHLYTILTTQMTNDELSEKVKNYSNLLAFCR 247

Query:   122 RIEQNYFKKDSTEAK 136
             RIEQ+YF K S+  +
Sbjct:   248 RIEQHYFGKGSSSIR 262




GO:0006626 "protein targeting to mitochondrion" evidence=IEA
GO:0005741 "mitochondrial outer membrane" evidence=IEA
RGD|1306473 Mtx2 "metaxin 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q2L969 MTX2 "Metaxin-2" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|O75431 MTX2 "Metaxin-2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q8IZ68 MTX2 "Metaxin-2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2RML8 MTX2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1859652 Mtx2 "metaxin 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E1BVN1 MTX2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
FB|FBgn0036920 CG8004 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|C9JAZ1 MTX2 "Metaxin-2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query166
cd03211126 cd03211, GST_C_Metaxin2, C-terminal, alpha helical 2e-63
cd03212137 cd03212, GST_C_Metaxin1_3, C-terminal, alpha helic 1e-29
cd0319388 cd03193, GST_C_Metaxin, C-terminal, alpha helical 6e-21
pfam11801155 pfam11801, Tom37_C, Tom37 C-terminal domain 2e-06
pfam1341069 pfam13410, GST_C_2, Glutathione S-transferase, C-t 5e-05
cd00299100 cd00299, GST_C_family, C-terminal, alpha helical d 3e-04
>gnl|CDD|198320 cd03211, GST_C_Metaxin2, C-terminal, alpha helical domain of Metaxin 2 Back     alignment and domain information
 Score =  190 bits (484), Expect = 2e-63
 Identities = 74/123 (60%), Positives = 96/123 (78%)

Query: 2   YITWCDPTTYREVTKVRHGAVAPWPLNIYLTYKKKLTVQHRLKTLKWLEKSLDQVYKDVD 61
           YI+WCD  TY EVTK R+G+V PWPLN  L Y+K+  V  +LK L W +KSLDQV+ +V+
Sbjct: 4   YISWCDEETYNEVTKPRYGSVYPWPLNHILAYRKQREVLRKLKALGWSDKSLDQVFDEVE 63

Query: 62  KCCQSLSERLEKNNFFFKDKPTELDALLFGHIYAVLTTPLPNNRFASTIRAYPNLVEHCT 121
           KCCQ+LSE+L  N +FF D+PTELDAL+FGH++ +LTTPLPN+  A+ ++ YPNLVE C 
Sbjct: 64  KCCQALSEKLGTNQYFFGDQPTELDALVFGHLFTILTTPLPNDELAAIVKKYPNLVEFCR 123

Query: 122 RIE 124
           RIE
Sbjct: 124 RIE 126


Glutathione S-transferase (GST) C-terminal domain family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait. Metaxin 2 shares sequence similarity with metaxin 1 but does not contain a C-terminal mitochondrial outer membrane signal-anchor domain. It associates with mitochondrial membranes through its interaction with metaxin 1, which is a component of the mitochondrial preprotein import complex of the outer membrane. The biological function of metaxin 2 is unknown. It is likely that it also plays a role in protein translocation into the mitochondria. However, this has not been experimentally validated. In a recent proteomics study, it has been shown that metaxin 2 is overexpressed in response to lipopolysaccharide-induced liver injury. Length = 126

>gnl|CDD|198321 cd03212, GST_C_Metaxin1_3, C-terminal, alpha helical domain of Metaxin 1, Metaxin 3, and similar proteins Back     alignment and domain information
>gnl|CDD|198302 cd03193, GST_C_Metaxin, C-terminal, alpha helical domain of Metaxin and related proteins Back     alignment and domain information
>gnl|CDD|221231 pfam11801, Tom37_C, Tom37 C-terminal domain Back     alignment and domain information
>gnl|CDD|222111 pfam13410, GST_C_2, Glutathione S-transferase, C-terminal domain Back     alignment and domain information
>gnl|CDD|198286 cd00299, GST_C_family, C-terminal, alpha helical domain of the Glutathione S-transferase family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 166
cd03211126 GST_C_Metaxin2 GST_C family, Metaxin subfamily, Me 100.0
cd03212137 GST_C_Metaxin1_3 GST_C family, Metaxin subfamily, 99.97
KOG3027|consensus257 99.95
KOG3028|consensus313 99.9
KOG4244|consensus281 99.84
PF11801168 Tom37_C: Tom37 C-terminal domain; InterPro: IPR019 99.79
cd0319388 GST_C_Metaxin GST_C family, Metaxin subfamily; com 99.39
PF1341069 GST_C_2: Glutathione S-transferase, C-terminal dom 99.27
PF1449799 GST_C_3: Glutathione S-transferase, C-terminal dom 99.22
PF0004395 GST_C: Glutathione S-transferase, C-terminal domai 99.06
cd03202124 GST_C_etherase_LigE GST_C family, Beta etherase Li 99.02
cd03180110 GST_C_2 GST_C family, unknown subfamily 2; compose 99.02
cd03206100 GST_C_7 GST_C family, unknown subfamily 7; compose 99.01
cd03187118 GST_C_Phi GST_C family, Class Phi subfamily; compo 98.99
cd03189119 GST_C_GTT1_like GST_C family, Saccharomyces cerevi 98.99
cd03186107 GST_C_SspA GST_N family, Stringent starvation prot 98.96
cd03188114 GST_C_Beta GST_C family, Class Beta subfamily; GST 98.95
cd03196115 GST_C_5 GST_C family, unknown subfamily 5; compose 98.94
cd03177118 GST_C_Delta_Epsilon GST_C family, Class Delta and 98.93
cd03209121 GST_C_Mu GST_C family, Class Mu subfamily; GSTs ar 98.93
cd00299100 GST_C_family Glutathione S-transferase (GST) famil 98.9
cd03182117 GST_C_GTT2_like GST_C family, Saccharomyces cerevi 98.87
cd03190142 GST_C_ECM4_like GST_C family, ECM4-like subfamily; 98.86
cd03178113 GST_C_Ure2p_like GST_C family, Ure2p-like subfamil 98.86
cd03207103 GST_C_8 GST_C family, unknown subfamily 8; compose 98.83
cd03181123 GST_C_EFB1gamma GST_C family, Gamma subunit of Elo 98.83
PLN02473214 glutathione S-transferase 98.82
cd03210126 GST_C_Pi GST_C family, Class Pi subfamily; GSTs ar 98.81
cd03201121 GST_C_DHAR GST_C family, Dehydroascorbate Reductas 98.81
PRK10387210 glutaredoxin 2; Provisional 98.81
cd03204111 GST_C_GDAP1 GST_C family, Ganglioside-induced diff 98.81
cd03185126 GST_C_Tau GST_C family, Class Tau subfamily; GSTs 98.8
cd03183126 GST_C_Theta GST_C family, Class Theta subfamily; c 98.79
cd03179105 GST_C_1 GST_C family, unknown subfamily 1; compose 98.79
cd03197149 GST_C_mPGES2 GST_C family; microsomal Prostaglandi 98.78
PRK13972215 GSH-dependent disulfide bond oxidoreductase; Provi 98.77
cd03184124 GST_C_Omega GST_C family, Class Omega subfamily; G 98.77
cd0320096 GST_C_JTV1 GST_C family, JTV-1 subfamily; composed 98.75
cd03198134 GST_C_CLIC GST_C family, Chloride Intracellular Ch 98.75
cd03192104 GST_C_Sigma_like GST_C family, Class Sigma_like; c 98.75
cd03208137 GST_C_Alpha GST_C family, Class Alpha subfamily; G 98.73
cd03191121 GST_C_Zeta GST_C family, Class Zeta subfamily; GST 98.73
PRK09481211 sspA stringent starvation protein A; Provisional 98.68
PLN02395215 glutathione S-transferase 98.67
PRK10542201 glutathionine S-transferase; Provisional 98.64
PRK11752264 putative S-transferase; Provisional 98.59
PTZ00057205 glutathione s-transferase; Provisional 98.59
COG0625211 Gst Glutathione S-transferase [Posttranslational m 98.58
TIGR02182209 GRXB Glutaredoxin, GrxB family. This model include 98.58
KOG0406|consensus231 98.56
TIGR01262210 maiA maleylacetoacetate isomerase. Maleylacetoacet 98.55
cd03195114 GST_C_4 GST_C family, unknown subfamily 4; compose 98.48
cd03203120 GST_C_Lambda GST_C family, Class Lambda subfamily; 98.48
PLN02378213 glutathione S-transferase DHAR1 98.44
cd0320598 GST_C_6 GST_C family, unknown subfamily 6; compose 98.4
cd03194114 GST_C_3 GST_C family, unknown subfamily 3; compose 98.39
TIGR00862236 O-ClC intracellular chloride channel protein. Thes 98.33
PRK10357202 putative glutathione S-transferase; Provisional 98.33
PLN02817265 glutathione dehydrogenase (ascorbate) 98.32
PRK15113214 glutathione S-transferase; Provisional 98.08
PLN02907 722 glutamate-tRNA ligase 98.01
KOG4420|consensus325 97.98
KOG0867|consensus226 97.92
COG0435324 ECM4 Predicted glutathione S-transferase [Posttran 97.64
KOG1695|consensus206 97.32
KOG3029|consensus370 97.08
KOG2903|consensus319 97.01
PF14834117 GST_C_4: Glutathione S-transferase, C-terminal dom 96.24
PF04399132 Glutaredoxin2_C: Glutaredoxin 2, C terminal domain 96.21
KOG0868|consensus217 95.76
cd03199128 GST_C_GRX2 GST_C family, Glutaredoxin 2 (GRX2) sub 94.95
KOG1422|consensus221 94.48
>cd03211 GST_C_Metaxin2 GST_C family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait Back     alignment and domain information
Probab=100.00  E-value=1.1e-32  Score=201.56  Aligned_cols=124  Identities=52%  Similarity=1.030  Sum_probs=117.4

Q ss_pred             CeeeecCCCChHHhhHHHhhccCChhhHHHhHHHHHHHHHHHhhhcccCCCCHHHHHHHHHHHHHHHHhhhccCCccCCC
Q psy13308          1 NYITWCDPTTYREVTKVRHGAVAPWPLNIYLTYKKKLTVQHRLKTLKWLEKSLDQVYKDVDKCCQSLSERLEKNNFFFKD   80 (166)
Q Consensus         1 ly~~W~d~~n~~~~t~~~~~~~~P~pl~~~l~~~~r~~~~~~l~~~G~g~~~~~~~~~~~~~~L~~Le~~L~~~~yl~Gd   80 (166)
                      ||.||+|++||..++++.|...+|+|+|.++++.+|+++++++++||+|+++.+++.+.++++|++|+++||+++||+||
T Consensus         3 l~~~w~d~~~~~~~~~~~~~~~~p~~l~~~~~~~~r~~~~~~l~~~G~gr~~~ee~~~~~~~~l~aLs~~Lg~~~~l~Gd   82 (126)
T cd03211           3 LYISWCDEETYDEVTKPRYGSPYPWPLNHILPYQKQREARRKLKAIGWDDKTLDQVIEEVDQCCQALSQRLGTQPYFFGD   82 (126)
T ss_pred             eeehccCcchHHHHhHHHHccCCCHHHHHHHHHHHHHHHHHHHHhcCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCC
Confidence            69999999999999999999899999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCChhHHHHHHHHHHHhcCCCCCchHHHHHhhChhHHHHHHHHH
Q psy13308         81 KPTELDALLFGHIYAVLTTPLPNNRFASTIRAYPNLVEHCTRIE  124 (166)
Q Consensus        81 ~pT~aD~~vf~~l~~~~~~~~~~~~l~~~l~~~P~L~~y~~Ri~  124 (166)
                      +||++||++|+++..+...+.+++++...+.+||||++|++||.
T Consensus        83 ~pT~~Da~vf~~la~~~~~~~~~~~l~~~~~~~pnL~~y~~Ri~  126 (126)
T cd03211          83 QPTELDALVFGHLFTILTTQLPNDELAEKVKKYSNLLAFCRRIE  126 (126)
T ss_pred             CCcHHHHHHHHHHHHHHhcCCCChHHHHHHHhCcHHHHHHHhcC
Confidence            99999999999999998765666677777899999999999983



Metaxin 2 shares sequence similarity with metaxin 1 but does not contain a C-terminal mitochondrial outer membrane signal-anchor domain. It associates with mitochondrial membranes through its interaction with metaxin 1, which is a component of the mitochondrial preprotein import complex of the outer membrane. The biological function of metaxin 2 is unknown. It is likely that it also plays a role in protein translocation into the mitochondria. However, this has not been experimentally validated. In a recent proteomics study, it has been shown that metaxin 2 is overexpressed in response to lipopolysaccharide-induced liver injury.

>cd03212 GST_C_Metaxin1_3 GST_C family, Metaxin subfamily, Metaxin 1-like proteins; composed of metaxins 1 and 3, and similar proteins Back     alignment and domain information
>KOG3027|consensus Back     alignment and domain information
>KOG3028|consensus Back     alignment and domain information
>KOG4244|consensus Back     alignment and domain information
>PF11801 Tom37_C: Tom37 C-terminal domain; InterPro: IPR019564 Tom37 is one of the outer membrane proteins that make up the TOM complex for guiding cytosolic mitochondrial beta-barrel proteins from the cytosol across the outer mitochondrial membrane into the intramembrane space Back     alignment and domain information
>cd03193 GST_C_Metaxin GST_C family, Metaxin subfamily; composed of metaxins and related proteins Back     alignment and domain information
>PF13410 GST_C_2: Glutathione S-transferase, C-terminal domain; PDB: 4DEJ_H 3IC8_A 2JL4_A 2V6K_B 3CBU_B 1JLW_B 3F6D_B 3G7I_A 3F63_A 3G7J_B Back     alignment and domain information
>PF14497 GST_C_3: Glutathione S-transferase, C-terminal domain; PDB: 3AY8_A 2UZ8_B 1V2A_C 2HNL_A 2YV9_B 3H1N_A 3FR6_A 1Q4J_B 1PA3_B 1OKT_B Back     alignment and domain information
>PF00043 GST_C: Glutathione S-transferase, C-terminal domain; InterPro: IPR004046 In eukaryotes, glutathione S-transferases (GSTs) participate in the detoxification of reactive electrophillic compounds by catalysing their conjugation to glutathione Back     alignment and domain information
>cd03202 GST_C_etherase_LigE GST_C family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor Back     alignment and domain information
>cd03180 GST_C_2 GST_C family, unknown subfamily 2; composed of uncharacterized bacterial proteins, with similarity to GSTs Back     alignment and domain information
>cd03206 GST_C_7 GST_C family, unknown subfamily 7; composed of uncharacterized proteins with similarity to GSTs Back     alignment and domain information
>cd03187 GST_C_Phi GST_C family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins Back     alignment and domain information
>cd03189 GST_C_GTT1_like GST_C family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>cd03186 GST_C_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E Back     alignment and domain information
>cd03188 GST_C_Beta GST_C family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>cd03196 GST_C_5 GST_C family, unknown subfamily 5; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03177 GST_C_Delta_Epsilon GST_C family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03209 GST_C_Mu GST_C family, Class Mu subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>cd00299 GST_C_family Glutathione S-transferase (GST) family, C-terminal alpha helical domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03182 GST_C_GTT2_like GST_C family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>cd03190 GST_C_ECM4_like GST_C family, ECM4-like subfamily; composed of predominantly uncharacterized and taxonomically diverse proteins with similarity to the translation product of the Saccharomyces cerevisiae gene ECM4 Back     alignment and domain information
>cd03178 GST_C_Ure2p_like GST_C family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs Back     alignment and domain information
>cd03207 GST_C_8 GST_C family, unknown subfamily 8; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03181 GST_C_EFB1gamma GST_C family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis Back     alignment and domain information
>PLN02473 glutathione S-transferase Back     alignment and domain information
>cd03210 GST_C_Pi GST_C family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>cd03201 GST_C_DHAR GST_C family, Dehydroascorbate Reductase (DHAR) subfamily; composed of plant-specific DHARs, monomeric enzymes catalyzing the reduction of DHA into ascorbic acid (AsA) using glutathione as the reductant Back     alignment and domain information
>PRK10387 glutaredoxin 2; Provisional Back     alignment and domain information
>cd03204 GST_C_GDAP1 GST_C family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells Back     alignment and domain information
>cd03185 GST_C_Tau GST_C family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03183 GST_C_Theta GST_C family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase Back     alignment and domain information
>cd03179 GST_C_1 GST_C family, unknown subfamily 1; composed of uncharacterized bacterial proteins, with similarity to GSTs Back     alignment and domain information
>cd03197 GST_C_mPGES2 GST_C family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 Back     alignment and domain information
>PRK13972 GSH-dependent disulfide bond oxidoreductase; Provisional Back     alignment and domain information
>cd03184 GST_C_Omega GST_C family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03200 GST_C_JTV1 GST_C family, JTV-1 subfamily; composed of uncharacterized proteins with similarity to the translation product of the human JTV-1 gene Back     alignment and domain information
>cd03198 GST_C_CLIC GST_C family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin, and similar proteins Back     alignment and domain information
>cd03192 GST_C_Sigma_like GST_C family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi, and Alpha Back     alignment and domain information
>cd03208 GST_C_Alpha GST_C family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>cd03191 GST_C_Zeta GST_C family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>PRK09481 sspA stringent starvation protein A; Provisional Back     alignment and domain information
>PLN02395 glutathione S-transferase Back     alignment and domain information
>PRK10542 glutathionine S-transferase; Provisional Back     alignment and domain information
>PRK11752 putative S-transferase; Provisional Back     alignment and domain information
>PTZ00057 glutathione s-transferase; Provisional Back     alignment and domain information
>COG0625 Gst Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02182 GRXB Glutaredoxin, GrxB family Back     alignment and domain information
>KOG0406|consensus Back     alignment and domain information
>TIGR01262 maiA maleylacetoacetate isomerase Back     alignment and domain information
>cd03195 GST_C_4 GST_C family, unknown subfamily 4; composed of uncharacterized proteins with similarity to GSTs Back     alignment and domain information
>cd03203 GST_C_Lambda GST_C family, Class Lambda subfamily; composed of plant-specific class Lambda GSTs Back     alignment and domain information
>PLN02378 glutathione S-transferase DHAR1 Back     alignment and domain information
>cd03205 GST_C_6 GST_C family, unknown subfamily 6; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03194 GST_C_3 GST_C family, unknown subfamily 3; composed of uncharacterized proteins with similarity to GSTs Back     alignment and domain information
>TIGR00862 O-ClC intracellular chloride channel protein Back     alignment and domain information
>PRK10357 putative glutathione S-transferase; Provisional Back     alignment and domain information
>PLN02817 glutathione dehydrogenase (ascorbate) Back     alignment and domain information
>PRK15113 glutathione S-transferase; Provisional Back     alignment and domain information
>PLN02907 glutamate-tRNA ligase Back     alignment and domain information
>KOG4420|consensus Back     alignment and domain information
>KOG0867|consensus Back     alignment and domain information
>COG0435 ECM4 Predicted glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1695|consensus Back     alignment and domain information
>KOG3029|consensus Back     alignment and domain information
>KOG2903|consensus Back     alignment and domain information
>PF14834 GST_C_4: Glutathione S-transferase, C-terminal domain; PDB: 3BBY_A Back     alignment and domain information
>PF04399 Glutaredoxin2_C: Glutaredoxin 2, C terminal domain; InterPro: IPR007494 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>KOG0868|consensus Back     alignment and domain information
>cd03199 GST_C_GRX2 GST_C family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E Back     alignment and domain information
>KOG1422|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query166
1bg5_A254 MAB, fusion protein of alpha-Na,K-ATPase with glut 2e-04
1dug_A234 Chimera of glutathione S-transferase-synthetic lin 4e-04
1b8x_A280 Protein (AML-1B); nuclear matrix targeting signal 6e-04
2fhe_A216 GST, glutathione S-transferase; transferase-substr 9e-04
>1bg5_A MAB, fusion protein of alpha-Na,K-ATPase with glutathione S-transferase; ankyrin binding, carrier crystallization, ION transport; 2.60A {Rattus norvegicus} SCOP: a.45.1.1 c.47.1.5 Length = 254 Back     alignment and structure
 Score = 39.4 bits (92), Expect = 2e-04
 Identities = 22/119 (18%), Positives = 32/119 (26%), Gaps = 29/119 (24%)

Query: 19  HGAVAPWPLNIYLTYKKKLTVQHRLKTLKWLEKSLDQVYKDVDKCCQSLSERLEKNNFFF 78
              V+    +      K   +    + LK  E                   RL    +  
Sbjct: 103 RYGVSRIAYSKDFETLKVDFLSKLPEMLKMFED------------------RLCHKTYLN 144

Query: 79  KDKPTELDALLFGHIYAVLTTPLPNNRFASTIRAYPNLVEHCTRIEQN-----YFKKDS 132
            D  T  D +L+  +  VL            + A+P LV    RIE       Y K   
Sbjct: 145 GDHVTHPDFMLYDALDVVLYM------DPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSK 197


>1dug_A Chimera of glutathione S-transferase-synthetic linker-C-terminal fibrinogen gamma...; gamma chain integrin fragment; HET: GSH; 1.80A {Schistosoma japonicum} SCOP: a.45.1.1 c.47.1.5 PDB: 1gne_A* 3qmz_T 1y6e_A 1m9a_A* 1gtb_A* 1gta_A* 1m99_A* 1m9b_A* 1ua5_A* 1u87_A* 1u88_A* 3crt_A* 3cru_A* 3d0z_A* Length = 234 Back     alignment and structure
>1b8x_A Protein (AML-1B); nuclear matrix targeting signal protein, signal protein; 2.70A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 Length = 280 Back     alignment and structure
>2fhe_A GST, glutathione S-transferase; transferase-substrate complex; HET: GSH; 2.30A {Fasciola hepatica} SCOP: a.45.1.1 c.47.1.5 PDB: 2wrt_A 1fhe_A* Length = 216 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query166
3vk9_A216 Glutathione S-transferase delta; glutathione bindi 99.0
1gnw_A211 Glutathione S-transferase; herbicide detoxificatio 99.0
3iso_A218 Putative glutathione transferase; GST; HET: GSH; 1 98.98
1aw9_A216 Glutathione S-transferase III; herbicide detoxific 98.98
1nhy_A219 EF-1-gamma 1, elongation factor 1-gamma 1; protein 98.96
1axd_A209 Glutathione S-transferase I; transferase, herbicid 98.96
4hi7_A228 GI20122; GST, glutathione S-transferase, enzyme fu 98.95
3ein_A209 GST class-theta, glutathione S-transferase 1-1; de 98.93
3lyp_A215 Stringent starvation protein A; structural genomic 98.92
3f6d_A219 Adgstd4-4, glutathione transferase GST1-4; HET: GT 98.92
3m3m_A210 Glutathione S-transferase; PSI-II, structural geno 98.91
3gtu_B224 Glutathione S-transferase; conjugation, detoxifica 98.91
2c4j_A218 Glutathione S-transferase MU 2; glutathione transf 98.91
1pn9_A209 GST class-delta, glutathione S-transferase 1-6; pr 98.9
4glt_A225 Glutathione S-transferase-like protein; structural 98.9
2fhe_A216 GST, glutathione S-transferase; transferase-substr 98.89
3gx0_A215 GST-like protein YFCG; transferase, glutathione, g 98.89
2uz8_A174 Eukaryotic translation elongation factor 1 epsilon 98.89
1n2a_A201 Glutathione S-transferase; HET: GTS; 1.90A {Escher 98.89
1r5a_A218 Glutathione transferase; glutathione S-transferase 98.89
3tou_A226 Glutathione S-transferase protein; GSH binding sit 98.89
4gci_A211 Glutathione S-transferase; GST, enzyme function in 98.89
1gsu_A219 GST, CGSTM1-1, class-MU glutathione S-transferase; 98.88
4hz4_A217 Glutathione-S-transferase; enzyme function initiat 98.88
2x64_A207 Glutathione-S-transferase; detoxification enzyme; 98.88
3ibh_A233 GST-II, saccharomyces cerevisiae GTT2; glutathione 98.87
3lsz_A225 Glutathione S-transferase; xenobiotic, biodegradat 98.87
4exj_A238 Uncharacterized protein; transferase-like protein, 98.87
2pvq_A201 Glutathione S-transferase; xenobiotics detoxificat 98.87
4hz2_A230 Glutathione S-transferase domain; glutathione,enzy 98.87
3m8n_A225 Possible glutathione S-transferase; PSI-II, struct 98.87
4ikh_A244 Glutathione S-transferase; enzyme function initiat 98.86
2dsa_A203 Glutathione S-transferase; HET: GSH HPX; 2.10A {Bu 98.86
3lxz_A229 Glutathione S-transferase family protein; structur 98.86
1dug_A234 Chimera of glutathione S-transferase-synthetic lin 98.85
2cvd_A198 Glutathione-requiring prostaglandin D synthase; gl 98.85
3lyk_A216 Stringent starvation protein A homolog; structural 98.85
3n5o_A235 Glutathione transferase; seattle structural genomi 98.85
2on5_A206 Nagst-2, Na glutathione S-transferase 2; hookworm; 98.84
1f2e_A201 Glutathione S-transferase; GST complexed with glut 98.84
2on7_A206 Nagst-1, Na glutathione S-transferase 1; hookworm; 98.84
1v2a_A210 Glutathione transferase GST1-6; glutathione S-tran 98.84
4gf0_A215 Glutathione S-transferase; GST, enzyme function in 98.84
1oe8_A211 Glutathione S-transferase; schistosomiasis, detoxi 98.83
3ik7_A222 Glutathione S-transferase A4; human GST A4-4, enzy 98.83
1pmt_A203 PMGST, GST B1-1, glutathione transferase; glutathi 98.83
3niv_A222 Glutathione S-transferase; structural genomics, PS 98.82
2gsq_A202 Squid GST, glutathione S-transferase; squid digest 98.82
3vln_A241 GSTO-1, glutathione S-transferase omega-1; GST fol 98.82
1ljr_A244 HGST T2-2, glutathione S-transferase; HET: GSH; 3. 98.82
4g0i_A328 Protein YQJG; glutathionyl-hydroquinone reductase, 98.82
3ay8_A216 Glutathione S-transferase; GST fold, GST binding, 98.81
3ic8_A310 Uncharacterized GST-like proteinprotein; glutathio 98.81
1yq1_A208 Glutathione S-transferase; nematoda, structural ge 98.81
1tw9_A206 Glutathione S-transferase 2; 1.71A {Heligmosomoide 98.81
4iel_A229 Glutathione S-transferase, N-terminal domain PROT; 98.8
3uar_A227 Glutathione S-transferase; GSH binding site; HET: 98.8
2a2r_A210 Glutathione S-transferase P; detoxification, nitri 98.79
1b48_A221 GST, mgsta4-4, protein (glutathione S-transferase) 98.79
3qav_A243 RHO-class glutathione S-transferase; cytosol; 2.10 98.79
3cbu_A214 Probable GST-related protein; thioredoxin fold, GS 98.79
3q18_A239 GSTO-2, glutathione S-transferase omega-2; glutath 98.79
4hoj_A210 REGF protein; GST, glutathione S-transferase, enzy 98.78
1tu7_A208 Glutathione S-transferase 2; HET: GSH; 1.50A {Onch 98.78
2wb9_A211 Glutathione transferase sigma class; thioredoxin f 98.77
3ubk_A242 Glutathione transferase; GSH binding; 1.95A {Lepto 98.77
2v6k_A214 Maleylpyruvate isomerase; glutathione-S-transferas 98.77
1zl9_A207 GST class-sigma, glutathione S-transferase 5; glut 98.77
4fqu_A313 Putative glutathione transferase; glutathionyl-hyd 98.77
2vo4_A219 2,4-D inducible glutathione S-transferase; herbici 98.77
1k3y_A221 GSTA1-1, glutathione S-transferase A1; S-hexyl glu 98.76
2cz2_A223 Maleylacetoacetate isomerase; structural genomics, 98.75
2imi_A221 Epsilon-class glutathione S-transferase; HET: GSH; 98.75
1b8x_A280 Protein (AML-1B); nuclear matrix targeting signal 98.75
3rbt_A246 Glutathione transferase O1; glutathione S-transfer 98.74
1vf1_A229 Glutathione S-transferase 3; detoxification; HET: 98.74
2c3n_A247 Glutathione S-transferase theta 1; glutathione tra 98.73
2ycd_A230 Glutathione S-transferase; SOIL bacteria, herbicid 98.71
2hnl_A225 Glutathione S-transferase 1; prostaglandin synthas 98.71
3h1n_A252 Probable glutathione S-transferase; APC84167, bord 98.71
1okt_A211 Glutathione S-transferase; GST; 1.9A {Plasmodium f 98.71
3c8e_A288 YGHU, glutathione S-transferase homologue; glutath 98.7
1yy7_A213 SSPA, stringent starvation protein A; GST fold, tr 98.7
1z9h_A290 Membrane-associated prostaglandin E synthase-2; me 98.69
3r2q_A202 Uncharacterized GST-like protein YIBF; transferase 98.69
2hra_A209 Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, l 98.68
2hqt_A124 GU4 nucleic-binding protein 1; GST-fold, biosynthe 98.67
4ecj_A244 Glutathione S-transferase; transferase-like protei 98.67
4dej_A231 Glutathione S-transferase related protein; transfe 98.67
1m0u_A249 GST2 gene product; flight muscle protein, sigma, t 98.67
3fy7_A250 Chloride intracellular channel protein 3; GST, glu 98.66
1e6b_A221 Glutathione S-transferase; 1.65A {Arabidopsis thal 98.64
3m0f_A213 Uncharacterized protein GST_N; PSI-2, NYSGXRC, glu 98.63
1k0m_A241 CLIC1, NCC27, chloride intracellular channel prote 98.62
1gwc_A230 Glutathione S-transferase TSI-1; herbicide detoxif 98.62
4ags_A471 Thiol-dependent reductase 1; transferase, leishman 98.59
4g10_A265 Glutathione S-transferase homolog; thioredoxin fol 98.59
2r4v_A247 XAP121, chloride intracellular channel protein 2; 98.59
2ws2_A204 NU-class GST, glutathione S-transferase; parasite, 98.58
2ahe_A267 Chloride intracellular channel protein 4; glutathi 98.58
1oyj_A231 Glutathione S-transferase; herbicide detoxificatio 98.55
3ir4_A218 Glutaredoxin 2; glutathione, IDP00895, structural 98.54
3m1g_A362 Putative glutathione S-transferase; ECM4-like subf 98.54
3ppu_A352 Glutathione-S-transferase; GST fold; HET: GSH; 2.3 98.53
3bby_A215 Uncharacterized GST-like protein YFCF; NP_416804.1 98.51
2yv7_A260 CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c 98.51
2yv9_A291 Chloride intracellular channel EXC-4; chloride ION 98.43
1bg5_A254 MAB, fusion protein of alpha-Na,K-ATPase with glut 98.42
1k0d_A260 URE2 protein; nitrate assimilation, structural gen 98.37
2fno_A248 AGR_PAT_752P; thioredoxin fold, GST C-terminal dom 98.34
4f03_A253 Glutathione transferase; GST fold; 1.80A {Phaneroc 98.28
4ags_A 471 Thiol-dependent reductase 1; transferase, leishman 98.26
4id0_A214 Glutathione S-transferase-like protein YIBF; GST, 98.22
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 98.01
2hsn_A160 Methionyl-tRNA synthetase, cytoplasmic; protein co 93.87
>3vk9_A Glutathione S-transferase delta; glutathione binding; 2.00A {Bombyx mori} Back     alignment and structure
Probab=99.00  E-value=1.3e-09  Score=83.62  Aligned_cols=68  Identities=15%  Similarity=0.207  Sum_probs=58.0

Q ss_pred             CHHHHHHHHHHHHHHHHhhhccCCccCCCCCChhHHHHHHHHHHHhcCCCCCchHHHHHhhChhHHHHHHHHHHh
Q psy13308         52 SLDQVYKDVDKCCQSLSERLEKNNFFFKDKPTELDALLFGHIYAVLTTPLPNNRFASTIRAYPNLVEHCTRIEQN  126 (166)
Q Consensus        52 ~~~~~~~~~~~~L~~Le~~L~~~~yl~Gd~pT~aD~~vf~~l~~~~~~~~~~~~l~~~l~~~P~L~~y~~Ri~~r  126 (166)
                      ..+...+.+.+.|+.||+.|++++|++|+++|+||+++++++..+.....       .+++||+|.+|++||.++
T Consensus       124 ~~~~~~~~~~~~l~~le~~L~~~~~l~G~~~t~ADi~~~~~l~~~~~~~~-------~~~~~P~l~~w~~r~~a~  191 (216)
T 3vk9_A          124 ADKAKNEKVQEALQLLDKFLEGQKYVAGPNLTVADLSLIASVSSLEASDI-------DFKKYANVKRWYETVKST  191 (216)
T ss_dssp             CCHHHHHHHHHHHHHHHHHTTTCSBTTBSSCCHHHHHHHHHHHHGGGTTC-------CGGGSHHHHHHHHHHHHH
T ss_pred             hHHHHHHHHHHHHHHHHHHhccCCCCCCCCCCHHHHHHHHHHHHHHHcCC-------CchhCHHHHHHHHHHHcc
Confidence            33556678899999999999999999999999999999999987765432       147899999999999887



>1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A* Back     alignment and structure
>3iso_A Putative glutathione transferase; GST; HET: GSH; 1.90A {Clonorchis sinensis} Back     alignment and structure
>1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A* Back     alignment and structure
>4hi7_A GI20122; GST, glutathione S-transferase, enzyme function initiative, structural genomics, unknown function; HET: GSH; 1.25A {Drosophila mojavensis} Back     alignment and structure
>3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A* Back     alignment and structure
>3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A Back     alignment and structure
>3f6d_A Adgstd4-4, glutathione transferase GST1-4; HET: GTX; 1.70A {Anopheles dirus} PDB: 3f63_A* 1jlw_A* 3g7i_A* 3g7j_A* Back     alignment and structure
>3m3m_A Glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics; HET: GSH; 1.75A {Pseudomonas fluorescens} Back     alignment and structure
>3gtu_B Glutathione S-transferase; conjugation, detoxification, cytosolic, heterodimer; 2.80A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2c4j_A Glutathione S-transferase MU 2; glutathione transferase, multigene family; HET: GSO; 1.35A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1xw5_A* 1ykc_A* 2ab6_A* 2gtu_A 3gtu_A 3gur_A* 1hna_A* 1hnb_A* 1hnc_A* 1xw6_A* 1xwk_A* 1yj6_A* 2f3m_A* 2dc5_A 1gtu_A 4gtu_A 6gsu_A* 6gsv_A* 6gsw_A* 2gst_A* ... Back     alignment and structure
>1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>4glt_A Glutathione S-transferase-like protein; structural genomics, function initiative, EFI; HET: GSH; 2.20A {Methylobacillus flagellatus} Back     alignment and structure
>2fhe_A GST, glutathione S-transferase; transferase-substrate complex; HET: GSH; 2.30A {Fasciola hepatica} SCOP: a.45.1.1 c.47.1.5 PDB: 2wrt_A 1fhe_A* Back     alignment and structure
>3gx0_A GST-like protein YFCG; transferase, glutathione, glutathione disulfide, disulfide bond oxidoreductase; HET: GDS; 2.30A {Escherichia coli} Back     alignment and structure
>2uz8_A Eukaryotic translation elongation factor 1 epsilon-1; protein biosynthesis, aminoacyl-tRNA synthetase, GST, nuclear protein, RNA-binding protein; HET: MSE; 2.0A {Homo sapiens} Back     alignment and structure
>1n2a_A Glutathione S-transferase; HET: GTS; 1.90A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 PDB: 1a0f_A* Back     alignment and structure
>1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A* Back     alignment and structure
>4gci_A Glutathione S-transferase; GST, enzyme function initiative, structural genomics; HET: GSH; 1.50A {Yersinia pestis} PDB: 4g9h_A* Back     alignment and structure
>1gsu_A GST, CGSTM1-1, class-MU glutathione S-transferase; detoxification enzyme, S-hexyl glutathione; HET: GTX; 1.94A {Gallus gallus} SCOP: a.45.1.1 c.47.1.5 PDB: 1c72_A* Back     alignment and structure
>4hz4_A Glutathione-S-transferase; enzyme function initiative; 1.62A {Actinobacillus pleuropneumoniae} Back     alignment and structure
>2x64_A Glutathione-S-transferase; detoxification enzyme; HET: GSH; 2.30A {Xylella fastidiosa} Back     alignment and structure
>3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A* Back     alignment and structure
>3lsz_A Glutathione S-transferase; xenobiotic, biodegradative metabolism, PSI2, NYSGXRC, structural genomics, protein structure initiative; HET: GSH; 1.70A {Rhodobacter sphaeroides} Back     alignment and structure
>4exj_A Uncharacterized protein; transferase-like protein, transcription regulation, transfer structural genomics; 1.64A {Lodderomyces elongisporus nrrl yb-4239} Back     alignment and structure
>2pvq_A Glutathione S-transferase; xenobiotics detoxification, H-site; HET: GSH; 1.80A {Ochrobactrum anthropi} PDB: 2nto_A* Back     alignment and structure
>4hz2_A Glutathione S-transferase domain; glutathione,enzyme function initiative; HET: GSH; 1.50A {Xanthobacter autotrophicus} Back     alignment and structure
>3m8n_A Possible glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, nysgxrc; 2.04A {Rhodopseudomonas palustris} Back     alignment and structure
>4ikh_A Glutathione S-transferase; enzyme function initiative, EFI, structural genomics; HET: GSH; 2.10A {Pseudomonas protegens} Back     alignment and structure
>2dsa_A Glutathione S-transferase; HET: GSH HPX; 2.10A {Burkholderia xenovorans} PDB: 2gdr_A* Back     alignment and structure
>3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* Back     alignment and structure
>1dug_A Chimera of glutathione S-transferase-synthetic linker-C-terminal fibrinogen gamma...; gamma chain integrin fragment; HET: GSH; 1.80A {Schistosoma japonicum} SCOP: a.45.1.1 c.47.1.5 PDB: 1gne_A* 3qmz_T 1y6e_A 1m9a_A* 1gtb_A* 1gta_A* 1m99_A* 1m9b_A* 1ua5_A* 1u87_A* 1u88_A* 3crt_A* 3cru_A* 3d0z_A* Back     alignment and structure
>2cvd_A Glutathione-requiring prostaglandin D synthase; glutathione-S-transferase, isomerase; HET: GSH HQL; 1.45A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1iyi_A* 1v40_A* 1iyh_A* 3vi5_A* 3vi7_A* 2vcq_A* 2vcw_A* 2vcx_A* 2vcz_A* 2vd0_A* 2vd1_A* 3kxo_A* 3ee2_A* 1pd2_1* Back     alignment and structure
>3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} Back     alignment and structure
>3n5o_A Glutathione transferase; seattle structural genomics center for infectious disease, S GST, pathogenic fungus, coccidioidomycosis; HET: GSH; 1.85A {Coccidioides immitis} PDB: 3lg6_A* Back     alignment and structure
>2on5_A Nagst-2, Na glutathione S-transferase 2; hookworm; HET: GSH; 1.90A {Necator americanus} Back     alignment and structure
>1f2e_A Glutathione S-transferase; GST complexed with glutathione, thioredoxin superfamily fold transferase; HET: GSH; 2.30A {Sphingomonas paucimobilis} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2on7_A Nagst-1, Na glutathione S-transferase 1; hookworm; 2.40A {Necator americanus} Back     alignment and structure
>1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>4gf0_A Glutathione S-transferase; GST, enzyme function initiative, EFI, structural genomics; HET: GSH; 1.75A {Sulfitobacter} Back     alignment and structure
>1oe8_A Glutathione S-transferase; schistosomiasis, detoxifying enzyme, prostaglandin D2 synthase, vaccine candidate; HET: GSH; 1.65A {Schistosoma haematobium} SCOP: a.45.1.1 c.47.1.5 PDB: 1oe7_A* 2c80_A* 2ca8_A* 2f8f_A* 2c8u_A 2caq_A* 2cai_A* 1u3i_A* Back     alignment and structure
>3ik7_A Glutathione S-transferase A4; human GST A4-4, enzyme, cytoplasm, polymorphism; HET: BOB; 1.97A {Homo sapiens} PDB: 1gum_A 1gul_A* Back     alignment and structure
>1pmt_A PMGST, GST B1-1, glutathione transferase; glutathione-conjugating, A putative oxidoreduct; HET: GSH; 2.50A {Proteus mirabilis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pmt_A* Back     alignment and structure
>3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp} Back     alignment and structure
>2gsq_A Squid GST, glutathione S-transferase; squid digestive gland, sigma class; HET: GBI; 2.20A {Ommastrephes sloani} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsq_A* Back     alignment and structure
>3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* Back     alignment and structure
>1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A* Back     alignment and structure
>4g0i_A Protein YQJG; glutathionyl-hydroquinone reductase, oxidoreductase; HET: MES; 2.05A {Escherichia coli} PDB: 3r3e_A* 4g0k_A* 4g0l_A* Back     alignment and structure
>3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori} Back     alignment and structure
>3ic8_A Uncharacterized GST-like proteinprotein; glutathione, transferase, PSI, MCSG, structural genomics; 2.40A {Pseudomonas syringae PV} Back     alignment and structure
>1yq1_A Glutathione S-transferase; nematoda, structural genomics, PSI, protein structure initiative; 3.00A {Caenorhabditis elegans} Back     alignment and structure
>1tw9_A Glutathione S-transferase 2; 1.71A {Heligmosomoides polygyrus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>4iel_A Glutathione S-transferase, N-terminal domain PROT; GST, glutathione S-transferase, enzyme function initiative, structural genomics; HET: GSH; 1.60A {Burkholderia ambifaria} Back     alignment and structure
>3uar_A Glutathione S-transferase; GSH binding site; HET: GSH; 2.60A {Methylococcus capsulatus} PDB: 3uap_A* Back     alignment and structure
>2a2r_A Glutathione S-transferase P; detoxification, nitric oxide carrier, S- nitrosoglutathione; HET: MES GSN; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 11gs_A* 12gs_A* 14gs_A* 16gs_A* 18gs_A* 21gs_A* 13gs_A* 2a2s_A* 3dd3_A* 3dgq_A* 3n9j_A* 3pgt_A* 1pgt_A* 2pgt_A* 4pgt_A* 22gs_A* 17gs_A* 3gus_A* 10gs_A* 1aqv_A* ... Back     alignment and structure
>1b48_A GST, mgsta4-4, protein (glutathione S-transferase); subunit cooperativity; HET: HAG GSH; 2.60A {Mus musculus} SCOP: a.45.1.1 c.47.1.5 PDB: 1guk_A Back     alignment and structure
>3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A* Back     alignment and structure
>3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} Back     alignment and structure
>3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* Back     alignment and structure
>4hoj_A REGF protein; GST, glutathione S-transferase, enzyme function initiative, structural genomics, transferase; HET: GSH; 1.40A {Neisseria gonorrhoeae} Back     alignment and structure
>1tu7_A Glutathione S-transferase 2; HET: GSH; 1.50A {Onchocerca volvulus} SCOP: a.45.1.1 c.47.1.5 PDB: 1tu8_A* Back     alignment and structure
>2wb9_A Glutathione transferase sigma class; thioredoxin fold; HET: GSH; 1.59A {Fasciola hepatica} PDB: 2wdu_A* Back     alignment and structure
>3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* Back     alignment and structure
>2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A* Back     alignment and structure
>1zl9_A GST class-sigma, glutathione S-transferase 5; glutathione transferase, C.elegans; HET: GSH; 2.01A {Caenorhabditis elegans} Back     alignment and structure
>4fqu_A Putative glutathione transferase; glutathionyl-hydroquinone reductases, oxidoredu; 3.00A {Sphingobium chlorophenolicum} Back     alignment and structure
>2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A* Back     alignment and structure
>1k3y_A GSTA1-1, glutathione S-transferase A1; S-hexyl glutatione, water structu transferase; HET: GTX; 1.30A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsf_A* 1guh_A* 1gsd_A* 1k3o_A 1k3l_A* 1pl1_A* 1pkz_A 1pkw_A* 2r6k_A* 1gse_A* 3u6v_A 1usb_A* 1ydk_A* 3q74_A 3ktl_A* 1pl2_A* 2r3x_A* 1xwg_A 3l0h_A* 1ags_A* ... Back     alignment and structure
>2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* Back     alignment and structure
>2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A* Back     alignment and structure
>1b8x_A Protein (AML-1B); nuclear matrix targeting signal protein, signal protein; 2.70A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori} Back     alignment and structure
>1vf1_A Glutathione S-transferase 3; detoxification; HET: GSH; 1.77A {Gallus gallus} PDB: 1vf2_A* 1vf3_A* 1vf4_A Back     alignment and structure
>2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A Back     alignment and structure
>2ycd_A Glutathione S-transferase; SOIL bacteria, herbicide detoxification; HET: GTB; 1.40A {Agrobacterium tumefaciens} PDB: 3lq7_A Back     alignment and structure
>2hnl_A Glutathione S-transferase 1; prostaglandin synthase, river BLI onchocerca volvulus, immune modulation; HET: GSH; 2.00A {Onchocerca volvulus} Back     alignment and structure
>3h1n_A Probable glutathione S-transferase; APC84167, bordetella bronchisepti structural genomics, PSI-2, protein structure initiative; 1.83A {Bordetella bronchiseptica RB50} Back     alignment and structure
>1okt_A Glutathione S-transferase; GST; 1.9A {Plasmodium falciparum} SCOP: a.45.1.1 c.47.1.5 PDB: 1pa3_A 1q4j_A* 3fr9_A* 3frc_A* 2aaw_A* 3fr6_A 3fr3_A* Back     alignment and structure
>3c8e_A YGHU, glutathione S-transferase homologue; glutathione transferase homologue, E. coli; HET: GSH; 1.50A {Escherichia coli} Back     alignment and structure
>1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} Back     alignment and structure
>1z9h_A Membrane-associated prostaglandin E synthase-2; membran associated protein, indomethacin, isomerase; HET: IMN; 2.60A {Macaca fascicularis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pbj_A* Back     alignment and structure
>3r2q_A Uncharacterized GST-like protein YIBF; transferase, glutathione; HET: GSH; 1.05A {Escherichia coli} Back     alignment and structure
>2hra_A Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, ligase; 1.90A {Saccharomyces cerevisiae} PDB: 2hrk_A 2hsm_A Back     alignment and structure
>2hqt_A GU4 nucleic-binding protein 1; GST-fold, biosynthetic protein, RNA binding; 1.90A {Saccharomyces cerevisiae} SCOP: a.45.1.2 PDB: 2hrk_B 2hsm_B 2hsn_B Back     alignment and structure
>4ecj_A Glutathione S-transferase; transferase-like protein, transcription regulation; HET: GSH; 1.76A {Pseudomonas aeruginosa} PDB: 4eci_A* Back     alignment and structure
>4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis} Back     alignment and structure
>1m0u_A GST2 gene product; flight muscle protein, sigma, transferase; HET: GSH; 1.75A {Drosophila melanogaster} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A Back     alignment and structure
>1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3m0f_A Uncharacterized protein GST_N; PSI-2, NYSGXRC, glutathione, structural genomics, protein structure initiative; HET: GSH; 1.60A {Pseudomonas fluorescens} PDB: 3lxt_A* Back     alignment and structure
>1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A Back     alignment and structure
>1gwc_A Glutathione S-transferase TSI-1; herbicide detoxification, plant, TAU class; HET: GTX; 2.25A {Aegilops tauschii} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Back     alignment and structure
>4g10_A Glutathione S-transferase homolog; thioredoxin fold; HET: MSE GSH; 1.20A {Sphingomonas paucimobilis} Back     alignment and structure
>2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A* Back     alignment and structure
>2ws2_A NU-class GST, glutathione S-transferase; parasite, nematode; 2.01A {Haemonchus contortus} Back     alignment and structure
>2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A Back     alignment and structure
>1oyj_A Glutathione S-transferase; herbicide detoxification; HET: GSH; 1.95A {Oryza sativa} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A Back     alignment and structure
>3m1g_A Putative glutathione S-transferase; ECM4-like subfamily, GST_C family, structural genomics, PSI- protein structure initiative; 2.10A {Corynebacterium glutamicum} Back     alignment and structure
>3ppu_A Glutathione-S-transferase; GST fold; HET: GSH; 2.30A {Phanerochaete chrysosporium} Back     alignment and structure
>3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli} Back     alignment and structure
>2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster} Back     alignment and structure
>2yv9_A Chloride intracellular channel EXC-4; chloride ION channel, CLIC, GST fold, metal transport; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1bg5_A MAB, fusion protein of alpha-Na,K-ATPase with glutathione S-transferase; ankyrin binding, carrier crystallization, ION transport; 2.60A {Rattus norvegicus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1k0d_A URE2 protein; nitrate assimilation, structural genomics, gene regulation; HET: GSH; 2.20A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 PDB: 1jzr_A* 1k0b_A* 1k0c_A* 1k0a_A* 1g6w_A 1g6y_A 1hqo_A Back     alignment and structure
>2fno_A AGR_PAT_752P; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics, JCSG; 2.00A {Agrobacterium tumefaciens} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>4f03_A Glutathione transferase; GST fold; 1.80A {Phanerochaete chrysosporium} PDB: 4g19_A* Back     alignment and structure
>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Back     alignment and structure
>4id0_A Glutathione S-transferase-like protein YIBF; GST, enzyme function initiative, structural genomics; HET: GSF; 1.10A {Pseudomonas fluorescens} PDB: 4ibp_A* Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>2hsn_A Methionyl-tRNA synthetase, cytoplasmic; protein complex protein interaction GST-fold, ligase/RNA binding protein complex; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 166
d2gsta1133 a.45.1.1 (A:85-217) Class mu GST {Rat (Rattus norv 4e-04
d2fhea1136 a.45.1.1 (A:81-216) Class alpha GST {Fasciola hepa 0.002
>d2gsta1 a.45.1.1 (A:85-217) Class mu GST {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 133 Back     information, alignment and structure

class: All alpha proteins
fold: GST C-terminal domain-like
superfamily: GST C-terminal domain-like
family: Glutathione S-transferase (GST), C-terminal domain
domain: Class mu GST
species: Rat (Rattus norvegicus) [TaxId: 10116]
 Score = 36.1 bits (83), Expect = 4e-04
 Identities = 19/77 (24%), Positives = 30/77 (38%), Gaps = 6/77 (7%)

Query: 50  EKSLDQVYKDVDKCCQSLSERLEKNNFFFKDKPTELDALLFGHIYAVLTTPLPNNRFAST 109
           EK   +  K + +  +  SE L K  +F  DK T +D L +  +                
Sbjct: 36  EKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQYHIF------EPKC 89

Query: 110 IRAYPNLVEHCTRIEQN 126
           + A+PNL +   R E  
Sbjct: 90  LDAFPNLKDFLARFEGL 106


>d2fhea1 a.45.1.1 (A:81-216) Class alpha GST {Fasciola hepatica [TaxId: 6192]} Length = 136 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query166
d1gnwa1126 Class phi GST {Mouse-ear cress (Arabidopsis thalia 99.3
d1jlva1123 Class delta GST {Mosquito (Anopheles dirus b), iso 99.23
d1v2aa1125 Class delta GST {Mosquito (Anopheles dirus b), iso 99.23
d1axda1129 Class phi GST {Maize (Zea mays), type I [TaxId: 45 99.22
d1r5aa1129 Class delta GST {Mosquito (Anopheles dirus b), iso 99.21
d1aw9a1135 Class phi GST {Maize (Zea mays), type III [TaxId: 99.18
d1jlwa1127 Class delta GST {Mosquito (Anopheles dirus b), iso 99.15
d1nhya1144 GST-like domain of elongation factor 1-gamma {Bake 99.14
d1ljra1165 Class theta GST {Human (Homo sapiens) [TaxId: 9606 99.1
d1f2ea1121 Class beta GST {Sphingomonas paucimobilis [TaxId: 99.09
d1n2aa1121 Class beta GST {Escherichia coli [TaxId: 562]} 99.09
d2c4ja1133 Class mu GST {Human (Homo sapiens) [TaxId: 9606]} 99.05
d1pmta1121 Class beta GST {Proteus mirabilis [TaxId: 584]} 99.03
d2cvda1124 Class sigma GST {Human (Homo sapiens) [TaxId: 9606 99.02
d1gsua1133 Class mu GST {Chicken (Gallus gallus) [TaxId: 9031 99.02
d1k0da1151 Yeast prion protein ure2p, nitrogen regulation fra 98.99
d3gtub1140 Class mu GST {Human (Homo sapiens) [TaxId: 9606]} 98.99
d1duga1140 Class alpha GST {Schistosoma japonicum [TaxId: 618 98.98
d2gsta1133 Class mu GST {Rat (Rattus norvegicus) [TaxId: 1011 98.98
d2gsqa1127 Class sigma GST {Squid (Ommastrephes sloani pacifi 98.98
d2fhea1136 Class alpha GST {Fasciola hepatica [TaxId: 6192]} 98.95
d1eema1139 Class omega GST {Human (Homo sapiens) [TaxId: 9606 98.92
d1fw1a1125 Class zeta GST {Human (Homo sapiens) [TaxId: 9606] 98.9
d2a2ra1132 Class pi GST {Human (Homo sapiens) [TaxId: 9606]} 98.89
d1tw9a1129 Class sigma GST {Heligmosomoides polygyrus [TaxId: 98.87
d1b48a1143 Class alpha GST {Mouse (Mus musculus), (a1-4) [Tax 98.83
d1gwca1138 Class tau GST {Aegilops tauschii, also known as Tr 98.82
d1k3ya1142 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 98.78
d1e6ba1133 Class zeta GST {Mouse-ear cress (Arabidopsis thali 98.76
d1m0ua1127 Class sigma GST {Fruit fly (Drosophila melanogaste 98.75
d1okta1126 Pf GST {Malarial parasite (Plasmodium falciparum) 98.75
d1gula1140 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 98.75
d1z9ha1161 Microsomal prostaglandin E synthase-2 {Crab-eating 98.75
d1tu7a1131 Class pi GST {Onchocerca volvulus [TaxId: 6282]} 98.72
d2hrkb1118 GU4 nucleic-binding protein 1, Arc1p {Baker's yeas 98.64
d1oe8a1123 Class alpha GST {Blood fluke (Schistosoma haematob 98.53
d1oyja1145 Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} 98.51
d1k0ma1149 Chloride intracellular channel 1 (clic1) {Human (H 98.38
d1g7oa1140 Glutaredoxin 2 {Escherichia coli [TaxId: 562]} 95.18
d2fnoa1149 Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobac 94.8
>d1gnwa1 a.45.1.1 (A:86-211) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
class: All alpha proteins
fold: GST C-terminal domain-like
superfamily: GST C-terminal domain-like
family: Glutathione S-transferase (GST), C-terminal domain
domain: Class phi GST
species: Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]
Probab=99.30  E-value=4.1e-12  Score=89.70  Aligned_cols=68  Identities=18%  Similarity=0.176  Sum_probs=58.5

Q ss_pred             HHHHHHHHHHHHHHHhhhccCCccCCCCCChhHHHHHHHHHHHhcCCCCCchHHHHHhhChhHHHHHHHHHHh
Q psy13308         54 DQVYKDVDKCCQSLSERLEKNNFFFKDKPTELDALLFGHIYAVLTTPLPNNRFASTIRAYPNLVEHCTRIEQN  126 (166)
Q Consensus        54 ~~~~~~~~~~L~~Le~~L~~~~yl~Gd~pT~aD~~vf~~l~~~~~~~~~~~~l~~~l~~~P~L~~y~~Ri~~r  126 (166)
                      ++..+.+.+.|+.||++|++++|++|+++|.|||.+++++..+...+     ....+++||||.+|++||.+|
T Consensus        52 ~~~~~~l~~~l~~le~~L~~~~yl~Gd~~TlADi~~~~~l~~~~~~~-----~~~~~~~~P~l~~W~~rl~~R  119 (126)
T d1gnwa1          52 AEEEAKLAKVLDVYEARLKEFKYLAGETFTLTDLHHIPAIQYLLGTP-----TKKLFTERPRVNEWVAEITKR  119 (126)
T ss_dssp             HHHHHHHHHHHHHHHHHHTTCSSSSSSSCCHHHHTTHHHHHHHTTSG-----GGHHHHTSHHHHHHHHHHHSS
T ss_pred             HHHHHHHHHHHHHHHHHHccCCccccCccccchHHHHHHHHHHHHcC-----cccccccCHHHHHHHHHHHcC
Confidence            45677889999999999999999999999999999999998775542     244568999999999999886



>d1jlva1 a.45.1.1 (A:85-207) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Back     information, alignment and structure
>d1v2aa1 a.45.1.1 (A:84-208) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Back     information, alignment and structure
>d1axda1 a.45.1.1 (A:81-210) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Back     information, alignment and structure
>d1r5aa1 a.45.1.1 (A:87-215) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Back     information, alignment and structure
>d1aw9a1 a.45.1.1 (A:83-217) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Back     information, alignment and structure
>d1jlwa1 a.45.1.1 (A:91-217) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-4 [TaxId: 123217]} Back     information, alignment and structure
>d1nhya1 a.45.1.1 (A:76-219) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ljra1 a.45.1.1 (A:80-244) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f2ea1 a.45.1.1 (A:81-201) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} Back     information, alignment and structure
>d1n2aa1 a.45.1.1 (A:81-201) Class beta GST {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c4ja1 a.45.1.1 (A:86-218) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmta1 a.45.1.1 (A:81-201) Class beta GST {Proteus mirabilis [TaxId: 584]} Back     information, alignment and structure
>d2cvda1 a.45.1.1 (A:76-199) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gsua1 a.45.1.1 (A:85-217) Class mu GST {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1k0da1 a.45.1.1 (A:201-351) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3gtub1 a.45.1.1 (B:85-224) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1duga1 a.45.1.1 (A:81-220) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} Back     information, alignment and structure
>d2gsta1 a.45.1.1 (A:85-217) Class mu GST {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2gsqa1 a.45.1.1 (A:76-202) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} Back     information, alignment and structure
>d2fhea1 a.45.1.1 (A:81-216) Class alpha GST {Fasciola hepatica [TaxId: 6192]} Back     information, alignment and structure
>d1eema1 a.45.1.1 (A:103-241) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fw1a1 a.45.1.1 (A:88-212) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a2ra1 a.45.1.1 (A:78-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tw9a1 a.45.1.1 (A:78-206) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} Back     information, alignment and structure
>d1b48a1 a.45.1.1 (A:80-222) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} Back     information, alignment and structure
>d1gwca1 a.45.1.1 (A:87-224) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} Back     information, alignment and structure
>d1k3ya1 a.45.1.1 (A:81-222) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d1e6ba1 a.45.1.1 (A:88-220) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1m0ua1 a.45.1.1 (A:123-249) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1okta1 a.45.1.1 (A:86-211) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1gula1 a.45.1.1 (A:81-220) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d1z9ha1 a.45.1.1 (A:213-373) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} Back     information, alignment and structure
>d1tu7a1 a.45.1.1 (A:78-208) Class pi GST {Onchocerca volvulus [TaxId: 6282]} Back     information, alignment and structure
>d2hrkb1 a.45.1.2 (B:4-121) GU4 nucleic-binding protein 1, Arc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oe8a1 a.45.1.1 (A:85-207) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} Back     information, alignment and structure
>d1oyja1 a.45.1.1 (A:86-230) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1k0ma1 a.45.1.1 (A:92-240) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g7oa1 a.45.1.1 (A:76-215) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fnoa1 a.45.1.1 (A:88-236) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure