Psyllid ID: psy13383
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 105 | ||||||
| 322790209 | 228 | hypothetical protein SINV_04238 [Solenop | 0.533 | 0.245 | 0.892 | 1e-21 | |
| 289741155 | 243 | vacuolar assembly/sorting protein DID4 [ | 0.533 | 0.230 | 0.875 | 3e-21 | |
| 307175574 | 227 | Charged multivesicular body protein 2a [ | 0.533 | 0.246 | 0.875 | 4e-21 | |
| 332019427 | 228 | Charged multivesicular body protein 2a [ | 0.533 | 0.245 | 0.875 | 4e-21 | |
| 66509926 | 227 | PREDICTED: charged multivesicular body p | 0.533 | 0.246 | 0.857 | 6e-21 | |
| 380025498 | 227 | PREDICTED: charged multivesicular body p | 0.533 | 0.246 | 0.857 | 6e-21 | |
| 383857259 | 227 | PREDICTED: charged multivesicular body p | 0.533 | 0.246 | 0.857 | 6e-21 | |
| 195454116 | 251 | GK14462 [Drosophila willistoni] gi|19417 | 0.533 | 0.223 | 0.857 | 6e-21 | |
| 195349629 | 256 | GM10303 [Drosophila sechellia] gi|194123 | 0.533 | 0.218 | 0.857 | 7e-21 | |
| 195151933 | 256 | GL21825 [Drosophila persimilis] gi|19411 | 0.533 | 0.218 | 0.857 | 7e-21 |
| >gi|322790209|gb|EFZ15208.1| hypothetical protein SINV_04238 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
Score = 106 bits (265), Expect = 1e-21, Method: Compositional matrix adjust.
Identities = 50/56 (89%), Positives = 54/56 (96%)
Query: 1 MEWLFGRKITPEEMLRKNQRALNKAMRDLDREKQHMEQQEKKLIADIKKMAKEGQM 56
MEWLFG++ITPEEMLRKNQRALNKAMRDLDREK MEQQEKK+IADIKK+AKEGQM
Sbjct: 1 MEWLFGKRITPEEMLRKNQRALNKAMRDLDREKMRMEQQEKKIIADIKKLAKEGQM 56
|
Source: Solenopsis invicta Species: Solenopsis invicta Genus: Solenopsis Family: Formicidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|289741155|gb|ADD19325.1| vacuolar assembly/sorting protein DID4 [Glossina morsitans morsitans] | Back alignment and taxonomy information |
|---|
| >gi|307175574|gb|EFN65486.1| Charged multivesicular body protein 2a [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|332019427|gb|EGI59911.1| Charged multivesicular body protein 2a [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|66509926|ref|XP_625164.1| PREDICTED: charged multivesicular body protein 2a-like [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|380025498|ref|XP_003696510.1| PREDICTED: charged multivesicular body protein 2a-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|383857259|ref|XP_003704122.1| PREDICTED: charged multivesicular body protein 2a-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|195454116|ref|XP_002074094.1| GK14462 [Drosophila willistoni] gi|194170179|gb|EDW85080.1| GK14462 [Drosophila willistoni] | Back alignment and taxonomy information |
|---|
| >gi|195349629|ref|XP_002041345.1| GM10303 [Drosophila sechellia] gi|194123040|gb|EDW45083.1| GM10303 [Drosophila sechellia] | Back alignment and taxonomy information |
|---|
| >gi|195151933|ref|XP_002016893.1| GL21825 [Drosophila persimilis] gi|194111950|gb|EDW33993.1| GL21825 [Drosophila persimilis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 105 | ||||||
| FB|FBgn0039402 | 256 | vps2 "vps2" [Drosophila melano | 0.533 | 0.218 | 0.857 | 7e-22 | |
| ZFIN|ZDB-GENE-040426-2922 | 220 | bc2 "putative breast adenocarc | 0.533 | 0.254 | 0.821 | 5.7e-20 | |
| UNIPROTKB|Q3T0U5 | 222 | CHMP2A "Chromatin modifying pr | 0.533 | 0.252 | 0.75 | 2.8e-18 | |
| UNIPROTKB|E2RIU2 | 222 | CHMP2A "Uncharacterized protei | 0.533 | 0.252 | 0.75 | 2.8e-18 | |
| UNIPROTKB|O43633 | 222 | CHMP2A "Charged multivesicular | 0.533 | 0.252 | 0.75 | 2.8e-18 | |
| MGI|MGI:1916203 | 222 | Chmp2a "charged multivesicular | 0.533 | 0.252 | 0.75 | 2.8e-18 | |
| RGD|1305050 | 222 | Chmp2a "charged multivesicular | 0.533 | 0.252 | 0.75 | 2.8e-18 | |
| UNIPROTKB|Q5ZHN1 | 220 | CHMP2A "Charged multivesicular | 0.533 | 0.254 | 0.714 | 4.1e-17 | |
| WB|WBGene00012903 | 237 | vps-2 [Caenorhabditis elegans | 0.533 | 0.236 | 0.696 | 2.9e-16 | |
| CGD|CAL0003689 | 235 | VPS2 [Candida albicans (taxid: | 0.533 | 0.238 | 0.642 | 3.3e-15 |
| FB|FBgn0039402 vps2 "vps2" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 255 (94.8 bits), Expect = 7.0e-22, P = 7.0e-22
Identities = 48/56 (85%), Positives = 54/56 (96%)
Query: 1 MEWLFGRKITPEEMLRKNQRALNKAMRDLDREKQHMEQQEKKLIADIKKMAKEGQM 56
M+WLFG+KI+P+EMLRKNQRALNKAMRDLDRE+ MEQQEKK+IADIKKMAKEGQM
Sbjct: 1 MDWLFGKKISPDEMLRKNQRALNKAMRDLDRERMKMEQQEKKIIADIKKMAKEGQM 56
|
|
| ZFIN|ZDB-GENE-040426-2922 bc2 "putative breast adenocarcinoma marker" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3T0U5 CHMP2A "Chromatin modifying protein 2A" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RIU2 CHMP2A "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O43633 CHMP2A "Charged multivesicular body protein 2a" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1916203 Chmp2a "charged multivesicular body protein 2A" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1305050 Chmp2a "charged multivesicular body protein 2A" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5ZHN1 CHMP2A "Charged multivesicular body protein 2a" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00012903 vps-2 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0003689 VPS2 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 105 | |||
| pfam03357 | 169 | pfam03357, Snf7, Snf7 | 1e-06 |
| >gnl|CDD|146145 pfam03357, Snf7, Snf7 | Back alignment and domain information |
|---|
Score = 43.8 bits (104), Expect = 1e-06
Identities = 17/40 (42%), Positives = 31/40 (77%)
Query: 17 KNQRALNKAMRDLDREKQHMEQQEKKLIADIKKMAKEGQM 56
+ +L KA+R+LD++++ +E++ KKL A+IKK+AK+G
Sbjct: 1 EAILSLRKAIRELDKKQESLEKKIKKLEAEIKKLAKKGNK 40
|
This family of proteins are involved in protein sorting and transport from the endosome to the vacuole/lysosome in eukaryotic cells. Vacuoles/lysosomes play an important role in the degradation of both lipids and cellular proteins. In order to perform this degradative function, vacuoles/lysosomes contain numerous hydrolases which have been transported in the form of inactive precursors via the biosynthetic pathway and are proteolytically activated upon delivery to the vacuole/lysosome. The delivery of transmembrane proteins, such as activated cell surface receptors to the lumen of the vacuole/lysosome, either for degradation/downregulation, or in the case of hydrolases, for proper localisation, requires the formation of multivesicular bodies (MVBs). These late endosomal structures are formed by invaginating and budding of the limiting membrane into the lumen of the compartment. During this process, a subset of the endosomal membrane proteins is sorted into the forming vesicles. Mature MVBs fuse with the vacuole/lysosome, thereby releasing cargo containing vesicles into its hydrolytic lumen for degradation. Endosomal proteins that are not sorted into the intralumenal MVB vesicles are either recycled back to the plasma membrane or Golgi complex, or remain in the limiting membrane of the MVB and are thereby transported to the limiting membrane of the vacuole/lysosome as a consequence of fusion. Therefore, the MVB sorting pathway plays a critical role in the decision between recycling and degradation of membrane proteins. A few archaeal sequences are also present within this family. Length = 169 |
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 105 | |||
| 2gd5_A | 179 | Charged multivesicular BODY protein 3; CHMP3, ESCR | 5e-10 | |
| 3frt_A | 218 | Charged multivesicular BODY protein 3; ESCRT, ESCR | 1e-09 |
| >2gd5_A Charged multivesicular BODY protein 3; CHMP3, ESCRT-III, protein transport; 2.80A {Homo sapiens} PDB: 3frv_A Length = 179 | Back alignment and structure |
|---|
Score = 52.4 bits (125), Expect = 5e-10
Identities = 14/49 (28%), Positives = 31/49 (63%)
Query: 8 KITPEEMLRKNQRALNKAMRDLDREKQHMEQQEKKLIADIKKMAKEGQM 56
+ P+E++ + + K MR +DR+ + ++++E+K+ +K AK+GQ
Sbjct: 5 EKPPKELVNEWSLKIRKEMRVVDRQIRDIQREEEKVKRSVKDAAKKGQK 53
|
| >3frt_A Charged multivesicular BODY protein 3; ESCRT, ESCRT-111, CHMP, IST1, coiled coil, cytoplasm, lipoprotein, membrane, myristate, phosphoprotein; 4.00A {Homo sapiens} Length = 218 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 105 | |||
| 3frt_A | 218 | Charged multivesicular BODY protein 3; ESCRT, ESCR | 99.9 | |
| 2gd5_A | 179 | Charged multivesicular BODY protein 3; CHMP3, ESCR | 99.86 | |
| 4dci_A | 150 | Uncharacterized protein; PSI-biology, midwest cent | 81.11 |
| >3frt_A Charged multivesicular BODY protein 3; ESCRT, ESCRT-111, CHMP, IST1, coiled coil, cytoplasm, lipoprotein, membrane, myristate, phosphoprotein; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.90 E-value=2.4e-24 Score=165.29 Aligned_cols=81 Identities=20% Similarity=0.302 Sum_probs=75.0
Q ss_pred CCCCHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHhcCccchhHhHHHHHHHHHHHhchhhhhhhhccc
Q psy13383 7 RKITPEEMLRKNQRALNKAMRDLDREKQHMEQQEKKLIADIKKMAKEGQMTLSTERHVALLLEFVIIVGPENRENFENSD 86 (105)
Q Consensus 7 kk~tPkEqlRe~kr~LRk~~R~LDRei~~LereEkKl~~~IKk~AKkgd~~~aki~~~~LAKElVr~rK~~~Rl~~~ks~ 86 (105)
++|||+|++|+|+|.||+++|+|||++++|+++|++++.+||++||+||+++||| ||++|||+|+++.|+|.++|+
T Consensus 4 ~~~~p~e~~r~~~r~Lr~~~R~LdR~~~kle~eEkk~~~~IKkaakkg~~~~ari----lAkelVR~Rk~~~rl~~~kaq 79 (218)
T 3frt_A 4 QEKPPKELVNEWSLKIRKEMRVVDRQIRDIQREEEKVKRSVKDAAKKGQKDVCIV----LAKEMIRSRKAVSKLYASKAH 79 (218)
T ss_dssp ----CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCHHHHHH----HHHHHHHHHHHHHHHHHHHHH
T ss_pred CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCHHHHHH----HHHHHHHHHHHHHHHHHHHHH
Confidence 4689999999999999999999999999999999999999999999999999999 999999999999999999999
Q ss_pred ccccc
Q psy13383 87 LRPQS 91 (105)
Q Consensus 87 l~~q~ 91 (105)
|++-+
T Consensus 80 L~sV~ 84 (218)
T 3frt_A 80 MNSVL 84 (218)
T ss_dssp HHHHH
T ss_pred HHHHH
Confidence 98643
|
| >2gd5_A Charged multivesicular BODY protein 3; CHMP3, ESCRT-III, protein transport; 2.80A {Homo sapiens} PDB: 3frv_A | Back alignment and structure |
|---|
| >4dci_A Uncharacterized protein; PSI-biology, midwest center for structural genomics, MCSG, S genomics, unknown function; 2.82A {Synechococcus SP} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
No hit with probability above 80.00