Psyllid ID: psy13308
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 166 | ||||||
| 321468529 | 272 | hypothetical protein DAPPUDRAFT_304425 [ | 0.777 | 0.474 | 0.550 | 2e-38 | |
| 270009997 | 312 | hypothetical protein TcasGA2_TC009327 [T | 0.789 | 0.419 | 0.511 | 8e-37 | |
| 91085775 | 259 | PREDICTED: similar to metaxin 2 [Triboli | 0.789 | 0.505 | 0.511 | 8e-37 | |
| 307194092 | 314 | Metaxin-2 [Harpegnathos saltator] | 0.813 | 0.429 | 0.525 | 1e-36 | |
| 255742481 | 276 | metaxin 2 [Callorhinchus milii] gi|38791 | 0.813 | 0.489 | 0.466 | 4e-35 | |
| 155372199 | 264 | metaxin-2 [Bos taurus] gi|426220821|ref| | 0.813 | 0.511 | 0.474 | 5e-35 | |
| 440895806 | 251 | Metaxin-2, partial [Bos grunniens mutus] | 0.813 | 0.537 | 0.474 | 8e-35 | |
| 56605654 | 263 | metaxin-2 [Rattus norvegicus] gi|5556278 | 0.771 | 0.486 | 0.492 | 1e-34 | |
| 332209411 | 263 | PREDICTED: metaxin-2 isoform 1 [Nomascus | 0.771 | 0.486 | 0.492 | 1e-34 | |
| 444723475 | 389 | Metaxin-2 [Tupaia chinensis] | 0.771 | 0.329 | 0.5 | 1e-34 |
| >gi|321468529|gb|EFX79513.1| hypothetical protein DAPPUDRAFT_304425 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
Score = 163 bits (412), Expect = 2e-38, Method: Compositional matrix adjust.
Identities = 71/129 (55%), Positives = 97/129 (75%)
Query: 2 YITWCDPTTYREVTKVRHGAVAPWPLNIYLTYKKKLTVQHRLKTLKWLEKSLDQVYKDVD 61
YI+WCD T EVT R+G+V WPLN LT++K+ V +L L W+ K+LD+VY+DVD
Sbjct: 130 YISWCDETVLNEVTGPRYGSVYSWPLNTLLTWRKQKQVAKKLTALGWITKTLDEVYEDVD 189
Query: 62 KCCQSLSERLEKNNFFFKDKPTELDALLFGHIYAVLTTPLPNNRFASTIRAYPNLVEHCT 121
CC +LSERL + +FF D+ TELDA++FGH++ +LTTPLP+NR AS +R+YPNLVE C
Sbjct: 190 HCCNALSERLGNHLYFFNDRCTELDAVVFGHVFTLLTTPLPDNRLASIVRSYPNLVEACQ 249
Query: 122 RIEQNYFKK 130
+E+ YF+K
Sbjct: 250 FLEKTYFQK 258
|
Source: Daphnia pulex Species: Daphnia pulex Genus: Daphnia Family: Daphniidae Order: Diplostraca Class: Branchiopoda Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|270009997|gb|EFA06445.1| hypothetical protein TcasGA2_TC009327 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|91085775|ref|XP_974308.1| PREDICTED: similar to metaxin 2 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|307194092|gb|EFN76553.1| Metaxin-2 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|255742481|gb|ACU32593.1| metaxin 2 [Callorhinchus milii] gi|387915910|gb|AFK11564.1| metaxin 2 [Callorhinchus milii] | Back alignment and taxonomy information |
|---|
| >gi|155372199|ref|NP_001094710.1| metaxin-2 [Bos taurus] gi|426220821|ref|XP_004004610.1| PREDICTED: metaxin-2 [Ovis aries] gi|151554696|gb|AAI48005.1| MTX2 protein [Bos taurus] gi|296490655|tpg|DAA32768.1| TPA: metaxin 2 [Bos taurus] | Back alignment and taxonomy information |
|---|
| >gi|440895806|gb|ELR47905.1| Metaxin-2, partial [Bos grunniens mutus] | Back alignment and taxonomy information |
|---|
| >gi|56605654|ref|NP_001008287.1| metaxin-2 [Rattus norvegicus] gi|55562783|gb|AAH86360.1| Metaxin 2 [Rattus norvegicus] gi|149022298|gb|EDL79192.1| metaxin 2 [Rattus norvegicus] | Back alignment and taxonomy information |
|---|
| >gi|332209411|ref|XP_003253805.1| PREDICTED: metaxin-2 isoform 1 [Nomascus leucogenys] | Back alignment and taxonomy information |
|---|
| >gi|444723475|gb|ELW64130.1| Metaxin-2 [Tupaia chinensis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 166 | ||||||
| UNIPROTKB|A6QLL2 | 264 | MTX2 "MTX2 protein" [Bos tauru | 0.813 | 0.511 | 0.474 | 1.3e-34 | |
| RGD|1306473 | 263 | Mtx2 "metaxin 2" [Rattus norve | 0.771 | 0.486 | 0.492 | 1.7e-34 | |
| UNIPROTKB|Q2L969 | 267 | MTX2 "Metaxin-2" [Sus scrofa ( | 0.789 | 0.490 | 0.488 | 2.8e-34 | |
| UNIPROTKB|O75431 | 263 | MTX2 "Metaxin-2" [Homo sapiens | 0.771 | 0.486 | 0.492 | 3.6e-34 | |
| UNIPROTKB|Q8IZ68 | 253 | MTX2 "Metaxin-2" [Homo sapiens | 0.771 | 0.505 | 0.492 | 3.6e-34 | |
| UNIPROTKB|E2RML8 | 267 | MTX2 "Uncharacterized protein" | 0.771 | 0.479 | 0.492 | 4.6e-34 | |
| MGI|MGI:1859652 | 263 | Mtx2 "metaxin 2" [Mus musculus | 0.771 | 0.486 | 0.484 | 2.5e-33 | |
| UNIPROTKB|E1BVN1 | 268 | MTX2 "Uncharacterized protein" | 0.807 | 0.5 | 0.459 | 1.1e-32 | |
| FB|FBgn0036920 | 269 | CG8004 [Drosophila melanogaste | 0.771 | 0.475 | 0.396 | 9.7e-25 | |
| UNIPROTKB|C9JAZ1 | 229 | MTX2 "Metaxin-2" [Homo sapiens | 0.530 | 0.384 | 0.5 | 1.9e-24 |
| UNIPROTKB|A6QLL2 MTX2 "MTX2 protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Score = 375 (137.1 bits), Expect = 1.3e-34, P = 1.3e-34
Identities = 64/135 (47%), Positives = 93/135 (68%)
Query: 2 YITWCDPTTYREVTKVRHGAVAPWPLNIYLTYKKKLTVQHRLKTLKWLEKSLDQVYKDVD 61
Y+ WCD T E+T R+G+ PWPLN L Y+K+ V+ ++K + W K+LDQV +DVD
Sbjct: 128 YLQWCDDATVGEITHARYGSPYPWPLNHILAYQKQWEVKRKMKAIGWGNKTLDQVLEDVD 187
Query: 62 KCCQSLSERLEKNNFFFKDKPTELDALLFGHIYAVLTTPLPNNRFASTIRAYPNLVEHCT 121
+CCQ+LS+RL +FF +PTELDAL+FGH+Y +LTT + N+ + ++ Y NL+ C
Sbjct: 188 QCCQALSQRLGTQPYFFNKQPTELDALVFGHLYTILTTQMTNDELSEKVKNYSNLLAFCR 247
Query: 122 RIEQNYFKKDSTEAK 136
RIEQ+YF K S+ +
Sbjct: 248 RIEQHYFGKGSSSIR 262
|
|
| RGD|1306473 Mtx2 "metaxin 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q2L969 MTX2 "Metaxin-2" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O75431 MTX2 "Metaxin-2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8IZ68 MTX2 "Metaxin-2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RML8 MTX2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1859652 Mtx2 "metaxin 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BVN1 MTX2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0036920 CG8004 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|C9JAZ1 MTX2 "Metaxin-2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 166 | |||
| cd03211 | 126 | cd03211, GST_C_Metaxin2, C-terminal, alpha helical | 2e-63 | |
| cd03212 | 137 | cd03212, GST_C_Metaxin1_3, C-terminal, alpha helic | 1e-29 | |
| cd03193 | 88 | cd03193, GST_C_Metaxin, C-terminal, alpha helical | 6e-21 | |
| pfam11801 | 155 | pfam11801, Tom37_C, Tom37 C-terminal domain | 2e-06 | |
| pfam13410 | 69 | pfam13410, GST_C_2, Glutathione S-transferase, C-t | 5e-05 | |
| cd00299 | 100 | cd00299, GST_C_family, C-terminal, alpha helical d | 3e-04 |
| >gnl|CDD|198320 cd03211, GST_C_Metaxin2, C-terminal, alpha helical domain of Metaxin 2 | Back alignment and domain information |
|---|
Score = 190 bits (484), Expect = 2e-63
Identities = 74/123 (60%), Positives = 96/123 (78%)
Query: 2 YITWCDPTTYREVTKVRHGAVAPWPLNIYLTYKKKLTVQHRLKTLKWLEKSLDQVYKDVD 61
YI+WCD TY EVTK R+G+V PWPLN L Y+K+ V +LK L W +KSLDQV+ +V+
Sbjct: 4 YISWCDEETYNEVTKPRYGSVYPWPLNHILAYRKQREVLRKLKALGWSDKSLDQVFDEVE 63
Query: 62 KCCQSLSERLEKNNFFFKDKPTELDALLFGHIYAVLTTPLPNNRFASTIRAYPNLVEHCT 121
KCCQ+LSE+L N +FF D+PTELDAL+FGH++ +LTTPLPN+ A+ ++ YPNLVE C
Sbjct: 64 KCCQALSEKLGTNQYFFGDQPTELDALVFGHLFTILTTPLPNDELAAIVKKYPNLVEFCR 123
Query: 122 RIE 124
RIE
Sbjct: 124 RIE 126
|
Glutathione S-transferase (GST) C-terminal domain family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait. Metaxin 2 shares sequence similarity with metaxin 1 but does not contain a C-terminal mitochondrial outer membrane signal-anchor domain. It associates with mitochondrial membranes through its interaction with metaxin 1, which is a component of the mitochondrial preprotein import complex of the outer membrane. The biological function of metaxin 2 is unknown. It is likely that it also plays a role in protein translocation into the mitochondria. However, this has not been experimentally validated. In a recent proteomics study, it has been shown that metaxin 2 is overexpressed in response to lipopolysaccharide-induced liver injury. Length = 126 |
| >gnl|CDD|198321 cd03212, GST_C_Metaxin1_3, C-terminal, alpha helical domain of Metaxin 1, Metaxin 3, and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198302 cd03193, GST_C_Metaxin, C-terminal, alpha helical domain of Metaxin and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|221231 pfam11801, Tom37_C, Tom37 C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|222111 pfam13410, GST_C_2, Glutathione S-transferase, C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|198286 cd00299, GST_C_family, C-terminal, alpha helical domain of the Glutathione S-transferase family | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 166 | |||
| cd03211 | 126 | GST_C_Metaxin2 GST_C family, Metaxin subfamily, Me | 100.0 | |
| cd03212 | 137 | GST_C_Metaxin1_3 GST_C family, Metaxin subfamily, | 99.97 | |
| KOG3027|consensus | 257 | 99.95 | ||
| KOG3028|consensus | 313 | 99.9 | ||
| KOG4244|consensus | 281 | 99.84 | ||
| PF11801 | 168 | Tom37_C: Tom37 C-terminal domain; InterPro: IPR019 | 99.79 | |
| cd03193 | 88 | GST_C_Metaxin GST_C family, Metaxin subfamily; com | 99.39 | |
| PF13410 | 69 | GST_C_2: Glutathione S-transferase, C-terminal dom | 99.27 | |
| PF14497 | 99 | GST_C_3: Glutathione S-transferase, C-terminal dom | 99.22 | |
| PF00043 | 95 | GST_C: Glutathione S-transferase, C-terminal domai | 99.06 | |
| cd03202 | 124 | GST_C_etherase_LigE GST_C family, Beta etherase Li | 99.02 | |
| cd03180 | 110 | GST_C_2 GST_C family, unknown subfamily 2; compose | 99.02 | |
| cd03206 | 100 | GST_C_7 GST_C family, unknown subfamily 7; compose | 99.01 | |
| cd03187 | 118 | GST_C_Phi GST_C family, Class Phi subfamily; compo | 98.99 | |
| cd03189 | 119 | GST_C_GTT1_like GST_C family, Saccharomyces cerevi | 98.99 | |
| cd03186 | 107 | GST_C_SspA GST_N family, Stringent starvation prot | 98.96 | |
| cd03188 | 114 | GST_C_Beta GST_C family, Class Beta subfamily; GST | 98.95 | |
| cd03196 | 115 | GST_C_5 GST_C family, unknown subfamily 5; compose | 98.94 | |
| cd03177 | 118 | GST_C_Delta_Epsilon GST_C family, Class Delta and | 98.93 | |
| cd03209 | 121 | GST_C_Mu GST_C family, Class Mu subfamily; GSTs ar | 98.93 | |
| cd00299 | 100 | GST_C_family Glutathione S-transferase (GST) famil | 98.9 | |
| cd03182 | 117 | GST_C_GTT2_like GST_C family, Saccharomyces cerevi | 98.87 | |
| cd03190 | 142 | GST_C_ECM4_like GST_C family, ECM4-like subfamily; | 98.86 | |
| cd03178 | 113 | GST_C_Ure2p_like GST_C family, Ure2p-like subfamil | 98.86 | |
| cd03207 | 103 | GST_C_8 GST_C family, unknown subfamily 8; compose | 98.83 | |
| cd03181 | 123 | GST_C_EFB1gamma GST_C family, Gamma subunit of Elo | 98.83 | |
| PLN02473 | 214 | glutathione S-transferase | 98.82 | |
| cd03210 | 126 | GST_C_Pi GST_C family, Class Pi subfamily; GSTs ar | 98.81 | |
| cd03201 | 121 | GST_C_DHAR GST_C family, Dehydroascorbate Reductas | 98.81 | |
| PRK10387 | 210 | glutaredoxin 2; Provisional | 98.81 | |
| cd03204 | 111 | GST_C_GDAP1 GST_C family, Ganglioside-induced diff | 98.81 | |
| cd03185 | 126 | GST_C_Tau GST_C family, Class Tau subfamily; GSTs | 98.8 | |
| cd03183 | 126 | GST_C_Theta GST_C family, Class Theta subfamily; c | 98.79 | |
| cd03179 | 105 | GST_C_1 GST_C family, unknown subfamily 1; compose | 98.79 | |
| cd03197 | 149 | GST_C_mPGES2 GST_C family; microsomal Prostaglandi | 98.78 | |
| PRK13972 | 215 | GSH-dependent disulfide bond oxidoreductase; Provi | 98.77 | |
| cd03184 | 124 | GST_C_Omega GST_C family, Class Omega subfamily; G | 98.77 | |
| cd03200 | 96 | GST_C_JTV1 GST_C family, JTV-1 subfamily; composed | 98.75 | |
| cd03198 | 134 | GST_C_CLIC GST_C family, Chloride Intracellular Ch | 98.75 | |
| cd03192 | 104 | GST_C_Sigma_like GST_C family, Class Sigma_like; c | 98.75 | |
| cd03208 | 137 | GST_C_Alpha GST_C family, Class Alpha subfamily; G | 98.73 | |
| cd03191 | 121 | GST_C_Zeta GST_C family, Class Zeta subfamily; GST | 98.73 | |
| PRK09481 | 211 | sspA stringent starvation protein A; Provisional | 98.68 | |
| PLN02395 | 215 | glutathione S-transferase | 98.67 | |
| PRK10542 | 201 | glutathionine S-transferase; Provisional | 98.64 | |
| PRK11752 | 264 | putative S-transferase; Provisional | 98.59 | |
| PTZ00057 | 205 | glutathione s-transferase; Provisional | 98.59 | |
| COG0625 | 211 | Gst Glutathione S-transferase [Posttranslational m | 98.58 | |
| TIGR02182 | 209 | GRXB Glutaredoxin, GrxB family. This model include | 98.58 | |
| KOG0406|consensus | 231 | 98.56 | ||
| TIGR01262 | 210 | maiA maleylacetoacetate isomerase. Maleylacetoacet | 98.55 | |
| cd03195 | 114 | GST_C_4 GST_C family, unknown subfamily 4; compose | 98.48 | |
| cd03203 | 120 | GST_C_Lambda GST_C family, Class Lambda subfamily; | 98.48 | |
| PLN02378 | 213 | glutathione S-transferase DHAR1 | 98.44 | |
| cd03205 | 98 | GST_C_6 GST_C family, unknown subfamily 6; compose | 98.4 | |
| cd03194 | 114 | GST_C_3 GST_C family, unknown subfamily 3; compose | 98.39 | |
| TIGR00862 | 236 | O-ClC intracellular chloride channel protein. Thes | 98.33 | |
| PRK10357 | 202 | putative glutathione S-transferase; Provisional | 98.33 | |
| PLN02817 | 265 | glutathione dehydrogenase (ascorbate) | 98.32 | |
| PRK15113 | 214 | glutathione S-transferase; Provisional | 98.08 | |
| PLN02907 | 722 | glutamate-tRNA ligase | 98.01 | |
| KOG4420|consensus | 325 | 97.98 | ||
| KOG0867|consensus | 226 | 97.92 | ||
| COG0435 | 324 | ECM4 Predicted glutathione S-transferase [Posttran | 97.64 | |
| KOG1695|consensus | 206 | 97.32 | ||
| KOG3029|consensus | 370 | 97.08 | ||
| KOG2903|consensus | 319 | 97.01 | ||
| PF14834 | 117 | GST_C_4: Glutathione S-transferase, C-terminal dom | 96.24 | |
| PF04399 | 132 | Glutaredoxin2_C: Glutaredoxin 2, C terminal domain | 96.21 | |
| KOG0868|consensus | 217 | 95.76 | ||
| cd03199 | 128 | GST_C_GRX2 GST_C family, Glutaredoxin 2 (GRX2) sub | 94.95 | |
| KOG1422|consensus | 221 | 94.48 |
| >cd03211 GST_C_Metaxin2 GST_C family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.1e-32 Score=201.56 Aligned_cols=124 Identities=52% Similarity=1.030 Sum_probs=117.4
Q ss_pred CeeeecCCCChHHhhHHHhhccCChhhHHHhHHHHHHHHHHHhhhcccCCCCHHHHHHHHHHHHHHHHhhhccCCccCCC
Q psy13308 1 NYITWCDPTTYREVTKVRHGAVAPWPLNIYLTYKKKLTVQHRLKTLKWLEKSLDQVYKDVDKCCQSLSERLEKNNFFFKD 80 (166)
Q Consensus 1 ly~~W~d~~n~~~~t~~~~~~~~P~pl~~~l~~~~r~~~~~~l~~~G~g~~~~~~~~~~~~~~L~~Le~~L~~~~yl~Gd 80 (166)
||.||+|++||..++++.|...+|+|+|.++++.+|+++++++++||+|+++.+++.+.++++|++|+++||+++||+||
T Consensus 3 l~~~w~d~~~~~~~~~~~~~~~~p~~l~~~~~~~~r~~~~~~l~~~G~gr~~~ee~~~~~~~~l~aLs~~Lg~~~~l~Gd 82 (126)
T cd03211 3 LYISWCDEETYDEVTKPRYGSPYPWPLNHILPYQKQREARRKLKAIGWDDKTLDQVIEEVDQCCQALSQRLGTQPYFFGD 82 (126)
T ss_pred eeehccCcchHHHHhHHHHccCCCHHHHHHHHHHHHHHHHHHHHhcCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCC
Confidence 69999999999999999999899999999999999999999999999999999999999999999999999999999999
Q ss_pred CCChhHHHHHHHHHHHhcCCCCCchHHHHHhhChhHHHHHHHHH
Q psy13308 81 KPTELDALLFGHIYAVLTTPLPNNRFASTIRAYPNLVEHCTRIE 124 (166)
Q Consensus 81 ~pT~aD~~vf~~l~~~~~~~~~~~~l~~~l~~~P~L~~y~~Ri~ 124 (166)
+||++||++|+++..+...+.+++++...+.+||||++|++||.
T Consensus 83 ~pT~~Da~vf~~la~~~~~~~~~~~l~~~~~~~pnL~~y~~Ri~ 126 (126)
T cd03211 83 QPTELDALVFGHLFTILTTQLPNDELAEKVKKYSNLLAFCRRIE 126 (126)
T ss_pred CCcHHHHHHHHHHHHHHhcCCCChHHHHHHHhCcHHHHHHHhcC
Confidence 99999999999999998765666677777899999999999983
|
Metaxin 2 shares sequence similarity with metaxin 1 but does not contain a C-terminal mitochondrial outer membrane signal-anchor domain. It associates with mitochondrial membranes through its interaction with metaxin 1, which is a component of the mitochondrial preprotein import complex of the outer membrane. The biological function of metaxin 2 is unknown. It is likely that it also plays a role in protein translocation into the mitochondria. However, this has not been experimentally validated. In a recent proteomics study, it has been shown that metaxin 2 is overexpressed in response to lipopolysaccharide-induced liver injury. |
| >cd03212 GST_C_Metaxin1_3 GST_C family, Metaxin subfamily, Metaxin 1-like proteins; composed of metaxins 1 and 3, and similar proteins | Back alignment and domain information |
|---|
| >KOG3027|consensus | Back alignment and domain information |
|---|
| >KOG3028|consensus | Back alignment and domain information |
|---|
| >KOG4244|consensus | Back alignment and domain information |
|---|
| >PF11801 Tom37_C: Tom37 C-terminal domain; InterPro: IPR019564 Tom37 is one of the outer membrane proteins that make up the TOM complex for guiding cytosolic mitochondrial beta-barrel proteins from the cytosol across the outer mitochondrial membrane into the intramembrane space | Back alignment and domain information |
|---|
| >cd03193 GST_C_Metaxin GST_C family, Metaxin subfamily; composed of metaxins and related proteins | Back alignment and domain information |
|---|
| >PF13410 GST_C_2: Glutathione S-transferase, C-terminal domain; PDB: 4DEJ_H 3IC8_A 2JL4_A 2V6K_B 3CBU_B 1JLW_B 3F6D_B 3G7I_A 3F63_A 3G7J_B | Back alignment and domain information |
|---|
| >PF14497 GST_C_3: Glutathione S-transferase, C-terminal domain; PDB: 3AY8_A 2UZ8_B 1V2A_C 2HNL_A 2YV9_B 3H1N_A 3FR6_A 1Q4J_B 1PA3_B 1OKT_B | Back alignment and domain information |
|---|
| >PF00043 GST_C: Glutathione S-transferase, C-terminal domain; InterPro: IPR004046 In eukaryotes, glutathione S-transferases (GSTs) participate in the detoxification of reactive electrophillic compounds by catalysing their conjugation to glutathione | Back alignment and domain information |
|---|
| >cd03202 GST_C_etherase_LigE GST_C family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor | Back alignment and domain information |
|---|
| >cd03180 GST_C_2 GST_C family, unknown subfamily 2; composed of uncharacterized bacterial proteins, with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03206 GST_C_7 GST_C family, unknown subfamily 7; composed of uncharacterized proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03187 GST_C_Phi GST_C family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins | Back alignment and domain information |
|---|
| >cd03189 GST_C_GTT1_like GST_C family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >cd03186 GST_C_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E | Back alignment and domain information |
|---|
| >cd03188 GST_C_Beta GST_C family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03196 GST_C_5 GST_C family, unknown subfamily 5; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03177 GST_C_Delta_Epsilon GST_C family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03209 GST_C_Mu GST_C family, Class Mu subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress | Back alignment and domain information |
|---|
| >cd00299 GST_C_family Glutathione S-transferase (GST) family, C-terminal alpha helical domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03182 GST_C_GTT2_like GST_C family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >cd03190 GST_C_ECM4_like GST_C family, ECM4-like subfamily; composed of predominantly uncharacterized and taxonomically diverse proteins with similarity to the translation product of the Saccharomyces cerevisiae gene ECM4 | Back alignment and domain information |
|---|
| >cd03178 GST_C_Ure2p_like GST_C family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs | Back alignment and domain information |
|---|
| >cd03207 GST_C_8 GST_C family, unknown subfamily 8; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03181 GST_C_EFB1gamma GST_C family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis | Back alignment and domain information |
|---|
| >PLN02473 glutathione S-transferase | Back alignment and domain information |
|---|
| >cd03210 GST_C_Pi GST_C family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03201 GST_C_DHAR GST_C family, Dehydroascorbate Reductase (DHAR) subfamily; composed of plant-specific DHARs, monomeric enzymes catalyzing the reduction of DHA into ascorbic acid (AsA) using glutathione as the reductant | Back alignment and domain information |
|---|
| >PRK10387 glutaredoxin 2; Provisional | Back alignment and domain information |
|---|
| >cd03204 GST_C_GDAP1 GST_C family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells | Back alignment and domain information |
|---|
| >cd03185 GST_C_Tau GST_C family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03183 GST_C_Theta GST_C family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase | Back alignment and domain information |
|---|
| >cd03179 GST_C_1 GST_C family, unknown subfamily 1; composed of uncharacterized bacterial proteins, with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03197 GST_C_mPGES2 GST_C family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 | Back alignment and domain information |
|---|
| >PRK13972 GSH-dependent disulfide bond oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >cd03184 GST_C_Omega GST_C family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03200 GST_C_JTV1 GST_C family, JTV-1 subfamily; composed of uncharacterized proteins with similarity to the translation product of the human JTV-1 gene | Back alignment and domain information |
|---|
| >cd03198 GST_C_CLIC GST_C family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin, and similar proteins | Back alignment and domain information |
|---|
| >cd03192 GST_C_Sigma_like GST_C family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi, and Alpha | Back alignment and domain information |
|---|
| >cd03208 GST_C_Alpha GST_C family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03191 GST_C_Zeta GST_C family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress | Back alignment and domain information |
|---|
| >PRK09481 sspA stringent starvation protein A; Provisional | Back alignment and domain information |
|---|
| >PLN02395 glutathione S-transferase | Back alignment and domain information |
|---|
| >PRK10542 glutathionine S-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK11752 putative S-transferase; Provisional | Back alignment and domain information |
|---|
| >PTZ00057 glutathione s-transferase; Provisional | Back alignment and domain information |
|---|
| >COG0625 Gst Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02182 GRXB Glutaredoxin, GrxB family | Back alignment and domain information |
|---|
| >KOG0406|consensus | Back alignment and domain information |
|---|
| >TIGR01262 maiA maleylacetoacetate isomerase | Back alignment and domain information |
|---|
| >cd03195 GST_C_4 GST_C family, unknown subfamily 4; composed of uncharacterized proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03203 GST_C_Lambda GST_C family, Class Lambda subfamily; composed of plant-specific class Lambda GSTs | Back alignment and domain information |
|---|
| >PLN02378 glutathione S-transferase DHAR1 | Back alignment and domain information |
|---|
| >cd03205 GST_C_6 GST_C family, unknown subfamily 6; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03194 GST_C_3 GST_C family, unknown subfamily 3; composed of uncharacterized proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >TIGR00862 O-ClC intracellular chloride channel protein | Back alignment and domain information |
|---|
| >PRK10357 putative glutathione S-transferase; Provisional | Back alignment and domain information |
|---|
| >PLN02817 glutathione dehydrogenase (ascorbate) | Back alignment and domain information |
|---|
| >PRK15113 glutathione S-transferase; Provisional | Back alignment and domain information |
|---|
| >PLN02907 glutamate-tRNA ligase | Back alignment and domain information |
|---|
| >KOG4420|consensus | Back alignment and domain information |
|---|
| >KOG0867|consensus | Back alignment and domain information |
|---|
| >COG0435 ECM4 Predicted glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1695|consensus | Back alignment and domain information |
|---|
| >KOG3029|consensus | Back alignment and domain information |
|---|
| >KOG2903|consensus | Back alignment and domain information |
|---|
| >PF14834 GST_C_4: Glutathione S-transferase, C-terminal domain; PDB: 3BBY_A | Back alignment and domain information |
|---|
| >PF04399 Glutaredoxin2_C: Glutaredoxin 2, C terminal domain; InterPro: IPR007494 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors | Back alignment and domain information |
|---|
| >KOG0868|consensus | Back alignment and domain information |
|---|
| >cd03199 GST_C_GRX2 GST_C family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E | Back alignment and domain information |
|---|
| >KOG1422|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 166 | |||
| 1bg5_A | 254 | MAB, fusion protein of alpha-Na,K-ATPase with glut | 2e-04 | |
| 1dug_A | 234 | Chimera of glutathione S-transferase-synthetic lin | 4e-04 | |
| 1b8x_A | 280 | Protein (AML-1B); nuclear matrix targeting signal | 6e-04 | |
| 2fhe_A | 216 | GST, glutathione S-transferase; transferase-substr | 9e-04 |
| >1bg5_A MAB, fusion protein of alpha-Na,K-ATPase with glutathione S-transferase; ankyrin binding, carrier crystallization, ION transport; 2.60A {Rattus norvegicus} SCOP: a.45.1.1 c.47.1.5 Length = 254 | Back alignment and structure |
|---|
Score = 39.4 bits (92), Expect = 2e-04
Identities = 22/119 (18%), Positives = 32/119 (26%), Gaps = 29/119 (24%)
Query: 19 HGAVAPWPLNIYLTYKKKLTVQHRLKTLKWLEKSLDQVYKDVDKCCQSLSERLEKNNFFF 78
V+ + K + + LK E RL +
Sbjct: 103 RYGVSRIAYSKDFETLKVDFLSKLPEMLKMFED------------------RLCHKTYLN 144
Query: 79 KDKPTELDALLFGHIYAVLTTPLPNNRFASTIRAYPNLVEHCTRIEQN-----YFKKDS 132
D T D +L+ + VL + A+P LV RIE Y K
Sbjct: 145 GDHVTHPDFMLYDALDVVLYM------DPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSK 197
|
| >1dug_A Chimera of glutathione S-transferase-synthetic linker-C-terminal fibrinogen gamma...; gamma chain integrin fragment; HET: GSH; 1.80A {Schistosoma japonicum} SCOP: a.45.1.1 c.47.1.5 PDB: 1gne_A* 3qmz_T 1y6e_A 1m9a_A* 1gtb_A* 1gta_A* 1m99_A* 1m9b_A* 1ua5_A* 1u87_A* 1u88_A* 3crt_A* 3cru_A* 3d0z_A* Length = 234 | Back alignment and structure |
|---|
| >1b8x_A Protein (AML-1B); nuclear matrix targeting signal protein, signal protein; 2.70A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 Length = 280 | Back alignment and structure |
|---|
| >2fhe_A GST, glutathione S-transferase; transferase-substrate complex; HET: GSH; 2.30A {Fasciola hepatica} SCOP: a.45.1.1 c.47.1.5 PDB: 2wrt_A 1fhe_A* Length = 216 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 166 | |||
| 3vk9_A | 216 | Glutathione S-transferase delta; glutathione bindi | 99.0 | |
| 1gnw_A | 211 | Glutathione S-transferase; herbicide detoxificatio | 99.0 | |
| 3iso_A | 218 | Putative glutathione transferase; GST; HET: GSH; 1 | 98.98 | |
| 1aw9_A | 216 | Glutathione S-transferase III; herbicide detoxific | 98.98 | |
| 1nhy_A | 219 | EF-1-gamma 1, elongation factor 1-gamma 1; protein | 98.96 | |
| 1axd_A | 209 | Glutathione S-transferase I; transferase, herbicid | 98.96 | |
| 4hi7_A | 228 | GI20122; GST, glutathione S-transferase, enzyme fu | 98.95 | |
| 3ein_A | 209 | GST class-theta, glutathione S-transferase 1-1; de | 98.93 | |
| 3lyp_A | 215 | Stringent starvation protein A; structural genomic | 98.92 | |
| 3f6d_A | 219 | Adgstd4-4, glutathione transferase GST1-4; HET: GT | 98.92 | |
| 3m3m_A | 210 | Glutathione S-transferase; PSI-II, structural geno | 98.91 | |
| 3gtu_B | 224 | Glutathione S-transferase; conjugation, detoxifica | 98.91 | |
| 2c4j_A | 218 | Glutathione S-transferase MU 2; glutathione transf | 98.91 | |
| 1pn9_A | 209 | GST class-delta, glutathione S-transferase 1-6; pr | 98.9 | |
| 4glt_A | 225 | Glutathione S-transferase-like protein; structural | 98.9 | |
| 2fhe_A | 216 | GST, glutathione S-transferase; transferase-substr | 98.89 | |
| 3gx0_A | 215 | GST-like protein YFCG; transferase, glutathione, g | 98.89 | |
| 2uz8_A | 174 | Eukaryotic translation elongation factor 1 epsilon | 98.89 | |
| 1n2a_A | 201 | Glutathione S-transferase; HET: GTS; 1.90A {Escher | 98.89 | |
| 1r5a_A | 218 | Glutathione transferase; glutathione S-transferase | 98.89 | |
| 3tou_A | 226 | Glutathione S-transferase protein; GSH binding sit | 98.89 | |
| 4gci_A | 211 | Glutathione S-transferase; GST, enzyme function in | 98.89 | |
| 1gsu_A | 219 | GST, CGSTM1-1, class-MU glutathione S-transferase; | 98.88 | |
| 4hz4_A | 217 | Glutathione-S-transferase; enzyme function initiat | 98.88 | |
| 2x64_A | 207 | Glutathione-S-transferase; detoxification enzyme; | 98.88 | |
| 3ibh_A | 233 | GST-II, saccharomyces cerevisiae GTT2; glutathione | 98.87 | |
| 3lsz_A | 225 | Glutathione S-transferase; xenobiotic, biodegradat | 98.87 | |
| 4exj_A | 238 | Uncharacterized protein; transferase-like protein, | 98.87 | |
| 2pvq_A | 201 | Glutathione S-transferase; xenobiotics detoxificat | 98.87 | |
| 4hz2_A | 230 | Glutathione S-transferase domain; glutathione,enzy | 98.87 | |
| 3m8n_A | 225 | Possible glutathione S-transferase; PSI-II, struct | 98.87 | |
| 4ikh_A | 244 | Glutathione S-transferase; enzyme function initiat | 98.86 | |
| 2dsa_A | 203 | Glutathione S-transferase; HET: GSH HPX; 2.10A {Bu | 98.86 | |
| 3lxz_A | 229 | Glutathione S-transferase family protein; structur | 98.86 | |
| 1dug_A | 234 | Chimera of glutathione S-transferase-synthetic lin | 98.85 | |
| 2cvd_A | 198 | Glutathione-requiring prostaglandin D synthase; gl | 98.85 | |
| 3lyk_A | 216 | Stringent starvation protein A homolog; structural | 98.85 | |
| 3n5o_A | 235 | Glutathione transferase; seattle structural genomi | 98.85 | |
| 2on5_A | 206 | Nagst-2, Na glutathione S-transferase 2; hookworm; | 98.84 | |
| 1f2e_A | 201 | Glutathione S-transferase; GST complexed with glut | 98.84 | |
| 2on7_A | 206 | Nagst-1, Na glutathione S-transferase 1; hookworm; | 98.84 | |
| 1v2a_A | 210 | Glutathione transferase GST1-6; glutathione S-tran | 98.84 | |
| 4gf0_A | 215 | Glutathione S-transferase; GST, enzyme function in | 98.84 | |
| 1oe8_A | 211 | Glutathione S-transferase; schistosomiasis, detoxi | 98.83 | |
| 3ik7_A | 222 | Glutathione S-transferase A4; human GST A4-4, enzy | 98.83 | |
| 1pmt_A | 203 | PMGST, GST B1-1, glutathione transferase; glutathi | 98.83 | |
| 3niv_A | 222 | Glutathione S-transferase; structural genomics, PS | 98.82 | |
| 2gsq_A | 202 | Squid GST, glutathione S-transferase; squid digest | 98.82 | |
| 3vln_A | 241 | GSTO-1, glutathione S-transferase omega-1; GST fol | 98.82 | |
| 1ljr_A | 244 | HGST T2-2, glutathione S-transferase; HET: GSH; 3. | 98.82 | |
| 4g0i_A | 328 | Protein YQJG; glutathionyl-hydroquinone reductase, | 98.82 | |
| 3ay8_A | 216 | Glutathione S-transferase; GST fold, GST binding, | 98.81 | |
| 3ic8_A | 310 | Uncharacterized GST-like proteinprotein; glutathio | 98.81 | |
| 1yq1_A | 208 | Glutathione S-transferase; nematoda, structural ge | 98.81 | |
| 1tw9_A | 206 | Glutathione S-transferase 2; 1.71A {Heligmosomoide | 98.81 | |
| 4iel_A | 229 | Glutathione S-transferase, N-terminal domain PROT; | 98.8 | |
| 3uar_A | 227 | Glutathione S-transferase; GSH binding site; HET: | 98.8 | |
| 2a2r_A | 210 | Glutathione S-transferase P; detoxification, nitri | 98.79 | |
| 1b48_A | 221 | GST, mgsta4-4, protein (glutathione S-transferase) | 98.79 | |
| 3qav_A | 243 | RHO-class glutathione S-transferase; cytosol; 2.10 | 98.79 | |
| 3cbu_A | 214 | Probable GST-related protein; thioredoxin fold, GS | 98.79 | |
| 3q18_A | 239 | GSTO-2, glutathione S-transferase omega-2; glutath | 98.79 | |
| 4hoj_A | 210 | REGF protein; GST, glutathione S-transferase, enzy | 98.78 | |
| 1tu7_A | 208 | Glutathione S-transferase 2; HET: GSH; 1.50A {Onch | 98.78 | |
| 2wb9_A | 211 | Glutathione transferase sigma class; thioredoxin f | 98.77 | |
| 3ubk_A | 242 | Glutathione transferase; GSH binding; 1.95A {Lepto | 98.77 | |
| 2v6k_A | 214 | Maleylpyruvate isomerase; glutathione-S-transferas | 98.77 | |
| 1zl9_A | 207 | GST class-sigma, glutathione S-transferase 5; glut | 98.77 | |
| 4fqu_A | 313 | Putative glutathione transferase; glutathionyl-hyd | 98.77 | |
| 2vo4_A | 219 | 2,4-D inducible glutathione S-transferase; herbici | 98.77 | |
| 1k3y_A | 221 | GSTA1-1, glutathione S-transferase A1; S-hexyl glu | 98.76 | |
| 2cz2_A | 223 | Maleylacetoacetate isomerase; structural genomics, | 98.75 | |
| 2imi_A | 221 | Epsilon-class glutathione S-transferase; HET: GSH; | 98.75 | |
| 1b8x_A | 280 | Protein (AML-1B); nuclear matrix targeting signal | 98.75 | |
| 3rbt_A | 246 | Glutathione transferase O1; glutathione S-transfer | 98.74 | |
| 1vf1_A | 229 | Glutathione S-transferase 3; detoxification; HET: | 98.74 | |
| 2c3n_A | 247 | Glutathione S-transferase theta 1; glutathione tra | 98.73 | |
| 2ycd_A | 230 | Glutathione S-transferase; SOIL bacteria, herbicid | 98.71 | |
| 2hnl_A | 225 | Glutathione S-transferase 1; prostaglandin synthas | 98.71 | |
| 3h1n_A | 252 | Probable glutathione S-transferase; APC84167, bord | 98.71 | |
| 1okt_A | 211 | Glutathione S-transferase; GST; 1.9A {Plasmodium f | 98.71 | |
| 3c8e_A | 288 | YGHU, glutathione S-transferase homologue; glutath | 98.7 | |
| 1yy7_A | 213 | SSPA, stringent starvation protein A; GST fold, tr | 98.7 | |
| 1z9h_A | 290 | Membrane-associated prostaglandin E synthase-2; me | 98.69 | |
| 3r2q_A | 202 | Uncharacterized GST-like protein YIBF; transferase | 98.69 | |
| 2hra_A | 209 | Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, l | 98.68 | |
| 2hqt_A | 124 | GU4 nucleic-binding protein 1; GST-fold, biosynthe | 98.67 | |
| 4ecj_A | 244 | Glutathione S-transferase; transferase-like protei | 98.67 | |
| 4dej_A | 231 | Glutathione S-transferase related protein; transfe | 98.67 | |
| 1m0u_A | 249 | GST2 gene product; flight muscle protein, sigma, t | 98.67 | |
| 3fy7_A | 250 | Chloride intracellular channel protein 3; GST, glu | 98.66 | |
| 1e6b_A | 221 | Glutathione S-transferase; 1.65A {Arabidopsis thal | 98.64 | |
| 3m0f_A | 213 | Uncharacterized protein GST_N; PSI-2, NYSGXRC, glu | 98.63 | |
| 1k0m_A | 241 | CLIC1, NCC27, chloride intracellular channel prote | 98.62 | |
| 1gwc_A | 230 | Glutathione S-transferase TSI-1; herbicide detoxif | 98.62 | |
| 4ags_A | 471 | Thiol-dependent reductase 1; transferase, leishman | 98.59 | |
| 4g10_A | 265 | Glutathione S-transferase homolog; thioredoxin fol | 98.59 | |
| 2r4v_A | 247 | XAP121, chloride intracellular channel protein 2; | 98.59 | |
| 2ws2_A | 204 | NU-class GST, glutathione S-transferase; parasite, | 98.58 | |
| 2ahe_A | 267 | Chloride intracellular channel protein 4; glutathi | 98.58 | |
| 1oyj_A | 231 | Glutathione S-transferase; herbicide detoxificatio | 98.55 | |
| 3ir4_A | 218 | Glutaredoxin 2; glutathione, IDP00895, structural | 98.54 | |
| 3m1g_A | 362 | Putative glutathione S-transferase; ECM4-like subf | 98.54 | |
| 3ppu_A | 352 | Glutathione-S-transferase; GST fold; HET: GSH; 2.3 | 98.53 | |
| 3bby_A | 215 | Uncharacterized GST-like protein YFCF; NP_416804.1 | 98.51 | |
| 2yv7_A | 260 | CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c | 98.51 | |
| 2yv9_A | 291 | Chloride intracellular channel EXC-4; chloride ION | 98.43 | |
| 1bg5_A | 254 | MAB, fusion protein of alpha-Na,K-ATPase with glut | 98.42 | |
| 1k0d_A | 260 | URE2 protein; nitrate assimilation, structural gen | 98.37 | |
| 2fno_A | 248 | AGR_PAT_752P; thioredoxin fold, GST C-terminal dom | 98.34 | |
| 4f03_A | 253 | Glutathione transferase; GST fold; 1.80A {Phaneroc | 98.28 | |
| 4ags_A | 471 | Thiol-dependent reductase 1; transferase, leishman | 98.26 | |
| 4id0_A | 214 | Glutathione S-transferase-like protein YIBF; GST, | 98.22 | |
| 4akg_A | 2695 | Glutathione S-transferase class-MU 26 kDa isozyme | 98.01 | |
| 2hsn_A | 160 | Methionyl-tRNA synthetase, cytoplasmic; protein co | 93.87 |
| >3vk9_A Glutathione S-transferase delta; glutathione binding; 2.00A {Bombyx mori} | Back alignment and structure |
|---|
Probab=99.00 E-value=1.3e-09 Score=83.62 Aligned_cols=68 Identities=15% Similarity=0.207 Sum_probs=58.0
Q ss_pred CHHHHHHHHHHHHHHHHhhhccCCccCCCCCChhHHHHHHHHHHHhcCCCCCchHHHHHhhChhHHHHHHHHHHh
Q psy13308 52 SLDQVYKDVDKCCQSLSERLEKNNFFFKDKPTELDALLFGHIYAVLTTPLPNNRFASTIRAYPNLVEHCTRIEQN 126 (166)
Q Consensus 52 ~~~~~~~~~~~~L~~Le~~L~~~~yl~Gd~pT~aD~~vf~~l~~~~~~~~~~~~l~~~l~~~P~L~~y~~Ri~~r 126 (166)
..+...+.+.+.|+.||+.|++++|++|+++|+||+++++++..+..... .+++||+|.+|++||.++
T Consensus 124 ~~~~~~~~~~~~l~~le~~L~~~~~l~G~~~t~ADi~~~~~l~~~~~~~~-------~~~~~P~l~~w~~r~~a~ 191 (216)
T 3vk9_A 124 ADKAKNEKVQEALQLLDKFLEGQKYVAGPNLTVADLSLIASVSSLEASDI-------DFKKYANVKRWYETVKST 191 (216)
T ss_dssp CCHHHHHHHHHHHHHHHHHTTTCSBTTBSSCCHHHHHHHHHHHHGGGTTC-------CGGGSHHHHHHHHHHHHH
T ss_pred hHHHHHHHHHHHHHHHHHHhccCCCCCCCCCCHHHHHHHHHHHHHHHcCC-------CchhCHHHHHHHHHHHcc
Confidence 33556678899999999999999999999999999999999987765432 147899999999999887
|
| >1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A* | Back alignment and structure |
|---|
| >3iso_A Putative glutathione transferase; GST; HET: GSH; 1.90A {Clonorchis sinensis} | Back alignment and structure |
|---|
| >1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A* | Back alignment and structure |
|---|
| >4hi7_A GI20122; GST, glutathione S-transferase, enzyme function initiative, structural genomics, unknown function; HET: GSH; 1.25A {Drosophila mojavensis} | Back alignment and structure |
|---|
| >3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A* | Back alignment and structure |
|---|
| >3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A | Back alignment and structure |
|---|
| >3f6d_A Adgstd4-4, glutathione transferase GST1-4; HET: GTX; 1.70A {Anopheles dirus} PDB: 3f63_A* 1jlw_A* 3g7i_A* 3g7j_A* | Back alignment and structure |
|---|
| >3m3m_A Glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics; HET: GSH; 1.75A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >3gtu_B Glutathione S-transferase; conjugation, detoxification, cytosolic, heterodimer; 2.80A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >2c4j_A Glutathione S-transferase MU 2; glutathione transferase, multigene family; HET: GSO; 1.35A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1xw5_A* 1ykc_A* 2ab6_A* 2gtu_A 3gtu_A 3gur_A* 1hna_A* 1hnb_A* 1hnc_A* 1xw6_A* 1xwk_A* 1yj6_A* 2f3m_A* 2dc5_A 1gtu_A 4gtu_A 6gsu_A* 6gsv_A* 6gsw_A* 2gst_A* ... | Back alignment and structure |
|---|
| >1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >4glt_A Glutathione S-transferase-like protein; structural genomics, function initiative, EFI; HET: GSH; 2.20A {Methylobacillus flagellatus} | Back alignment and structure |
|---|
| >2fhe_A GST, glutathione S-transferase; transferase-substrate complex; HET: GSH; 2.30A {Fasciola hepatica} SCOP: a.45.1.1 c.47.1.5 PDB: 2wrt_A 1fhe_A* | Back alignment and structure |
|---|
| >3gx0_A GST-like protein YFCG; transferase, glutathione, glutathione disulfide, disulfide bond oxidoreductase; HET: GDS; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >2uz8_A Eukaryotic translation elongation factor 1 epsilon-1; protein biosynthesis, aminoacyl-tRNA synthetase, GST, nuclear protein, RNA-binding protein; HET: MSE; 2.0A {Homo sapiens} | Back alignment and structure |
|---|
| >1n2a_A Glutathione S-transferase; HET: GTS; 1.90A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 PDB: 1a0f_A* | Back alignment and structure |
|---|
| >1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A* | Back alignment and structure |
|---|
| >4gci_A Glutathione S-transferase; GST, enzyme function initiative, structural genomics; HET: GSH; 1.50A {Yersinia pestis} PDB: 4g9h_A* | Back alignment and structure |
|---|
| >1gsu_A GST, CGSTM1-1, class-MU glutathione S-transferase; detoxification enzyme, S-hexyl glutathione; HET: GTX; 1.94A {Gallus gallus} SCOP: a.45.1.1 c.47.1.5 PDB: 1c72_A* | Back alignment and structure |
|---|
| >4hz4_A Glutathione-S-transferase; enzyme function initiative; 1.62A {Actinobacillus pleuropneumoniae} | Back alignment and structure |
|---|
| >2x64_A Glutathione-S-transferase; detoxification enzyme; HET: GSH; 2.30A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A* | Back alignment and structure |
|---|
| >3lsz_A Glutathione S-transferase; xenobiotic, biodegradative metabolism, PSI2, NYSGXRC, structural genomics, protein structure initiative; HET: GSH; 1.70A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >4exj_A Uncharacterized protein; transferase-like protein, transcription regulation, transfer structural genomics; 1.64A {Lodderomyces elongisporus nrrl yb-4239} | Back alignment and structure |
|---|
| >2pvq_A Glutathione S-transferase; xenobiotics detoxification, H-site; HET: GSH; 1.80A {Ochrobactrum anthropi} PDB: 2nto_A* | Back alignment and structure |
|---|
| >4hz2_A Glutathione S-transferase domain; glutathione,enzyme function initiative; HET: GSH; 1.50A {Xanthobacter autotrophicus} | Back alignment and structure |
|---|
| >3m8n_A Possible glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, nysgxrc; 2.04A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >4ikh_A Glutathione S-transferase; enzyme function initiative, EFI, structural genomics; HET: GSH; 2.10A {Pseudomonas protegens} | Back alignment and structure |
|---|
| >2dsa_A Glutathione S-transferase; HET: GSH HPX; 2.10A {Burkholderia xenovorans} PDB: 2gdr_A* | Back alignment and structure |
|---|
| >3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* | Back alignment and structure |
|---|
| >1dug_A Chimera of glutathione S-transferase-synthetic linker-C-terminal fibrinogen gamma...; gamma chain integrin fragment; HET: GSH; 1.80A {Schistosoma japonicum} SCOP: a.45.1.1 c.47.1.5 PDB: 1gne_A* 3qmz_T 1y6e_A 1m9a_A* 1gtb_A* 1gta_A* 1m99_A* 1m9b_A* 1ua5_A* 1u87_A* 1u88_A* 3crt_A* 3cru_A* 3d0z_A* | Back alignment and structure |
|---|
| >2cvd_A Glutathione-requiring prostaglandin D synthase; glutathione-S-transferase, isomerase; HET: GSH HQL; 1.45A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1iyi_A* 1v40_A* 1iyh_A* 3vi5_A* 3vi7_A* 2vcq_A* 2vcw_A* 2vcx_A* 2vcz_A* 2vd0_A* 2vd1_A* 3kxo_A* 3ee2_A* 1pd2_1* | Back alignment and structure |
|---|
| >3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >3n5o_A Glutathione transferase; seattle structural genomics center for infectious disease, S GST, pathogenic fungus, coccidioidomycosis; HET: GSH; 1.85A {Coccidioides immitis} PDB: 3lg6_A* | Back alignment and structure |
|---|
| >2on5_A Nagst-2, Na glutathione S-transferase 2; hookworm; HET: GSH; 1.90A {Necator americanus} | Back alignment and structure |
|---|
| >1f2e_A Glutathione S-transferase; GST complexed with glutathione, thioredoxin superfamily fold transferase; HET: GSH; 2.30A {Sphingomonas paucimobilis} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >2on7_A Nagst-1, Na glutathione S-transferase 1; hookworm; 2.40A {Necator americanus} | Back alignment and structure |
|---|
| >1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >4gf0_A Glutathione S-transferase; GST, enzyme function initiative, EFI, structural genomics; HET: GSH; 1.75A {Sulfitobacter} | Back alignment and structure |
|---|
| >1oe8_A Glutathione S-transferase; schistosomiasis, detoxifying enzyme, prostaglandin D2 synthase, vaccine candidate; HET: GSH; 1.65A {Schistosoma haematobium} SCOP: a.45.1.1 c.47.1.5 PDB: 1oe7_A* 2c80_A* 2ca8_A* 2f8f_A* 2c8u_A 2caq_A* 2cai_A* 1u3i_A* | Back alignment and structure |
|---|
| >3ik7_A Glutathione S-transferase A4; human GST A4-4, enzyme, cytoplasm, polymorphism; HET: BOB; 1.97A {Homo sapiens} PDB: 1gum_A 1gul_A* | Back alignment and structure |
|---|
| >1pmt_A PMGST, GST B1-1, glutathione transferase; glutathione-conjugating, A putative oxidoreduct; HET: GSH; 2.50A {Proteus mirabilis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pmt_A* | Back alignment and structure |
|---|
| >3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2gsq_A Squid GST, glutathione S-transferase; squid digestive gland, sigma class; HET: GBI; 2.20A {Ommastrephes sloani} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsq_A* | Back alignment and structure |
|---|
| >3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* | Back alignment and structure |
|---|
| >1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A* | Back alignment and structure |
|---|
| >4g0i_A Protein YQJG; glutathionyl-hydroquinone reductase, oxidoreductase; HET: MES; 2.05A {Escherichia coli} PDB: 3r3e_A* 4g0k_A* 4g0l_A* | Back alignment and structure |
|---|
| >3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori} | Back alignment and structure |
|---|
| >3ic8_A Uncharacterized GST-like proteinprotein; glutathione, transferase, PSI, MCSG, structural genomics; 2.40A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >1yq1_A Glutathione S-transferase; nematoda, structural genomics, PSI, protein structure initiative; 3.00A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1tw9_A Glutathione S-transferase 2; 1.71A {Heligmosomoides polygyrus} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >4iel_A Glutathione S-transferase, N-terminal domain PROT; GST, glutathione S-transferase, enzyme function initiative, structural genomics; HET: GSH; 1.60A {Burkholderia ambifaria} | Back alignment and structure |
|---|
| >3uar_A Glutathione S-transferase; GSH binding site; HET: GSH; 2.60A {Methylococcus capsulatus} PDB: 3uap_A* | Back alignment and structure |
|---|
| >2a2r_A Glutathione S-transferase P; detoxification, nitric oxide carrier, S- nitrosoglutathione; HET: MES GSN; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 11gs_A* 12gs_A* 14gs_A* 16gs_A* 18gs_A* 21gs_A* 13gs_A* 2a2s_A* 3dd3_A* 3dgq_A* 3n9j_A* 3pgt_A* 1pgt_A* 2pgt_A* 4pgt_A* 22gs_A* 17gs_A* 3gus_A* 10gs_A* 1aqv_A* ... | Back alignment and structure |
|---|
| >1b48_A GST, mgsta4-4, protein (glutathione S-transferase); subunit cooperativity; HET: HAG GSH; 2.60A {Mus musculus} SCOP: a.45.1.1 c.47.1.5 PDB: 1guk_A | Back alignment and structure |
|---|
| >3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A* | Back alignment and structure |
|---|
| >3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* | Back alignment and structure |
|---|
| >4hoj_A REGF protein; GST, glutathione S-transferase, enzyme function initiative, structural genomics, transferase; HET: GSH; 1.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >1tu7_A Glutathione S-transferase 2; HET: GSH; 1.50A {Onchocerca volvulus} SCOP: a.45.1.1 c.47.1.5 PDB: 1tu8_A* | Back alignment and structure |
|---|
| >2wb9_A Glutathione transferase sigma class; thioredoxin fold; HET: GSH; 1.59A {Fasciola hepatica} PDB: 2wdu_A* | Back alignment and structure |
|---|
| >3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* | Back alignment and structure |
|---|
| >2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A* | Back alignment and structure |
|---|
| >1zl9_A GST class-sigma, glutathione S-transferase 5; glutathione transferase, C.elegans; HET: GSH; 2.01A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >4fqu_A Putative glutathione transferase; glutathionyl-hydroquinone reductases, oxidoredu; 3.00A {Sphingobium chlorophenolicum} | Back alignment and structure |
|---|
| >2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A* | Back alignment and structure |
|---|
| >1k3y_A GSTA1-1, glutathione S-transferase A1; S-hexyl glutatione, water structu transferase; HET: GTX; 1.30A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsf_A* 1guh_A* 1gsd_A* 1k3o_A 1k3l_A* 1pl1_A* 1pkz_A 1pkw_A* 2r6k_A* 1gse_A* 3u6v_A 1usb_A* 1ydk_A* 3q74_A 3ktl_A* 1pl2_A* 2r3x_A* 1xwg_A 3l0h_A* 1ags_A* ... | Back alignment and structure |
|---|
| >2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* | Back alignment and structure |
|---|
| >2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A* | Back alignment and structure |
|---|
| >1b8x_A Protein (AML-1B); nuclear matrix targeting signal protein, signal protein; 2.70A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori} | Back alignment and structure |
|---|
| >1vf1_A Glutathione S-transferase 3; detoxification; HET: GSH; 1.77A {Gallus gallus} PDB: 1vf2_A* 1vf3_A* 1vf4_A | Back alignment and structure |
|---|
| >2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A | Back alignment and structure |
|---|
| >2ycd_A Glutathione S-transferase; SOIL bacteria, herbicide detoxification; HET: GTB; 1.40A {Agrobacterium tumefaciens} PDB: 3lq7_A | Back alignment and structure |
|---|
| >2hnl_A Glutathione S-transferase 1; prostaglandin synthase, river BLI onchocerca volvulus, immune modulation; HET: GSH; 2.00A {Onchocerca volvulus} | Back alignment and structure |
|---|
| >3h1n_A Probable glutathione S-transferase; APC84167, bordetella bronchisepti structural genomics, PSI-2, protein structure initiative; 1.83A {Bordetella bronchiseptica RB50} | Back alignment and structure |
|---|
| >1okt_A Glutathione S-transferase; GST; 1.9A {Plasmodium falciparum} SCOP: a.45.1.1 c.47.1.5 PDB: 1pa3_A 1q4j_A* 3fr9_A* 3frc_A* 2aaw_A* 3fr6_A 3fr3_A* | Back alignment and structure |
|---|
| >3c8e_A YGHU, glutathione S-transferase homologue; glutathione transferase homologue, E. coli; HET: GSH; 1.50A {Escherichia coli} | Back alignment and structure |
|---|
| >1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} | Back alignment and structure |
|---|
| >1z9h_A Membrane-associated prostaglandin E synthase-2; membran associated protein, indomethacin, isomerase; HET: IMN; 2.60A {Macaca fascicularis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pbj_A* | Back alignment and structure |
|---|
| >3r2q_A Uncharacterized GST-like protein YIBF; transferase, glutathione; HET: GSH; 1.05A {Escherichia coli} | Back alignment and structure |
|---|
| >2hra_A Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, ligase; 1.90A {Saccharomyces cerevisiae} PDB: 2hrk_A 2hsm_A | Back alignment and structure |
|---|
| >2hqt_A GU4 nucleic-binding protein 1; GST-fold, biosynthetic protein, RNA binding; 1.90A {Saccharomyces cerevisiae} SCOP: a.45.1.2 PDB: 2hrk_B 2hsm_B 2hsn_B | Back alignment and structure |
|---|
| >4ecj_A Glutathione S-transferase; transferase-like protein, transcription regulation; HET: GSH; 1.76A {Pseudomonas aeruginosa} PDB: 4eci_A* | Back alignment and structure |
|---|
| >4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis} | Back alignment and structure |
|---|
| >1m0u_A GST2 gene product; flight muscle protein, sigma, transferase; HET: GSH; 1.75A {Drosophila melanogaster} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A | Back alignment and structure |
|---|
| >1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3m0f_A Uncharacterized protein GST_N; PSI-2, NYSGXRC, glutathione, structural genomics, protein structure initiative; HET: GSH; 1.60A {Pseudomonas fluorescens} PDB: 3lxt_A* | Back alignment and structure |
|---|
| >1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A | Back alignment and structure |
|---|
| >1gwc_A Glutathione S-transferase TSI-1; herbicide detoxification, plant, TAU class; HET: GTX; 2.25A {Aegilops tauschii} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} | Back alignment and structure |
|---|
| >4g10_A Glutathione S-transferase homolog; thioredoxin fold; HET: MSE GSH; 1.20A {Sphingomonas paucimobilis} | Back alignment and structure |
|---|
| >2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A* | Back alignment and structure |
|---|
| >2ws2_A NU-class GST, glutathione S-transferase; parasite, nematode; 2.01A {Haemonchus contortus} | Back alignment and structure |
|---|
| >2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A | Back alignment and structure |
|---|
| >1oyj_A Glutathione S-transferase; herbicide detoxification; HET: GSH; 1.95A {Oryza sativa} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A | Back alignment and structure |
|---|
| >3m1g_A Putative glutathione S-transferase; ECM4-like subfamily, GST_C family, structural genomics, PSI- protein structure initiative; 2.10A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3ppu_A Glutathione-S-transferase; GST fold; HET: GSH; 2.30A {Phanerochaete chrysosporium} | Back alignment and structure |
|---|
| >3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli} | Back alignment and structure |
|---|
| >2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2yv9_A Chloride intracellular channel EXC-4; chloride ION channel, CLIC, GST fold, metal transport; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1bg5_A MAB, fusion protein of alpha-Na,K-ATPase with glutathione S-transferase; ankyrin binding, carrier crystallization, ION transport; 2.60A {Rattus norvegicus} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1k0d_A URE2 protein; nitrate assimilation, structural genomics, gene regulation; HET: GSH; 2.20A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 PDB: 1jzr_A* 1k0b_A* 1k0c_A* 1k0a_A* 1g6w_A 1g6y_A 1hqo_A | Back alignment and structure |
|---|
| >2fno_A AGR_PAT_752P; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics, JCSG; 2.00A {Agrobacterium tumefaciens} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >4f03_A Glutathione transferase; GST fold; 1.80A {Phanerochaete chrysosporium} PDB: 4g19_A* | Back alignment and structure |
|---|
| >4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} | Back alignment and structure |
|---|
| >4id0_A Glutathione S-transferase-like protein YIBF; GST, enzyme function initiative, structural genomics; HET: GSF; 1.10A {Pseudomonas fluorescens} PDB: 4ibp_A* | Back alignment and structure |
|---|
| >4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A | Back alignment and structure |
|---|
| >2hsn_A Methionyl-tRNA synthetase, cytoplasmic; protein complex protein interaction GST-fold, ligase/RNA binding protein complex; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 166 | ||||
| d2gsta1 | 133 | a.45.1.1 (A:85-217) Class mu GST {Rat (Rattus norv | 4e-04 | |
| d2fhea1 | 136 | a.45.1.1 (A:81-216) Class alpha GST {Fasciola hepa | 0.002 |
| >d2gsta1 a.45.1.1 (A:85-217) Class mu GST {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 133 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: GST C-terminal domain-like superfamily: GST C-terminal domain-like family: Glutathione S-transferase (GST), C-terminal domain domain: Class mu GST species: Rat (Rattus norvegicus) [TaxId: 10116]
Score = 36.1 bits (83), Expect = 4e-04
Identities = 19/77 (24%), Positives = 30/77 (38%), Gaps = 6/77 (7%)
Query: 50 EKSLDQVYKDVDKCCQSLSERLEKNNFFFKDKPTELDALLFGHIYAVLTTPLPNNRFAST 109
EK + K + + + SE L K +F DK T +D L + +
Sbjct: 36 EKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQYHIF------EPKC 89
Query: 110 IRAYPNLVEHCTRIEQN 126
+ A+PNL + R E
Sbjct: 90 LDAFPNLKDFLARFEGL 106
|
| >d2fhea1 a.45.1.1 (A:81-216) Class alpha GST {Fasciola hepatica [TaxId: 6192]} Length = 136 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 166 | |||
| d1gnwa1 | 126 | Class phi GST {Mouse-ear cress (Arabidopsis thalia | 99.3 | |
| d1jlva1 | 123 | Class delta GST {Mosquito (Anopheles dirus b), iso | 99.23 | |
| d1v2aa1 | 125 | Class delta GST {Mosquito (Anopheles dirus b), iso | 99.23 | |
| d1axda1 | 129 | Class phi GST {Maize (Zea mays), type I [TaxId: 45 | 99.22 | |
| d1r5aa1 | 129 | Class delta GST {Mosquito (Anopheles dirus b), iso | 99.21 | |
| d1aw9a1 | 135 | Class phi GST {Maize (Zea mays), type III [TaxId: | 99.18 | |
| d1jlwa1 | 127 | Class delta GST {Mosquito (Anopheles dirus b), iso | 99.15 | |
| d1nhya1 | 144 | GST-like domain of elongation factor 1-gamma {Bake | 99.14 | |
| d1ljra1 | 165 | Class theta GST {Human (Homo sapiens) [TaxId: 9606 | 99.1 | |
| d1f2ea1 | 121 | Class beta GST {Sphingomonas paucimobilis [TaxId: | 99.09 | |
| d1n2aa1 | 121 | Class beta GST {Escherichia coli [TaxId: 562]} | 99.09 | |
| d2c4ja1 | 133 | Class mu GST {Human (Homo sapiens) [TaxId: 9606]} | 99.05 | |
| d1pmta1 | 121 | Class beta GST {Proteus mirabilis [TaxId: 584]} | 99.03 | |
| d2cvda1 | 124 | Class sigma GST {Human (Homo sapiens) [TaxId: 9606 | 99.02 | |
| d1gsua1 | 133 | Class mu GST {Chicken (Gallus gallus) [TaxId: 9031 | 99.02 | |
| d1k0da1 | 151 | Yeast prion protein ure2p, nitrogen regulation fra | 98.99 | |
| d3gtub1 | 140 | Class mu GST {Human (Homo sapiens) [TaxId: 9606]} | 98.99 | |
| d1duga1 | 140 | Class alpha GST {Schistosoma japonicum [TaxId: 618 | 98.98 | |
| d2gsta1 | 133 | Class mu GST {Rat (Rattus norvegicus) [TaxId: 1011 | 98.98 | |
| d2gsqa1 | 127 | Class sigma GST {Squid (Ommastrephes sloani pacifi | 98.98 | |
| d2fhea1 | 136 | Class alpha GST {Fasciola hepatica [TaxId: 6192]} | 98.95 | |
| d1eema1 | 139 | Class omega GST {Human (Homo sapiens) [TaxId: 9606 | 98.92 | |
| d1fw1a1 | 125 | Class zeta GST {Human (Homo sapiens) [TaxId: 9606] | 98.9 | |
| d2a2ra1 | 132 | Class pi GST {Human (Homo sapiens) [TaxId: 9606]} | 98.89 | |
| d1tw9a1 | 129 | Class sigma GST {Heligmosomoides polygyrus [TaxId: | 98.87 | |
| d1b48a1 | 143 | Class alpha GST {Mouse (Mus musculus), (a1-4) [Tax | 98.83 | |
| d1gwca1 | 138 | Class tau GST {Aegilops tauschii, also known as Tr | 98.82 | |
| d1k3ya1 | 142 | Class alpha GST {Human (Homo sapiens), (a1-1) [Tax | 98.78 | |
| d1e6ba1 | 133 | Class zeta GST {Mouse-ear cress (Arabidopsis thali | 98.76 | |
| d1m0ua1 | 127 | Class sigma GST {Fruit fly (Drosophila melanogaste | 98.75 | |
| d1okta1 | 126 | Pf GST {Malarial parasite (Plasmodium falciparum) | 98.75 | |
| d1gula1 | 140 | Class alpha GST {Human (Homo sapiens), (a1-1) [Tax | 98.75 | |
| d1z9ha1 | 161 | Microsomal prostaglandin E synthase-2 {Crab-eating | 98.75 | |
| d1tu7a1 | 131 | Class pi GST {Onchocerca volvulus [TaxId: 6282]} | 98.72 | |
| d2hrkb1 | 118 | GU4 nucleic-binding protein 1, Arc1p {Baker's yeas | 98.64 | |
| d1oe8a1 | 123 | Class alpha GST {Blood fluke (Schistosoma haematob | 98.53 | |
| d1oyja1 | 145 | Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} | 98.51 | |
| d1k0ma1 | 149 | Chloride intracellular channel 1 (clic1) {Human (H | 98.38 | |
| d1g7oa1 | 140 | Glutaredoxin 2 {Escherichia coli [TaxId: 562]} | 95.18 | |
| d2fnoa1 | 149 | Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobac | 94.8 |
| >d1gnwa1 a.45.1.1 (A:86-211) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: GST C-terminal domain-like superfamily: GST C-terminal domain-like family: Glutathione S-transferase (GST), C-terminal domain domain: Class phi GST species: Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]
Probab=99.30 E-value=4.1e-12 Score=89.70 Aligned_cols=68 Identities=18% Similarity=0.176 Sum_probs=58.5
Q ss_pred HHHHHHHHHHHHHHHhhhccCCccCCCCCChhHHHHHHHHHHHhcCCCCCchHHHHHhhChhHHHHHHHHHHh
Q psy13308 54 DQVYKDVDKCCQSLSERLEKNNFFFKDKPTELDALLFGHIYAVLTTPLPNNRFASTIRAYPNLVEHCTRIEQN 126 (166)
Q Consensus 54 ~~~~~~~~~~L~~Le~~L~~~~yl~Gd~pT~aD~~vf~~l~~~~~~~~~~~~l~~~l~~~P~L~~y~~Ri~~r 126 (166)
++..+.+.+.|+.||++|++++|++|+++|.|||.+++++..+...+ ....+++||||.+|++||.+|
T Consensus 52 ~~~~~~l~~~l~~le~~L~~~~yl~Gd~~TlADi~~~~~l~~~~~~~-----~~~~~~~~P~l~~W~~rl~~R 119 (126)
T d1gnwa1 52 AEEEAKLAKVLDVYEARLKEFKYLAGETFTLTDLHHIPAIQYLLGTP-----TKKLFTERPRVNEWVAEITKR 119 (126)
T ss_dssp HHHHHHHHHHHHHHHHHHTTCSSSSSSSCCHHHHTTHHHHHHHTTSG-----GGHHHHTSHHHHHHHHHHHSS
T ss_pred HHHHHHHHHHHHHHHHHHccCCccccCccccchHHHHHHHHHHHHcC-----cccccccCHHHHHHHHHHHcC
Confidence 45677889999999999999999999999999999999998775542 244568999999999999886
|
| >d1jlva1 a.45.1.1 (A:85-207) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1v2aa1 a.45.1.1 (A:84-208) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1axda1 a.45.1.1 (A:81-210) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1r5aa1 a.45.1.1 (A:87-215) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1aw9a1 a.45.1.1 (A:83-217) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1jlwa1 a.45.1.1 (A:91-217) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-4 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1nhya1 a.45.1.1 (A:76-219) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ljra1 a.45.1.1 (A:80-244) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f2ea1 a.45.1.1 (A:81-201) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} | Back information, alignment and structure |
|---|
| >d1n2aa1 a.45.1.1 (A:81-201) Class beta GST {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2c4ja1 a.45.1.1 (A:86-218) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pmta1 a.45.1.1 (A:81-201) Class beta GST {Proteus mirabilis [TaxId: 584]} | Back information, alignment and structure |
|---|
| >d2cvda1 a.45.1.1 (A:76-199) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gsua1 a.45.1.1 (A:85-217) Class mu GST {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1k0da1 a.45.1.1 (A:201-351) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d3gtub1 a.45.1.1 (B:85-224) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1duga1 a.45.1.1 (A:81-220) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} | Back information, alignment and structure |
|---|
| >d2gsta1 a.45.1.1 (A:85-217) Class mu GST {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2gsqa1 a.45.1.1 (A:76-202) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} | Back information, alignment and structure |
|---|
| >d2fhea1 a.45.1.1 (A:81-216) Class alpha GST {Fasciola hepatica [TaxId: 6192]} | Back information, alignment and structure |
|---|
| >d1eema1 a.45.1.1 (A:103-241) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fw1a1 a.45.1.1 (A:88-212) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2a2ra1 a.45.1.1 (A:78-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tw9a1 a.45.1.1 (A:78-206) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} | Back information, alignment and structure |
|---|
| >d1b48a1 a.45.1.1 (A:80-222) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gwca1 a.45.1.1 (A:87-224) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} | Back information, alignment and structure |
|---|
| >d1k3ya1 a.45.1.1 (A:81-222) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e6ba1 a.45.1.1 (A:88-220) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1m0ua1 a.45.1.1 (A:123-249) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1okta1 a.45.1.1 (A:86-211) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1gula1 a.45.1.1 (A:81-220) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z9ha1 a.45.1.1 (A:213-373) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} | Back information, alignment and structure |
|---|
| >d1tu7a1 a.45.1.1 (A:78-208) Class pi GST {Onchocerca volvulus [TaxId: 6282]} | Back information, alignment and structure |
|---|
| >d2hrkb1 a.45.1.2 (B:4-121) GU4 nucleic-binding protein 1, Arc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1oe8a1 a.45.1.1 (A:85-207) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} | Back information, alignment and structure |
|---|
| >d1oyja1 a.45.1.1 (A:86-230) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1k0ma1 a.45.1.1 (A:92-240) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g7oa1 a.45.1.1 (A:76-215) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fnoa1 a.45.1.1 (A:88-236) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|