Psyllid ID: psy13406


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040---
MDVMSMMGKYVDANEEESKDIEKLVIEESASEDSDDEEDEDFENDENSSGKKMVKKFKCNICPKRYARKNRLTNHLRTHEAGSGDEKSEGGEGSFTCSQCPKTFVDKWHLNRHLKSHSENKVFRCEQCRFDFYVKREYNRHMKIHDGVKVFLCSVCSKTFTDKVKFNRHMRAHEGIKPFQCSVCSESFTQRSNLNIHLRIHDGIRPFQCNVCYICFTNKSDLNRHSRIHNGIKPFLCSMCAKCFSRKDDLNRHMKIHEGSKRYLCTMCPKCFTRKDDLNRHMRNHDGLKPFHCSVCFESFTQKALLNIHLRIHTNSKPHACSICTESFSQKSNLYIHLKLQHGVNPFKCDEKSFNCSKCLNIVRIPVEIKVEVPFVCKACASEETKKDKPGAASLGNKRGKAAASQKKETGKGKAKTVYTCEMCEKTFKYKLPLVKHCKKQHQVDLEMSESEDENKASVNTAKVKKESVEGVSMEGKSLSEFSGPVGNFKCALCEKTFVRKQTLDRHVTVHGITGAEHDEIMGESNPATAQVNASETSGDLNTSLAPSDGTIPEIDINKSDTGNMYIVTPKQEPDSIVKEEMLSDYDDNDNSMMTATQDDDDEPFQSEVENDDDDVPLSKRTSYYASSADEERPAPKKRGRKKGVPTRRKSTGSRKSAKSDVDTTDYESAMDTDYVDDNEASESRNEDSGVEGKENEDGRRKRGKRKKGDTPQEFPCSECGKVFTRKTTLKRHVRIHTGIKEFQCWICSKCFMEKSHLNRHLRKHSGVVDNMEAEAPYACSICDRKFTIKGQLSRHLRAHENEKPEKPQTCEVCQKTFDKMAKFKRHLKVHDGVRDHQCQVCGNRFKQKSNLNIHMKIHEGIKAHQCNVCMMKFTNKSDLNRHMRKHDGVKPFLCSICAKNFSRKDDLNRHMRKHDGIKPFLCSMCAEAFSRKDHLKKHMRKCYGPPTGEYRPRRRAKKLPATDVPPTVVGSQLNTMISQDLTVREPPQYRSVQNSIVSEHAHQVLQASVGQAAASGLFWCAAAQYYTTPPTIEFAPKPEYYA
ccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccHHHHHcccccccccccccccccccccccHHHHHHccccccccccccHHHHccccccHHHHccccccccccccccccHHccccccHHHHHcccccccccccccccHHccccccHHHHHcccccccccccccccHHcccccHHHHHHHccccccccccccccHHcccccHHHHHHcccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccHHHHHHHccccccccccccccHHHHccccccHHHHHHHccccccccccccccccccccccHHHHccccccccccccccccccccccccHHHHHccccccccccccccccccccccHHHHHcccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccc
cccccccccEcccccHHHHcHccccccccEcccccccEcccccHHHHHHHcccccccEcccccccEccccHHHHHHHHcccccccccccccccccEcccccccEccccHHHHHHHHcccccccEcccccccEccccHHHHHHHHccccccEEccccccEcccccHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHcHHHHccccEEccccccEEccHHHHHHHHHccHccccEEccccccEEccHHHHHHHcHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEcccccccEccccHHHHHHHHcccccccEcccccccccccccccccccccccEccccHHHHHHHHcccccccccccccccEccccHHHHHHHHHcccccccEcccccccEccccHHHHHHHHcccccccccccEccccccccEcccccccEccccHHHHHHHHcccccccEcccccccEccccHHHHHEcEEEccccccccccccccccccccHHHHHHEEcccccccccccccccccEEcccccEEEEccccccccccccccccccEcccccEEEcccccccccccccccccccccHEEEEEcccccccEcccccccEccccHHHHHHHHcccccccccccccccEccccHHHHHHHHccccccEEccccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHHccccccccccccEcccccccEccccHHHHHHHHcccccccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEcccccHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHcccccccEcccccccEccccHHHcccEEccccccHEHEHEcccccccccccccccEcccccHHHHHHHcccccccccccccccccccccEEEccccccccc
mdvmsmmgkyvdaneeesKDIEKLVIEesasedsddeededfendenssgkkMVKKfkcnicpkryarknrltnhlrtheagsgdekseggegsftcsqcpktfvdkwhlnrhlkshsenkvfrceqcrfdfyvkreynrhmkihDGVKVFLCSVcsktftdkvkfnrhmrahegikpfqcsvcsesftqrsNLNIHLRihdgirpfqcnvcyicftnksdlnrhsrihngikpflcsmcakcfsrkddlnrhmkihegskrylctmcpkcftrkddlnrhmrnhdglkpfhcsvcfesFTQKALLNIHLRihtnskphacsictesfsqksNLYIHLKLqhgvnpfkcdeksfncskclnivripveikVEVPFVCKAcaseetkkdkpgaaslgnkrgkaaasqkketgkgkaktVYTCEMCEKtfkyklplvkhckkQHQVDlemsesedenKASVNTAKVKKesvegvsmegkslsefsgpvgnfkcalcEKTFVRKQTLDrhvtvhgitgaehdeimgesnpataqvnasetsgdlntslapsdgtipeidinksdtgnmyivtpkqepdsivkeemlsdyddndnsmmtatqddddepfqsevenddddvplskrtsyyassadeerpapkkrgrkkgvptrrkstgsrksaksdvdttdyesamdtdyvddneasesrnedsgvegkenedgrrkrgkrkkgdtpqefpcsecgkvftrkttLKRHVRIHTGIKEFQCWicskcfmekshLNRHLrkhsgvvdnmeaeapyacsicdrkftikGQLSRHLRahenekpekpqtceVCQKTFDKMAKFKRHLkvhdgvrdhqcqvcgnrfkqksnlNIHMKIHEGIKahqcnvcmmkftnksdlnrhmrkhdgvkpflcsicaknfsrkddlnrhmrkhdgikpflCSMCAEAFSRKDHLKKHmrkcygpptgeyrprrrakklpatdvpptvvgsQLNTmisqdltvreppqyrsvQNSIVSEHAHQVLQASVGQAAASGLFWCAAaqyyttpptiefapkpeyya
MDVMSMMGKyvdaneeeskdiEKLVIEesasedsddeededfendenssgkkmvkkfkcnicpkryarknrltnhlrtheagsgdekseggeGSFTCSQCPKTFVDKWHLNRHlkshsenkvfrceqCRFDFYVKREYNRHMKIHDGVKVFLCSVCSKTFTDKVKFNRHMRAHEGIKPFQCSVCSESFTQRSNLNIHLRIHDGIRPFQCNVCYICFTNKSDLNRHSRIHNGIKPFLCSMCAKCFSRKDDLNRHMKIhegskrylctmcPKCFTRKDDLNRHMRNHDGLKPFHCSVCFESFTQKALLNIHLRIHTNSKPHACSICTESFSQKSNLYIHLKLQHGVNPFKCDEKSFNCSKCLNIVRIPVEIKVEVPFVCKACaseetkkdkpgaaslgnkrgkaaasqkketgkgkaktvyTCEMCEKTFKYKLPLVKHCKKQHQVDlemsesedenkasvntakvkkesvegvsmegkslsefsgpvgNFKCALCEKTFvrkqtldrhVTVHGITGAEHDEIMGESNPATAQVNASETSGDLntslapsdgtipeidinksdtgnmyivtpkqepdsivKEEMLSDYDDNDNSMMTATQDDDDEPFQSevenddddvplskrtsyyassadeerpapkkrgrkkgvptrrkstgsrksaksdvdttdyesamdtdyvddneasesrnedsgvegkenedgrrkrgkrkkgdtpqefpcsecgkvftrkttlkRHVRIHTGIKEFQCWICSKCFMEKSHLNRHLRKHSGVVDNMEAEAPYACSICDRKFTIKGQLSRHLRahenekpekpqtceVCQKTFDKMAKFKRHLKvhdgvrdhqcqvcgNRFKQKSNLNIHMKIHEGIKAHQCNVCMMKFTNKSDLNRHMRKHDGVKPFLCSICAKnfsrkddlnrhmRKHDGIKPFLCSMCAEAFSRKDHLKKHMRKcygpptgeyrprrrakklpatdvpptvvgsqLNTMISQDLTVREPPQYRSVQNSIVSEHAHQVLQASVGQAAASGLFWCAAAQYYTtpptiefapkpeyya
MDVMSMMGKYVDANEEESKDIEKLVIeesasedsddeededfendenssGKKMVKKFKCNICPKRYARKNRLTNHLRTHEAgsgdekseggegsFTCSQCPKTFVDKWHLNRHLKSHSENKVFRCEQCRFDFYVKREYNRHMKIHDGVKVFLCSVCSKTFTDKVKFNRHMRAHEGIKPFQCSVCSESFTQRSNLNIHLRIHDGIRPFQCNVCYICFTNKSDLNRHSRIHNGIKPFLCSMCAKCFSRKDDLNRHMKIHEGSKRYLCTMCPKCFTRKDDLNRHMRNHDGLKPFHCSVCFESFTQKALLNIHLRIHTNSKPHACSICTESFSQKSNLYIHLKLQHGVNPFKCDEKSFNCSKCLNIVRIPVEIKVEVPFVCKACASEETKKDKPGAASLGNKRGKAAASQKKETGKGKAKTVYTCEMCEKTFKYKLPLVKHCKKQHQVDLEMSESEDENKASVNTAKVKKESVEGVSMEGKSLSEFSGPVGNFKCALCEKTFVRKQTLDRHVTVHGITGAEHDEIMGESNPATAQVNASETSGDLNTSLAPSDGTIPEIDINKSDTGNMYIVTPKQEPDSIVKEEMLSDYDDNDNSMMTATQDDDDEPFQSEVENDDDDVPLSKRTSYYASSADEErpapkkrgrkkgvptrrkSTGSRKSAKSDVDTTDYESAMDTDYVDDNEASESRNEDSGVEGKENEDgrrkrgkrkkgDTPQEFPCSECGKVFTRKTTLKRHVRIHTGIKEFQCWICSKCFMEKSHLNRHLRKHSGVVDNMEAEAPYACSICDRKFTIKGQLSRHLRAHENEKPEKPQTCEVCQKTFDKMAKFKRHLKVHDGVRDHQCQVCGNRFKQKSNLNIHMKIHEGIKAHQCNVCMMKFTNKSDLNRHMRKHDGVKPFLCSICAKNFSRKDDLNRHMRKHDGIKPFLCSMCAEAFSRKDHLKKHMRKCYGPPTGEYRPRRRAKKLPATDVPPTVVGSQLNTMISQDLTVREPPQYRSVQNSIVSEHAHQVLQASVGQAAASGLFWCAAAQYYTTPPTIEFAPKPEYYA
*******************************************************KFKCNICPKRYA***************************FTCSQCPKTFVDKWHLNRHLKSHSENKVFRCEQCRFDFYVKREYNRHMKIHDGVKVFLCSVCSKTFTDKVKFNRHMRAHEGIKPFQCSVCSESFTQRSNLNIHLRIHDGIRPFQCNVCYICFTNKSDLNRHSRIHNGIKPFLCSMCAKCFSRKDDLNRHMKIHEGSKRYLCTMCPKCFTRKDDLNRHMRNHDGLKPFHCSVCFESFTQKALLNIHLRIHTNSKPHACSICTESFSQKSNLYIHLKLQHGVNPFKCDEKSFNCSKCLNIVRIPVEIKVEVPFVCKACA**********************************KTVYTCEMCEKTFKYKLPLVKHCK*********************************************PVGNFKCALCEKTFVRKQTLDRHVTVHGITG*********************************************************************************************************************************************************************************************************CSECGKVFTRKTTLKRHVRIHTGIKEFQCWICSKCFMEKSHLNRHLRKHSGVVDNMEAEAPYACSICDRKFTIKGQL*****************CEVCQKTFDKMAKFKRHLKVHDGVRDHQCQVCGNRFKQKSNLNIHMKIHEGIKAHQCNVCMMKFTNKSDLNRHMRKHDGVKPFLCSICAKNFSRKDDLNRHMRKHDGIKPFLCSMCAEAFSRKDHL***********************************************************************************************************
*DVMS************************ASEDSDDEED****************KFKCNICPKRYARKNRLTNHLRTHEAGSGDEKSEGGEGSFTCSQCPKTFVDKWHLNRHLKSHSENKVFRCEQCRFDFYVKREYNRHMKIHDGVKVFLCSVCSKTFTDKVKFNRHMRAHEGIKPFQCSVCSESFTQRSNLNIHLRIHDGIRPFQCNVCYICFTNKSDLNRHSRIHNGIKPFLCSMCAKCFSRKDDLNRHMKIHEGSKRYLCTMCPKCFTRKDDLNRHMRNHDGLKPFHCSVCFESFTQKALLNIHLRIHTNSKPHACSICTESFSQKSNLYIHLKLQHGVNPFKCDEKSFNCSKCLNIVRIPVEIKVEVPFVCKACASEETKKDKPGAASLGNKRGKAAASQKKETGKGKAKTVYTCEMCEKTFKYKLPLVKHCKKQHQVDLEMSESEDENKASVNTAKVKKESVEGVSMEGKSLSEFSGPVGNFKCALCEKTFVRKQTLDRHVTVHGITGAEHDEIMGESNPATAQVNASETSGDLNTSLAPSDGTIPEIDINKSDTGNMYIVTPKQEPDSIVKEEMLSDYDDNDNSMMTATQDDDDEPFQSEVENDDD************SSADEERPAPKKRGR*****TRRKSTGSRKSAKSDVDTTDYESAMDTDYVDDNEASESRNEDSGVEGKENEDGRRKRGKRKKGDTPQEFPCSECGKVFTRKTTLKRHVRIHTGIKEFQCWICSKCFMEKSHLNRHLRKHSGVVDNMEAEAPYACSICDRKFTIKGQLSRHLRAHENEKPEKPQTCEVCQKTFDKMAKFKRHLKVHDGVRDHQCQVCGNRFKQKSNLNIHMKIHEGIKAHQCNVCMMKFTNKSDLNRHMRKHDGVKPFLCSICAKNFSRKDDLNRHMRKHDGIKPFLCSMCAEAFSRKDHLKKHMRKCYGPPTGEYRPRRRAKKLPATDVPPTVVGSQLNTMISQDLTVREPPQYRSVQNSIVSEHAHQVLQASVGQAAASGLFWCAAAQYYTTPPTIEFA*******
********KYVDANEEESKDIEKLVIE************************KMVKKFKCNICPKRYARKNRLTNHLRTH****************TCSQCPKTFVDKWHLNRHLKSHSENKVFRCEQCRFDFYVKREYNRHMKIHDGVKVFLCSVCSKTFTDKVKFNRHMRAHEGIKPFQCSVCSESFTQRSNLNIHLRIHDGIRPFQCNVCYICFTNKSDLNRHSRIHNGIKPFLCSMCAKCFSRKDDLNRHMKIHEGSKRYLCTMCPKCFTRKDDLNRHMRNHDGLKPFHCSVCFESFTQKALLNIHLRIHTNSKPHACSICTESFSQKSNLYIHLKLQHGVNPFKCDEKSFNCSKCLNIVRIPVEIKVEVPFVCKACASE*********************************TVYTCEMCEKTFKYKLPLVKH************************AKVK************SLSEFSGPVGNFKCALCEKTFVRKQTLDRHVTVHGITGAEHDEIMGESN****************TSLAPSDGTIPEIDINKSDTGNMYIVTPKQEPDSIVKEEMLSDYDDNDNSMMTATQDDDDEPFQSEVENDDDDVPLSKRTSYY*****************************************YESAMDTDYVD*************************************FPCSECGKVFTRKTTLKRHVRIHTGIKEFQCWICSKCFMEKSHLNRHLRKHSGVVDNMEAEAPYACSICDRKFTIKGQLSRHLRAHENEKPEKPQTCEVCQKTFDKMAKFKRHLKVHDGVRDHQCQVCGNRFKQKSNLNIHMKIHEGIKAHQCNVCMMKFTNKSDLNRHMRKHDGVKPFLCSICAKNFSRKDDLNRHMRKHDGIKPFLCSMCAEAFSRKDHLKKHMRKCYGPPTGEYRPRRRAKKLPATDVPPTVVGSQLNTMISQDLTVREPPQYRSVQNSIVSEHAHQVLQASVGQAAASGLFWCAAAQYYTTPPTIEFAPKPEYYA
MDVMSMMGKYVDANEEESKDIEKLVIEESASEDSDDEEDEDFENDENSSGKKMVKKFKCNICPKRYARKNRLTNHLRTHEAGSGDEKSEGGEGSFTCSQCPKTFVDKWHLNRHLKSHSENKVFRCEQCRFDFYVKREYNRHMKIHDGVKVFLCSVCSKTFTDKVKFNRHMRAHEGIKPFQCSVCSESFTQRSNLNIHLRIHDGIRPFQCNVCYICFTNKSDLNRHSRIHNGIKPFLCSMCAKCFSRKDDLNRHMKIHEGSKRYLCTMCPKCFTRKDDLNRHMRNHDGLKPFHCSVCFESFTQKALLNIHLRIHTNSKPHACSICTESFSQKSNLYIHLKLQHGVNPFKCDEKSFNCSKCLNIVRIPVEIKVEVPFVCKACASEETKKDKPGAASLGNKRGKAAASQKKETGKGKAKTVYTCEMCEKTFKYKLPLVKHCKKQHQVDLEMSESEDENKASVNTAKVKKESVEGVSMEGKSLSEFSGPVGNFKCALCEKTFVRKQTLDRHVTVHGITGAEHDEIMGESNPATAQVNASETSGDLNTSLAPSDGTIPEIDINKSDTGNMYIVTPKQEPDSIVKEEMLSDYDDNDNSMMTATQDDDDEPFQSEVENDDDDVPLSKRTSYYASSADEERPAPKKRGRKKGVPTRRKSTGSRKSAKSDVDTTDYESAMDTDYVDDNEASESRNEDSGVEGKENEDGRRKRGKRKKGDTPQEFPCSECGKVFTRKTTLKRHVRIHTGIKEFQCWICSKCFMEKSHLNRHLRKHSGVVDNMEAEAPYACSICDRKFTIKGQLSRHLRAHENEKPEKPQTCEVCQKTFDKMAKFKRHLKVHDGVRDHQCQVCGNRFKQKSNLNIHMKIHEGIKAHQCNVCMMKFTNKSDLNRHMRKHDGVKPFLCSICAKNFSRKDDLNRHMRKHDGIKPFLCSMCAEAFSRKDHLKKHMRKCYGPPTGEYRPRRRAKKLPATDVPPTVVGSQLNTMISQDLTVREPPQYRSVQNSIVSEHAHQVLQASVGQAAASGLFWCAAAQYYTTPPTIEFAPKP****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDVMSMMGKYVDANEEESKDIEKLVIEESASEDSDDEEDEDFENDENSSGKKMVKKFKCNICPKRYARKNRLTNHLRTHEAGSGDEKSEGGEGSFTCSQCPKTFVDKWHLNRHLKSHSENKVFRCEQCRFDFYVKREYNRHMKIHDGVKVFLCSVCSKTFTDKVKFNRHMRAHEGIKPFQCSVCSESFTQRSNLNIHLRIHDGIRPFQCNVCYICFTNKSDLNRHSRIHNGIKPFLCSMCAKCFSRKDDLNRHMKIHEGSKRYLCTMCPKCFTRKDDLNRHMRNHDGLKPFHCSVCFESFTQKALLNIHLRIHTNSKPHACSICTESFSQKSNLYIHLKLQHGVNPFKCDEKSFNCSKCLNIVRIPVEIKVEVPFVCKACASEETKKDKPGAASLGNKRGKAAASQKKETGKGKAKTVYTCEMCEKTFKYKLPLVKHCKKQHQVDLEMSESEDENKASVNTAKVKKESVEGVSMEGKSLSEFSGPVGNFKCALCEKTFVRKQTLDRHVTVHGITGAEHDEIMGESNPATAQVNASETSGDLNTSLAPSDGTIPEIDINKSDTGNMYIVTPKQEPDSIVKEEMLSDYDDNDNSMMTATQDDDDEPFQSEVENDDDDVPLSKRTSYYASSADEERPAPKKRGRKKGVPTRRKSTGSRKSAKSDVDTTDYESAMDTDYVDDNEASESRNEDSGVEGKENEDGRRKRGKRKKGDTPQEFPCSECGKVFTRKTTLKRHVRIHTGIKEFQCWICSKCFMEKSHLNRHLRKHSGVVDNMEAEAPYACSICDRKFTIKGQLSRHLRAHENEKPEKPQTCEVCQKTFDKMAKFKRHLKVHDGVRDHQCQVCGNRFKQKSNLNIHMKIHEGIKAHQCNVCMMKFTNKSDLNRHMRKHDGVKPFLCSICAKNFSRKDDLNRHMRKHDGIKPFLCSMCAEAFSRKDHLKKHMRKCYGPPTGEYRPRRRAKKLPATDVPPTVVGSQLNTMISQDLTVREPPQYRSVQNSIVSEHAHQVLQASVGQAAASGLFWCAAAQYYTTPPTIEFAPKPEYYA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1043 2.2.26 [Sep-21-2011]
P080451350 Zinc finger protein Xfin N/A N/A 0.660 0.510 0.260 1e-70
Q6ZNA1936 Zinc finger protein 836 O no N/A 0.660 0.736 0.290 9e-70
Q14591655 Zinc finger protein 271 O yes N/A 0.303 0.483 0.394 2e-61
Q5R5U3672 Zinc finger protein 271 O no N/A 0.303 0.471 0.394 3e-61
P10076861 Zinc finger protein 26 OS no N/A 0.311 0.377 0.361 4e-61
P51814821 Zinc finger protein 41 OS yes N/A 0.395 0.503 0.325 6e-61
A2VDP4647 Zinc finger protein 567 O no N/A 0.352 0.568 0.345 2e-60
Q8N184647 Zinc finger protein 567 O no N/A 0.352 0.568 0.345 2e-60
P15620580 Zinc finger protein 271 O no N/A 0.467 0.841 0.292 3e-60
Q52M93769 Zinc finger protein 585B no N/A 0.407 0.552 0.327 4e-60
>sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 Back     alignment and function desciption
 Score =  268 bits (686), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 220/844 (26%), Positives = 349/844 (41%), Gaps = 155/844 (18%)

Query: 55   KKFKCNICPKRYARKNRLTNHLRTHEAGSGDEKSEGGEGSFTCSQCPKTFVDKWHLNRHL 114
            K FKC +C K +++ + L  H R H           GE  F C  C K+F ++  L +H 
Sbjct: 557  KPFKCLLCKKSFSQNSDLHKHWRIHT----------GEKPFPCYTCDKSFTERSALIKHH 606

Query: 115  KSHSENKVFRCEQCRFDFYVKREYNRHMKIHDGVKVFLCSVCSKTFTDKVKFNRHMRAHE 174
            ++H+  +  +C  C+  F  K    +H + H G K + C+ C K+F       +H R H 
Sbjct: 607  RTHTGERPHKCSVCQKGFIQKSALTKHSRTHTGEKPYPCTQCGKSFIQNSDLVKHQRIHT 666

Query: 175  GIKPFQCSVCSESFTQRSNLNIHLRIHDGIRPFQCNVCYICFTNKSDLNRHSRIHNG--- 231
            G KP+ C+ C++ FT+ S+L  H R H G +P++C  C   F   SDL +H  +HNG   
Sbjct: 667  GEKPYHCTECNKRFTEGSSLVKHRRTHSGEKPYRCPQCEKTFIQSSDLVKHLVVHNGENP 726

Query: 232  --------------------IKPFLCSMCAKCFSRKDDLNRHMKIHEGSKRYLCTMCPKC 271
                                  P+ C+ C K F ++  L +H++ H+  KRY C  C K 
Sbjct: 727  PAATAFHEILIRRENLTRSEPDPYPCTECGKVFHQRPALLKHLRTHKTEKRYPCNECDKS 786

Query: 272  FTRKDDLNRHMRNHDGLKPFHCSVCFESFTQKALLNIHLRIHTNSKPHACSICTESFSQK 331
            F +  DL +H+R H G +P+HC  C + F Q + L  H R HT  +P+ CS C + F Q+
Sbjct: 787  FFQTSDLVKHLRTHTGERPYHCPECNKGFIQNSDLVKHQRTHTGERPYTCSQCDKGFIQR 846

Query: 332  SNLYIHLKLQHGVNPFKCDEKSFNCSKCL----NIVRIPVEIKVEVPFVCKACASEETKK 387
            S L  H++   G  P+KC++    C KC     ++V+       E P+ C  C       
Sbjct: 847  SALTKHMRTHTGEKPYKCEQ----CQKCFIQNSDLVKHQRIHTGEKPYHCPDC------- 895

Query: 388  DKPGAASLGNKRGKAAASQKKETGKGKAKTVYTCEMCEKTFKYKLPLVKHCKKQHQVDLE 447
                     +KR    +S  K          Y C +C K+F     L+KH K   + +  
Sbjct: 896  ---------DKRFTEGSSLIKHQRIHSRIKPYPCGVCGKSFSQSSNLLKHLKCHSEQNPP 946

Query: 448  MSESEDENKASVNTAKVKKESVEGVSMEGKSLSEFSGPVG---NFKCALCEKTFVRKQTL 504
            ++ S +     V   +   + V+ + + G + S  S       +FKC  C K F  +  L
Sbjct: 947  VALSSE--LGFVAETQTHPDPVDHI-VYGDTASYISPEAAGERSFKCNDCGKCFAHRSVL 1003

Query: 505  DRHVTVHGITGAEHDEIMGESNPATAQVNASETSGDLNTSLAPSDGTIPEIDINKSDTGN 564
             +HV +H           GE     +Q   S                     I KSD   
Sbjct: 1004 IKHVRIH----------TGERPYKCSQCTRS--------------------FIQKSDLVK 1033

Query: 565  MYIVTPKQEP-------DSIVKEEMLSDYD---DNDNSMMTATQDDDDEPFQSEVENDDD 614
             Y     + P        S V++  LS +     N++ ++ +  +     +  E ++D +
Sbjct: 1034 HYRTHTGERPYKCGLCERSFVEKSALSRHQRVHKNESPVLNSAMEQQQVTYWGESKDDPN 1093

Query: 615  DV--------------------PLSKRTSYYASSADEERPAPKKRGRKKGVPTRRKSTGS 654
             +                    PLS   SY+    +            KG P    S   
Sbjct: 1094 SLVPQLHVIKEEESPHIVNAYSPLSILQSYFPPILEP-----------KGTPRYSCSECG 1142

Query: 655  RKSAKSDVDTTDYESAMDTDYVDDNEASESRNEDSGVEGKENEDGRRKRGKRKKGDTPQE 714
            +      V    +            E  +S ++ S +          K  +   G+ P  
Sbjct: 1143 KCFTHRSVFLKHWRMHTGEQPYTCKECGKSFSQSSALV---------KHVRIHTGEKP-- 1191

Query: 715  FPCSECGKVFTRKTTLKRHVRIHTGIKEFQCWICSKCFMEKSHLNRHLRKHSGVVDNMEA 774
            +PCS CGK F +K+ L +H RIHTG K + C +C K F+++S + +H R H+G       
Sbjct: 1192 YPCSTCGKSFIQKSDLAKHQRIHTGEKPYTCTVCGKKFIDRSSVVKHSRTHTG------- 1244

Query: 775  EAPYACSICDRKFTIKGQLSRHLRAHENEKPEKPQTCEVCQKTFDKMAKFKRHLKVHDGV 834
            E PY C+ C + F  K  L +H+R H     EKP  C  C ++F   +   RH ++ +  
Sbjct: 1245 ERPYKCNECTKGFVQKSDLVKHMRTHTG---EKPYGCNCCDRSFSTHSASVRHQRMCNTG 1301

Query: 835  RDHQ 838
            R +Q
Sbjct: 1302 RPYQ 1305




Binds to poly-G sequences in RNA. May function in post-translational regulation processes.
Xenopus laevis (taxid: 8355)
>sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 Back     alignment and function description
>sp|Q14591|ZN271_HUMAN Zinc finger protein 271 OS=Homo sapiens GN=ZNF271 PE=2 SV=4 Back     alignment and function description
>sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 Back     alignment and function description
>sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 Back     alignment and function description
>sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 Back     alignment and function description
>sp|A2VDP4|ZN567_BOVIN Zinc finger protein 567 OS=Bos taurus GN=ZNF567 PE=2 SV=1 Back     alignment and function description
>sp|Q8N184|ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens GN=ZNF567 PE=2 SV=3 Back     alignment and function description
>sp|P15620|ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus GN=Znf271 PE=2 SV=1 Back     alignment and function description
>sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1043
326667187 1365 PREDICTED: zinc finger protein 729-like 0.763 0.583 0.303 1e-110
326667110 1395 PREDICTED: zinc finger protein 729-like, 0.767 0.574 0.315 1e-110
326680667 1782 PREDICTED: zinc finger protein 729-like 0.790 0.462 0.302 1e-109
326667289 1202 PREDICTED: zinc finger protein 729-like 0.788 0.683 0.322 1e-108
326666355 1861 PREDICTED: zinc finger protein 208-like 0.804 0.450 0.308 1e-108
326666983853 PREDICTED: zinc finger protein 91-like [ 0.769 0.941 0.322 1e-107
301629397 2250 PREDICTED: hypothetical protein LOC10049 0.814 0.377 0.291 1e-107
326665700 1573 PREDICTED: zinc finger protein 91-like [ 0.713 0.472 0.310 1e-106
326666730 1718 PREDICTED: zinc finger protein 729 [Dani 0.765 0.464 0.310 1e-105
326673957 2528 PREDICTED: hypothetical protein LOC55726 0.815 0.336 0.300 1e-104
>gi|326667187|ref|XP_001920997.3| PREDICTED: zinc finger protein 729-like [Danio rerio] Back     alignment and taxonomy information
 Score =  407 bits (1047), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 281/927 (30%), Positives = 406/927 (43%), Gaps = 131/927 (14%)

Query: 55   KKFKCNICPKRYARKNRLTNHLRTHEAGSGDEKSEGGEGSFTCSQCPKTFVDKWHLNRHL 114
            K F C  C K ++R + L +H+  H           GE  FTC+QC K+F+    LN H+
Sbjct: 260  KPFTCTQCGKSFSRSSSLNHHIMIHT----------GEKPFTCTQCGKSFIQSSQLNLHM 309

Query: 115  KSHSENKVFRCEQCRFDFYVKREYNRHMKIHDGVKVFLCSVCSKTFTDKVKFNRHMRAHE 174
            + H+  K F C QC   F       +HM+ H G K F C+ C K+F      N HMR H 
Sbjct: 310  RIHTGEKPFSCTQCGKSFRRSSSLKQHMRTHTGEKPFTCTQCGKSFRRSSHLNHHMRIHT 369

Query: 175  GIKPFQCSVCSESFTQRSNLNIHLRIHDGIRPFQCNVCYICFTNKSDLNRHSRIHNGIKP 234
            G KPF C+ C +SF + S+LN H+RIH G +PF C  C   F+  S LN H R H G KP
Sbjct: 370  GEKPFTCTQCGKSFRRSSHLNHHMRIHTGEKPFSCTQCGKSFSKSSSLNHHMRTHTGEKP 429

Query: 235  FLCSMCAKCFSRKDDLNRHMKIHEGSKRYLCTMCPKCFTRKDDLNRHMRNHDGLKPFHCS 294
            F C+ C K F     L +HM IH G K + CT C K F++   LN HMR H G KPF C+
Sbjct: 430  FTCTQCGKSFRNSLFLKQHMMIHTGEKPFSCTQCGKNFSKSSSLNHHMRTHTGEKPFSCT 489

Query: 295  VCFESFTQKALLNIHLRIHTNSKPHACSICTESFSQKSNLYIHLKLQHGVNPFKCDE--K 352
             C ++F++ + LN H+R HT  KP +C+ C +SF Q S L  H+++  G  P  C    K
Sbjct: 490  QCGKNFSKSSSLNHHMRTHTGEKPFSCTQCGKSFIQSSQLNRHMRIHTGEKPLTCTRCGK 549

Query: 353  SFNCSKCLNIVRIPVEIKV-EVPFVCKACASEETKK------------DKPGAASLGNKR 399
            SF+ S CL+ + + + I   E  F C  C    +K             +KP   +   K 
Sbjct: 550  SFSRSSCLSHLNVHMMIHTGEKLFTCTQCGKSFSKSSHLNKHMMSHTGEKPFTCTQCGKS 609

Query: 400  GKAAASQKKETGKGKAKTVYTCEMCEKTFKYKLPLVKHCKKQHQVDLEMSESEDENKASV 459
               ++S+ K       +  +TC  C K+F           +   +DL M     E     
Sbjct: 610  FSQSSSRSKHMMIHTGEKPFTCTQCGKSFS----------QLSHLDLHMMIHTGETP--- 656

Query: 460  NTAKVKKESVEGVSMEGKSLSEFSGPVGNFKCALCEKTFVRKQTLDRHVTVHGITGAEHD 519
                                         F C  C K+F     L+ H+ +H  TG +  
Sbjct: 657  -----------------------------FTCTQCGKSFNYLSHLNHHMMIH--TGEKPF 685

Query: 520  EIMGESNPATAQVNASETSGDLNTSLAPSDGTIPEIDINKSDTGNMYI-VTPKQEPDSIV 578
            + + +   + +Q ++      ++T   P   T      +KS + N ++ +   ++P +  
Sbjct: 686  KCL-QCGKSFSQSSSLNQHMRIHTGEKPFTCTQCGKSFSKSSSLNKHMRIHTGEKPFTCT 744

Query: 579  KEEMLSDYDDNDNSMMTATQDDDDEPFQSEVENDDDDVPLSKRTSYYASSADEERPAPKK 638
            +         N N  M       ++PF             S   +Y+      E+P    
Sbjct: 745  QCGKCFTCSSNLNQHMRI--HTGEKPF--ICTQCGKSFSQSSSLNYHMKFHAGEKPFT-- 798

Query: 639  RGRKKGVPTRRKSTGSRKSAKSDVDTTDYESAMDTDYVDDNEASESRNEDSGVEGKENED 698
                             +  KS   ++     M     +         +        N+ 
Sbjct: 799  ---------------CTQCGKSFSQSSHLNKHMRIHTGEKPFTCTQCGKCFTCSSNLNQH 843

Query: 699  GRRKRGKRKKGDTPQEFPCSECGKVFTRKTTLKRHVRIHTGIKEFQCWICSKCFMEKSHL 758
             R   G++        F C++CGK F++ T+L  H++IHTG K F C  C K F + S L
Sbjct: 844  MRIHTGEK-------PFICTQCGKSFSQSTSLNYHMKIHTGEKPFTCTQCGKSFSQSSSL 896

Query: 759  NRHLRKHSGVVDNMEAEAPYACSICDRKFTIKGQLSRHLRAHENEKP------------- 805
            N H+R H+G       E P+ C+ C + F+    L+ H+R H  EKP             
Sbjct: 897  NLHMRIHTG-------EKPFTCTQCGKSFSQSSSLNLHVRIHTGEKPFTCPQCGKSFSHS 949

Query: 806  ------------EKPQTCEVCQKTFDKMAKFKRHLKVHDGVRDHQCQVCGNRFKQKSNLN 853
                        EKP TC  C K+F + +    H+K+H G +   C  CG  F Q SNLN
Sbjct: 950  SHLNCHMKIHTGEKPFTCPHCGKSFSQSSHLNCHMKIHTGEKPFTCPQCGKSFSQSSNLN 1009

Query: 854  IHMKIHEGIKAHQCNVCMMKFTNKSDLNRHMRKHDGVKPFLCSICAKNFSRKDDLNRHMR 913
             HM IH G K   C  C   FT  S L++HMR H G KPF C+ C K F++  +LN HMR
Sbjct: 1010 CHMTIHTGEKPFTCTQCGKSFTCSSHLHQHMRIHTGEKPFTCTQCGKAFNKSSNLNLHMR 1069

Query: 914  KHDGIKPFLCSMCAEAFSRKDHLKKHM 940
             H G KP+ C+ C ++FS   HL +HM
Sbjct: 1070 IHTGEKPYTCTQCGKSFSHSSHLNQHM 1096




Source: Danio rerio

Species: Danio rerio

Genus: Danio

Family: Cyprinidae

Order: Cypriniformes

Class: Actinopterygii

Phylum: Chordata

Superkingdom: Eukaryota

>gi|326667110|ref|XP_003198489.1| PREDICTED: zinc finger protein 729-like, partial [Danio rerio] Back     alignment and taxonomy information
>gi|326680667|ref|XP_003201586.1| PREDICTED: zinc finger protein 729-like [Danio rerio] Back     alignment and taxonomy information
>gi|326667289|ref|XP_003198555.1| PREDICTED: zinc finger protein 729-like [Danio rerio] Back     alignment and taxonomy information
>gi|326666355|ref|XP_003198248.1| PREDICTED: zinc finger protein 208-like [Danio rerio] Back     alignment and taxonomy information
>gi|326666983|ref|XP_003198441.1| PREDICTED: zinc finger protein 91-like [Danio rerio] Back     alignment and taxonomy information
>gi|301629397|ref|XP_002943827.1| PREDICTED: hypothetical protein LOC100496354 [Xenopus (Silurana) tropicalis] Back     alignment and taxonomy information
>gi|326665700|ref|XP_003198088.1| PREDICTED: zinc finger protein 91-like [Danio rerio] Back     alignment and taxonomy information
>gi|326666730|ref|XP_003198356.1| PREDICTED: zinc finger protein 729 [Danio rerio] Back     alignment and taxonomy information
>gi|326673957|ref|XP_003200037.1| PREDICTED: hypothetical protein LOC557268 [Danio rerio] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1043
ZFIN|ZDB-GENE-110913-38987 si:ch211-208f21.5 "si:ch211-20 0.412 0.435 0.355 8.1e-76
ZFIN|ZDB-GENE-120703-37911 si:dkey-78o7.1 "si:dkey-78o7.1 0.343 0.392 0.417 1.7e-124
ZFIN|ZDB-GENE-110913-135689 si:ch211-207e19.14 "si:ch211-2 0.358 0.542 0.377 2e-72
ZFIN|ZDB-GENE-080218-24904 zgc:173603 "zgc:173603" [Danio 0.412 0.475 0.357 5.1e-123
ZFIN|ZDB-GENE-110913-173819 si:dkey-78k22.1 "si:dkey-78k22 0.410 0.522 0.351 6.5e-123
ZFIN|ZDB-GENE-110913-159733 si:ch211-197f20.2 "si:ch211-19 0.415 0.590 0.334 1.3e-122
ZFIN|ZDB-GENE-071004-1051014 zgc:173573 "zgc:173573" [Danio 0.354 0.364 0.378 1.6e-122
ZFIN|ZDB-GENE-110913-157981 si:ch211-245n8.1 "si:ch211-245 0.412 0.438 0.345 3.5e-84
ZFIN|ZDB-GENE-110913-143984 si:ch211-209p16.3 "si:ch211-20 0.413 0.438 0.353 3.2e-75
ZFIN|ZDB-GENE-110913-121898 si:ch211-162i8.3 "si:ch211-162 0.359 0.417 0.370 4.6e-120
ZFIN|ZDB-GENE-110913-38 si:ch211-208f21.5 "si:ch211-208f21.5" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 764 (274.0 bits), Expect = 8.1e-76, P = 8.1e-76
 Identities = 168/472 (35%), Positives = 240/472 (50%)

Query:    55 KKFKCNICPKRYARKNRLTNHLRTHEAXXXXXXXXXXXXXFTCSQCPKTFVDKWHLNRHL 114
             K F C  C K + + + L  H+R H               FTC++C K+F    HL +H+
Sbjct:   539 KPFTCTKCGKSFNQSSYLNKHMRIHTGKRS----------FTCTRCGKSFTHSSHLKKHM 588

Query:   115 KSHSENKVFRCEQCRFDFYVKREYNRHMKIHDGVKVFLCSVCSKTFTDKVKFNRHMRAHE 174
             K+H+   +++C +C      K +   HM+IH+ VK+F C+ C K+F++    N+HMR H 
Sbjct:   589 KNHTAETLYQCSECGKSLANKSKLKIHMRIHNRVKLFTCTQCGKSFSNSANLNQHMRIHT 648

Query:   175 GIKPFQCSVCSESFTQRSNLNIHLRIHDGIRPFQCNVCYICFTNKSDLNRHSRIHNGIKP 234
             G KPF C+ C +SF+Q SNLN+H+RIH G +PF C+ C   F+  S LN H RIH G KP
Sbjct:   649 GEKPFTCTQCGKSFSQSSNLNLHMRIHTGEKPFTCSQCGKSFSQSSSLNLHMRIHTGEKP 708

Query:   235 FLCSMCAKCFSRKDDLNRHMKIHEGSKRYLCTMCPKCFTRKDDLNRHMRNHDGLKPFHCS 294
             F C+ C K FS+   LN HM+ H G K + C  C K F++   LN+HMR H G   F C+
Sbjct:   709 FTCTQCGKSFSQSSILNIHMRNHTGEKPFTCLQCGKSFSQSTYLNQHMRIHTGENLFTCT 768

Query:   295 VCFESFTQKALLNIHLRIHTNSKPHACSICTESFSQKSNLYIHLKLQHGVNPFKCDE--K 352
              C +SF+  A LN+H+RIHT  KP  C+ C +SFSQ SNL IH+++  G  PF C +  K
Sbjct:   769 QCGKSFSNSANLNLHMRIHTGEKPFTCTQCGKSFSQSSNLNIHMRIHTGEKPFTCSQCGK 828

Query:   353 SFNCSKCLNI-VRIPVEIKVEVPFVCKACASEETKK------------DKPGAASLGNKR 399
             SF+ S  LN  +RI      E PF C  C    +K             +KP   +     
Sbjct:   829 SFSQSPYLNHHMRIHTG---EKPFTCSQCGKSFSKSSNLNIHMRIHTGEKPFTCTQCGTS 885

Query:   400 GKAAASQKKETGKGKAKTVYTCEMCEKTFKYKLPLVKHCKKQHQVDLEMSESEDENKASV 459
                +++          +  +TC  C K+F     L +H    H  + E    + EN   +
Sbjct:   886 FSQSSNLNIHMRNHTGEKPFTCLQCGKSFSRSTSLNRHMMI-HTGEKEFMCLKCEN-TFI 943

Query:   460 NTAKVKKESVEGVSMEGKSLSEFSGPVGNFKCALCEKTFVRKQTLDRHVTVH 511
               A++K+   + V    K       P   +KC+ C K F R  TL  H  +H
Sbjct:   944 TAAELKRH--QRVHTGEK-------P---YKCSQCSKRFARSGTLKTHERIH 983


GO:0008270 "zinc ion binding" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
ZFIN|ZDB-GENE-120703-37 si:dkey-78o7.1 "si:dkey-78o7.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-135 si:ch211-207e19.14 "si:ch211-207e19.14" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-080218-24 zgc:173603 "zgc:173603" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-173 si:dkey-78k22.1 "si:dkey-78k22.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-159 si:ch211-197f20.2 "si:ch211-197f20.2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-071004-105 zgc:173573 "zgc:173573" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-157 si:ch211-245n8.1 "si:ch211-245n8.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-143 si:ch211-209p16.3 "si:ch211-209p16.3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-121 si:ch211-162i8.3 "si:ch211-162i8.3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1043
COG5048467 COG5048, COG5048, FOG: Zn-finger [General function 2e-05
COG5048467 COG5048, COG5048, FOG: Zn-finger [General function 4e-05
COG5048467 COG5048, COG5048, FOG: Zn-finger [General function 8e-05
COG5048467 COG5048, COG5048, FOG: Zn-finger [General function 3e-04
COG5048467 COG5048, COG5048, FOG: Zn-finger [General function 3e-04
COG5048467 COG5048, COG5048, FOG: Zn-finger [General function 6e-04
COG5048467 COG5048, COG5048, FOG: Zn-finger [General function 0.001
pfam1346526 pfam13465, zf-H2C2_2, Zinc-finger double domain 0.001
COG5048467 COG5048, COG5048, FOG: Zn-finger [General function 0.003
>gnl|CDD|227381 COG5048, COG5048, FOG: Zn-finger [General function prediction only] Back     alignment and domain information
 Score = 48.2 bits (114), Expect = 2e-05
 Identities = 48/201 (23%), Positives = 76/201 (37%), Gaps = 18/201 (8%)

Query: 173 HEGIKPFQCSVCSESFTQRSNLNIHLRIHDGIR-PFQCNVCYICFTNKSDLNRHSRIHN- 230
               +  + S+ + S    S          G   P +   C I F+  S L RH R  N 
Sbjct: 255 SSASESPRSSLPTASSQSSSPNESDSSSEKGFSLPIKSKQCNISFSRSSPLTRHLRSVNH 314

Query: 231 ---GIKPFLC--SMCAKCFSRKDDLNRHMKIHEGSKRYLCTMCPKCFTRKDDLN------ 279
               +KPF C  S+C K FSR D L RH+ +H         +          LN      
Sbjct: 315 SGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAKEKLLNSSSKFSPLLNNEPPQS 374

Query: 280 -RHMRNHDGLKPFHCSV--CFESFTQKALLNIHLRIHTNSKPHAC--SICTESFSQKSNL 334
            +  ++    K        C  +F + + L++H+  H + +P+ C    C++SF++  NL
Sbjct: 375 LQQYKDLKNDKKSETLSNSCIRNFKRDSNLSLHIITHLSFRPYNCKNPPCSKSFNRHYNL 434

Query: 335 YIHLKLQHGVNPFKCDEKSFN 355
             H K+     P  C      
Sbjct: 435 IPHKKIHTNHAPLLCSILKSF 455


Length = 467

>gnl|CDD|227381 COG5048, COG5048, FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>gnl|CDD|227381 COG5048, COG5048, FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>gnl|CDD|227381 COG5048, COG5048, FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>gnl|CDD|227381 COG5048, COG5048, FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>gnl|CDD|227381 COG5048, COG5048, FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>gnl|CDD|227381 COG5048, COG5048, FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>gnl|CDD|222150 pfam13465, zf-H2C2_2, Zinc-finger double domain Back     alignment and domain information
>gnl|CDD|227381 COG5048, COG5048, FOG: Zn-finger [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1043
KOG1074|consensus958 100.0
KOG1074|consensus958 99.97
KOG2462|consensus279 99.95
KOG2462|consensus279 99.95
KOG3608|consensus467 99.94
KOG3608|consensus467 99.94
KOG3623|consensus1007 99.93
KOG3623|consensus 1007 99.92
KOG3576|consensus267 99.72
KOG3576|consensus267 99.7
PLN03086567 PRLI-interacting factor K; Provisional 99.31
PLN03086567 PRLI-interacting factor K; Provisional 99.2
PHA00733128 hypothetical protein 99.04
PHA00733128 hypothetical protein 99.01
KOG1146|consensus1406 99.0
PHA0276855 hypothetical protein; Provisional 98.8
KOG3993|consensus500 98.77
KOG3993|consensus500 98.77
PHA0276855 hypothetical protein; Provisional 98.71
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.57
KOG1146|consensus1406 98.55
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.35
PHA0061644 hypothetical protein 98.33
PHA0061644 hypothetical protein 98.22
PHA0073279 hypothetical protein 98.02
PHA0073279 hypothetical protein 97.93
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.79
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.68
COG5189423 SFP1 Putative transcriptional repressor regulating 97.58
KOG2231|consensus 669 97.51
COG5189423 SFP1 Putative transcriptional repressor regulating 97.43
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.39
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.39
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.17
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.12
KOG2231|consensus 669 97.07
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 96.96
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 96.93
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 96.83
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 96.77
COG5236493 Uncharacterized conserved protein, contains RING Z 96.73
COG5236493 Uncharacterized conserved protein, contains RING Z 96.39
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.32
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.17
smart0035526 ZnF_C2H2 zinc finger. 95.8
smart0035526 ZnF_C2H2 zinc finger. 95.79
KOG2785|consensus390 95.79
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 95.6
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 95.56
KOG2785|consensus390 95.25
PRK04860160 hypothetical protein; Provisional 95.24
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 95.17
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 95.17
KOG2482|consensus423 95.16
COG5048467 FOG: Zn-finger [General function prediction only] 95.13
COG5048467 FOG: Zn-finger [General function prediction only] 95.08
PRK04860160 hypothetical protein; Provisional 94.7
KOG2482|consensus423 94.39
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 93.78
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 93.37
KOG4173|consensus253 92.13
KOG4173|consensus253 91.42
KOG2893|consensus341 90.9
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 90.63
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 90.41
KOG2893|consensus341 90.26
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 89.78
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 87.01
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 86.39
COG404965 Uncharacterized protein containing archaeal-type C 85.57
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 83.03
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 82.19
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 81.87
COG404965 Uncharacterized protein containing archaeal-type C 80.98
KOG4167|consensus907 80.36
>KOG1074|consensus Back     alignment and domain information
Probab=100.00  E-value=2.4e-34  Score=310.81  Aligned_cols=237  Identities=27%  Similarity=0.538  Sum_probs=184.4

Q ss_pred             CccccccccccccCHHHHHHHHHHhcCCCceeccccccccCCHHHHHHHHHhccCCCCCCCCCCCcccC---cCCcccCC
Q psy13406        713 QEFPCSECGKVFTRKTTLKRHVRIHTGIKEFQCWICSKCFMEKSHLNRHLRKHSGVVDNMEAEAPYACS---ICDRKFTI  789 (1043)
Q Consensus       713 ~~~~C~~C~k~F~~~~~L~~H~~~H~~~~~~~C~~C~~~f~~~~~L~~H~~~h~~~~~~~~~~~~~~C~---~C~~~f~~  789 (1043)
                      .+-.|-+|-++..-.+.|+.|.|+|+|++||+|.+|+++|+++.+|+.||-+|.....   ....|.|+   +|-+.|.+
T Consensus       604 dPNqCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~p~---~R~q~ScP~~~ic~~kftn  680 (958)
T KOG1074|consen  604 DPNQCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHMSVHKAKPP---ARVQFSCPSTFICQKKFTN  680 (958)
T ss_pred             CccceeeeeecccchhhhhhhhhcccCcCccccccccchhccccchhhcccccccCcc---ccccccCCchhhhcccccc
Confidence            4678999999999999999999999999999999999999999999999999964221   13568999   99999999


Q ss_pred             HHHHHHHHHHhcCCC-CCC---------CcccccccccccChHHHhhhhccc----------------CCCC----CCCC
Q psy13406        790 KGQLSRHLRAHENEK-PEK---------PQTCEVCQKTFDKMAKFKRHLKVH----------------DGVR----DHQC  839 (1043)
Q Consensus       790 ~~~l~~H~~~h~~~~-~~~---------~~~C~~C~~~f~~~~~l~~H~~~h----------------~~~~----~~~C  839 (1043)
                      .-.|..|+++|.+.. +..         .-.|..|.+.|.....+..++-.|                +++.    +..+
T Consensus       681 ~V~lpQhIriH~~~~~s~g~~a~e~~~~adq~~~~qk~~~~a~~f~~~~se~~~~~s~~~~~~~~~t~t~~~~~tp~~~e  760 (958)
T KOG1074|consen  681 AVTLPQHIRIHLGGQISNGGTAAEGILAADQCSSCQKTFSDARSFSQQISEQPSPESEPDEQMDERTETEELDVTPPPPE  760 (958)
T ss_pred             cccccceEEeecCCCCCCCcccccccchhcccchhhhcccccccchhhhhccCCcccCCcccccccccccccccCCCccc
Confidence            999999999998532 111         257999999998888887777655                2223    5789


Q ss_pred             cccccccCChhHHHHHHh-----------------------hhcCCCcc-CCCcccccCCCHHHHHH-HHHhhc------
Q psy13406        840 QVCGNRFKQKSNLNIHMK-----------------------IHEGIKAH-QCNVCMMKFTNKSDLNR-HMRKHD------  888 (1043)
Q Consensus       840 ~~C~~~f~~~~~l~~H~~-----------------------~h~~~~~~-~C~~C~~~f~~~~~l~~-H~~~h~------  888 (1043)
                      ..|+..+.....+..+--                       .++++++. .+.+++..-...-...- =+..-.      
T Consensus       761 ~~~~~~~~~e~~i~~~g~te~asa~~~~vg~~s~~~~~~~~~~T~~k~~~~~~~~~~~~~~~v~~~pvl~~~~~~~l~eg  840 (958)
T KOG1074|consen  761 NSCGRELEGEMAISVRGSTEEASANLDEVGTVSAAGEAGEEDDTSEKPTQASSFPGEILAPSVNMDPVLWNQETSMLNEG  840 (958)
T ss_pred             cccccccCcccccccccchhhhhcChhhhcCccccchhhhhcccCCCCcccccCCCcCCccccccCchhhcccccccccc
Confidence            999999987777665532                       23456666 67777655433321110 000000      


Q ss_pred             -----------C------------------------CCCcCccchhHHhCChHHHHHHHHhccCCCcccCccchhhcCCH
Q psy13406        889 -----------G------------------------VKPFLCSICAKNFSRKDDLNRHMRKHDGIKPFLCSMCAEAFSRK  933 (1043)
Q Consensus       889 -----------~------------------------~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~  933 (1043)
                                 +                        .....|.+|++.|....+|..||++|+|+|||.|.+|++.|.++
T Consensus       841 ~~t~~n~~t~~~~~~sv~qs~~~p~l~p~l~~~~pvnn~h~C~vCgk~FsSSsALqiH~rTHtg~KPF~C~fC~~aFttr  920 (958)
T KOG1074|consen  841 LATKTNEITPEGPADSVIQSGGVPTLEPSLGRPGPVNNAHVCNVCGKQFSSSAALEIHMRTHTGPKPFFCHFCEEAFTTR  920 (958)
T ss_pred             cccccccccCCCcchhhhhhccccccCCCCCCCCcccchhhhccchhcccchHHHHHhhhcCCCCCCccchhhhhhhhhh
Confidence                       0                        01267999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhhhcCCCCCCCC
Q psy13406        934 DHLKKHMRKCYGPPTGEYR  952 (1043)
Q Consensus       934 ~~l~~H~~~~~~~~~~~~~  952 (1043)
                      .+|+.||.+|++..+...+
T Consensus       921 gnLKvHMgtH~w~q~~srr  939 (958)
T KOG1074|consen  921 GNLKVHMGTHMWVQPPSRR  939 (958)
T ss_pred             hhhhhhhccccccCCCccC
Confidence            9999999999876654443



>KOG1074|consensus Back     alignment and domain information
>KOG2462|consensus Back     alignment and domain information
>KOG2462|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>KOG4167|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1043
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 2e-36
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 2e-34
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 4e-33
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 1e-13
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 4e-18
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 9e-16
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 3e-16
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 3e-15
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 3e-14
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 3e-14
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 5e-13
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 3e-15
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 4e-14
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 7e-13
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 6e-15
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 7e-15
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 7e-15
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 1e-14
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 3e-14
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 2e-14
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 2e-14
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 2e-14
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 3e-14
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 3e-14
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 4e-14
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 3e-13
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 3e-12
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 7e-07
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 6e-14
2wbu_A90 Crystal Structure Of The Zinc Finger Domain Of Klf4 3e-13
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 3e-13
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 3e-09
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 3e-13
2csh_A110 Solution Structure Of Tandem Repeat Of The Zf-C2h2 4e-13
2csh_A110 Solution Structure Of Tandem Repeat Of The Zf-C2h2 1e-12
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 3e-12
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 3e-11
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 7e-11
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 9e-11
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 2e-10
2gli_A155 Five-Finger GliDNA COMPLEX Length = 155 3e-10
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 6e-10
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 2e-09
1llm_C88 Crystal Structure Of A Zif23-Gcn4 Chimera Bound To 2e-09
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 3e-09
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 9e-08
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 6e-07
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 3e-06
1f2i_G73 Cocrystal Structure Of Selected Zinc Finger Dimer B 6e-09
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 2e-08
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 4e-06
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 6e-06
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 3e-08
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 2e-06
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 3e-08
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 6e-07
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 7e-06
4gzn_C60 Mouse Zfp57 Zinc Fingers In Complex With Methylated 5e-08
4gzn_C60 Mouse Zfp57 Zinc Fingers In Complex With Methylated 2e-05
4gzn_C60 Mouse Zfp57 Zinc Fingers In Complex With Methylated 3e-05
4gzn_C60 Mouse Zfp57 Zinc Fingers In Complex With Methylated 5e-04
2adr_A60 Adr1 Dna-Binding Domain From Saccharomyces Cerevisi 6e-08
1tf6_A190 Co-crystal Structure Of Xenopus Tfiiia Zinc Finger 6e-07
1tf6_A190 Co-crystal Structure Of Xenopus Tfiiia Zinc Finger 1e-05
1x6e_A72 Solution Structures Of The C2h2 Type Zinc Finger Do 1e-06
1x6e_A72 Solution Structures Of The C2h2 Type Zinc Finger Do 6e-06
1x6h_A86 Solution Structures Of The C2h2 Type Zinc Finger Do 1e-05
3uk3_C57 Crystal Structure Of Znf217 Bound To Dna Length = 5 2e-05
3uk3_C57 Crystal Structure Of Znf217 Bound To Dna Length = 5 3e-04
2lt7_A133 Solution Nmr Structure Of Kaiso Zinc Finger Dna Bin 5e-05
2lt7_A133 Solution Nmr Structure Of Kaiso Zinc Finger Dna Bin 3e-04
2epa_A72 Solution Structure Of The First And Second Zf-C2h2 1e-04
1tf3_A92 Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures 2e-04
1tf3_A92 Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures 8e-04
2ct1_A77 Solution Structure Of The Zinc Finger Domain Of Tra 4e-04
2ep2_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 8e-04
2eml_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 8e-04
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure

Iteration: 1

Score = 151 bits (382), Expect = 2e-36, Method: Compositional matrix adjust. Identities = 70/169 (41%), Positives = 92/169 (54%) Query: 121 KVFRCEQCRFDFYVKREYNRHMKIHDGVKVFLCSVCSKTFTDKVKFNRHMRAHEGIKPFQ 180 K + C +C F H + H G K + C C K+F+DK RH R H G KP++ Sbjct: 20 KPYACPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFSDKKDLTRHQRTHTGEKPYK 79 Query: 181 CSVCSESFTQRSNLNIHLRIHDGIRPFQCNVCYICFTNKSDLNRHSRIHNGIKPFLCSMC 240 C C +SF+QR+NL H R H G +P+ C C F+ + L H R H G KP+ C C Sbjct: 80 CPECGKSFSQRANLRAHQRTHTGEKPYACPECGKSFSQLAHLRAHQRTHTGEKPYKCPEC 139 Query: 241 AKCFSRKDDLNRHMKIHEGSKRYLCTMCPKCFTRKDDLNRHMRNHDGLK 289 K FSR+D+L+ H + H G K Y C C K F+R+D LN H R H G K Sbjct: 140 GKSFSREDNLHTHQRTHTGEKPYKCPECGKSFSRRDALNVHQRTHTGKK 188
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure
>pdb|2CSH|A Chain A, Solution Structure Of Tandem Repeat Of The Zf-C2h2 Domains Of Human Zinc Finger Protein 297b Length = 110 Back     alignment and structure
>pdb|2CSH|A Chain A, Solution Structure Of Tandem Repeat Of The Zf-C2h2 Domains Of Human Zinc Finger Protein 297b Length = 110 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|1LLM|C Chain C, Crystal Structure Of A Zif23-Gcn4 Chimera Bound To Dna Length = 88 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|1F2I|G Chain G, Cocrystal Structure Of Selected Zinc Finger Dimer Bound To Dna Length = 73 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|4GZN|C Chain C, Mouse Zfp57 Zinc Fingers In Complex With Methylated Dna Length = 60 Back     alignment and structure
>pdb|4GZN|C Chain C, Mouse Zfp57 Zinc Fingers In Complex With Methylated Dna Length = 60 Back     alignment and structure
>pdb|4GZN|C Chain C, Mouse Zfp57 Zinc Fingers In Complex With Methylated Dna Length = 60 Back     alignment and structure
>pdb|4GZN|C Chain C, Mouse Zfp57 Zinc Fingers In Complex With Methylated Dna Length = 60 Back     alignment and structure
>pdb|2ADR|A Chain A, Adr1 Dna-Binding Domain From Saccharomyces Cerevisiae, Nmr, 25 Structures Length = 60 Back     alignment and structure
>pdb|1TF6|A Chain A, Co-crystal Structure Of Xenopus Tfiiia Zinc Finger Domain Bound To The 5s Ribosomal Rna Gene Internal Control Region Length = 190 Back     alignment and structure
>pdb|1TF6|A Chain A, Co-crystal Structure Of Xenopus Tfiiia Zinc Finger Domain Bound To The 5s Ribosomal Rna Gene Internal Control Region Length = 190 Back     alignment and structure
>pdb|1X6E|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Zinc Finger Protein 24 Length = 72 Back     alignment and structure
>pdb|1X6E|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Zinc Finger Protein 24 Length = 72 Back     alignment and structure
>pdb|1X6H|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Transcriptional Repressor Ctcf Length = 86 Back     alignment and structure
>pdb|3UK3|C Chain C, Crystal Structure Of Znf217 Bound To Dna Length = 57 Back     alignment and structure
>pdb|3UK3|C Chain C, Crystal Structure Of Znf217 Bound To Dna Length = 57 Back     alignment and structure
>pdb|2LT7|A Chain A, Solution Nmr Structure Of Kaiso Zinc Finger Dna Binding Domain In Complex With Kaiso Binding Site Dna Length = 133 Back     alignment and structure
>pdb|2LT7|A Chain A, Solution Nmr Structure Of Kaiso Zinc Finger Dna Binding Domain In Complex With Kaiso Binding Site Dna Length = 133 Back     alignment and structure
>pdb|2EPA|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domains From Human Krueppel-Like Factor 10 Length = 72 Back     alignment and structure
>pdb|1TF3|A Chain A, Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures Length = 92 Back     alignment and structure
>pdb|1TF3|A Chain A, Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures Length = 92 Back     alignment and structure
>pdb|2CT1|A Chain A, Solution Structure Of The Zinc Finger Domain Of Transcriptional Repressor Ctcf Protein Length = 77 Back     alignment and structure
>pdb|2EP2|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 603- 635) Of Human Zinc Finger Protein 484 Length = 46 Back     alignment and structure
>pdb|2EML|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 752- 784) Of Human Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1043
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 6e-57
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-55
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 5e-52
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 4e-50
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 4e-46
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-40
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 7e-29
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-22
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-16
1tf6_A190 Protein (transcription factor IIIA); complex (tran 5e-44
1tf6_A190 Protein (transcription factor IIIA); complex (tran 1e-36
1tf6_A190 Protein (transcription factor IIIA); complex (tran 2e-36
1tf6_A190 Protein (transcription factor IIIA); complex (tran 3e-34
1tf6_A190 Protein (transcription factor IIIA); complex (tran 2e-30
1tf6_A190 Protein (transcription factor IIIA); complex (tran 5e-22
1tf6_A190 Protein (transcription factor IIIA); complex (tran 1e-09
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 1e-37
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 8e-36
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 4e-31
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 7e-29
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 1e-27
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 3e-25
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 4e-19
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 5e-10
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 9e-37
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 4e-34
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 4e-32
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 1e-31
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-31
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 4e-29
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-26
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 4e-25
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-20
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 1e-05
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 5e-35
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 3e-34
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 1e-33
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 3e-31
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-28
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 1e-27
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-06
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 1e-31
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 9e-31
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 2e-30
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 2e-30
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 3e-27
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 8e-27
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 5e-25
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 6e-20
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 3e-13
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 3e-31
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-30
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-29
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 4e-28
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 1e-27
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-27
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 5e-26
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 4e-24
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-21
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-21
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 3e-18
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 6e-13
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 5e-05
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 8e-31
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 4e-30
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 6e-29
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 1e-27
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 3e-26
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 3e-24
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 4e-23
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 3e-22
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 2e-21
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 9e-21
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 4e-19
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 3e-18
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 5e-17
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 1e-06
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 1e-30
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 1e-30
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 9e-30
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 5e-27
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 3e-25
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 2e-24
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 3e-23
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 6e-23
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 2e-22
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 3e-20
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 3e-20
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 7e-20
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 1e-06
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 8e-29
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 1e-27
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-27
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 8e-27
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-25
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 5e-25
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 4e-24
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 7e-22
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 3e-21
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 4e-21
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 4e-20
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-17
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 9e-13
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-06
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 2e-27
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 1e-24
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 4e-24
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 6e-24
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 1e-23
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 2e-23
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 4e-23
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 7e-21
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 3e-19
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 1e-18
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 1e-16
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 6e-16
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 6e-16
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 4e-14
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 1e-12
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 2e-06
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-27
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 1e-24
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 1e-22
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 1e-22
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 1e-22
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 4e-21
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 6e-21
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 1e-17
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 4e-17
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 3e-16
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 3e-12
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 3e-27
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 5e-26
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 2e-22
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 6e-22
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 1e-21
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 3e-20
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 2e-19
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 9e-18
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 2e-15
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 1e-12
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 5e-10
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 4e-27
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 6e-26
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 2e-25
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 7e-24
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 1e-22
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 4e-22
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 4e-20
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 3e-19
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 2e-13
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 4e-12
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 2e-09
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 3e-09
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 3e-25
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 1e-23
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-23
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 9e-22
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-21
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 6e-21
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 5e-20
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 5e-17
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 6e-17
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 7e-17
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 1e-14
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 3e-13
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-23
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 3e-21
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 6e-21
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-20
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 2e-20
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 3e-20
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 9e-20
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 2e-18
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-16
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 4e-16
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 2e-15
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 2e-15
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 8e-05
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 3e-23
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 4e-23
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 6e-23
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 2e-20
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 3e-19
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 1e-18
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 7e-18
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 9e-17
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 1e-16
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 7e-13
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 8e-13
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 2e-10
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 2e-07
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 6e-22
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 3e-21
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 4e-21
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 9e-21
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 1e-20
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-18
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 1e-17
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 9e-17
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-12
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-08
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 5e-21
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 5e-18
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 2e-16
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 5e-16
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 2e-15
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 7e-15
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 3e-12
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 3e-12
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 7e-12
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 6e-10
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 7e-10
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 2e-09
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 7e-09
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 5e-07
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 1e-06
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 9e-05
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 1e-04
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 2e-20
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 4e-18
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 1e-17
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 9e-17
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 5e-16
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 2e-15
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 6e-15
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 1e-13
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 8e-13
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 2e-12
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 6e-10
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 1e-09
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 3e-08
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 3e-20
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 3e-20
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 8e-20
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 6e-18
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 7e-18
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 7e-17
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 2e-16
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 3e-16
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 7e-16
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 1e-15
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 5e-14
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 2e-12
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 1e-10
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 3e-07
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 3e-05
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 5e-20
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 3e-19
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 2e-18
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 4e-17
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 3e-16
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 1e-15
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 2e-15
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 3e-15
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 7e-15
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 8e-15
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 6e-13
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 1e-10
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 2e-10
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 6e-05
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 3e-19
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 2e-18
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 3e-18
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 4e-18
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 3e-16
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 7e-16
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 1e-15
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 5e-15
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 7e-15
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 2e-14
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 8e-13
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 2e-11
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 1e-09
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 5e-06
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 3e-05
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 6e-19
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 3e-18
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 1e-16
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 6e-15
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 5e-14
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 6e-13
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 1e-12
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 1e-11
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 2e-09
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 3e-08
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 9e-08
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 7e-19
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 1e-17
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 2e-17
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 4e-17
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 2e-16
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 3e-16
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 5e-16
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 8e-16
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 2e-15
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 3e-15
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 8e-15
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 3e-12
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 7e-10
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 3e-09
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 8e-09
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 3e-06
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 7e-19
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 8e-19
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 5e-18
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-17
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 3e-17
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 6e-17
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 4e-16
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-15
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-14
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 1e-12
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 3e-08
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 6e-08
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 6e-18
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 5e-17
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 6e-17
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-16
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 3e-16
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 3e-16
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-15
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 4e-14
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 5e-13
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 9e-13
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 2e-12
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-10
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 1e-16
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 1e-15
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 2e-15
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 6e-15
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 2e-14
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 2e-13
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 4e-13
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 3e-12
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 7e-12
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 4e-10
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 2e-09
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 8e-08
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 5e-06
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 1e-04
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 2e-16
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 2e-15
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 2e-15
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 3e-15
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 8e-15
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 2e-14
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 4e-12
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 9e-11
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 1e-08
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 2e-08
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 3e-07
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 1e-05
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 7e-04
2epa_A72 Krueppel-like factor 10; transforming growth facto 2e-13
2epa_A72 Krueppel-like factor 10; transforming growth facto 2e-13
2epa_A72 Krueppel-like factor 10; transforming growth facto 2e-13
2epa_A72 Krueppel-like factor 10; transforming growth facto 4e-13
2epa_A72 Krueppel-like factor 10; transforming growth facto 8e-13
2epa_A72 Krueppel-like factor 10; transforming growth facto 2e-12
2epa_A72 Krueppel-like factor 10; transforming growth facto 3e-11
2epa_A72 Krueppel-like factor 10; transforming growth facto 1e-10
2epa_A72 Krueppel-like factor 10; transforming growth facto 3e-09
2epa_A72 Krueppel-like factor 10; transforming growth facto 4e-09
2epa_A72 Krueppel-like factor 10; transforming growth facto 2e-08
2epa_A72 Krueppel-like factor 10; transforming growth facto 8e-07
2epa_A72 Krueppel-like factor 10; transforming growth facto 3e-05
2epa_A72 Krueppel-like factor 10; transforming growth facto 3e-04
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 1e-12
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 5e-11
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 2e-10
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 4e-10
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 5e-10
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 2e-08
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 3e-08
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 4e-08
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 5e-07
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 5e-07
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 1e-06
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 2e-06
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 3e-06
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 7e-06
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 4e-12
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 2e-11
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 3e-10
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 7e-10
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 1e-09
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 3e-09
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 4e-08
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 4e-08
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 4e-07
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 2e-06
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 5e-06
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 4e-05
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 7e-05
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-12
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-10
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-09
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-09
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-09
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-09
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-08
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-08
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-07
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-07
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-06
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-06
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-05
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-04
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-12
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-10
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-10
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-10
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-09
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-09
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-08
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-08
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-08
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-06
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-05
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-11
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-08
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-07
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-04
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-11
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-09
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-09
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-09
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-09
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-08
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-08
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-08
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-07
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-06
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-06
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-04
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-11
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-09
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-09
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-09
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-09
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-08
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-08
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-07
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-07
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-07
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-06
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-06
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-04
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-04
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-11
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-09
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-09
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-09
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-09
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-08
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-08
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-07
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-06
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-06
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-06
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-06
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-05
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-04
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-11
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-10
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-10
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-10
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-09
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-08
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-08
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-07
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-07
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-07
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-07
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-07
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-05
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-04
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-11
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-10
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-09
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-09
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-09
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-08
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-08
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-07
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-07
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-07
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-07
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-06
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-05
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-05
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-11
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-10
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-09
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-09
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-09
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-08
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-08
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-08
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-07
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-07
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-06
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-06
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-05
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-04
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 2e-11
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 9e-10
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 1e-09
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 2e-09
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 8e-09
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 1e-08
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 8e-08
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 8e-08
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 2e-07
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 9e-07
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 1e-06
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 1e-06
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 8e-05
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 2e-04
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-11
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-09
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-09
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-09
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-09
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-08
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-08
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-07
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-07
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-07
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-06
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-06
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-05
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-04
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 2e-11
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 3e-10
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 2e-09
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 4e-09
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 6e-09
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 9e-09
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 5e-08
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 6e-08
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 4e-07
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 5e-07
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 5e-07
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 2e-06
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 7e-05
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 8e-05
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-11
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-09
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-09
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-09
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-08
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-08
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-07
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-07
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-07
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-06
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-06
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-06
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-04
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-04
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-11
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-09
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-09
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-09
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-09
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-08
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-08
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-07
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-07
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-07
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-06
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-06
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-05
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-04
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-11
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-09
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-09
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-09
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-09
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-09
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-08
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-07
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-07
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-07
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-07
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-06
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-05
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-05
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-11
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-10
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-10
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-09
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-09
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-09
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-08
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-07
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-07
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-07
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-06
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-06
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-04
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-04
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 4e-11
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 1e-09
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 1e-09
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 3e-09
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 6e-09
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 5e-08
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 5e-08
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 2e-07
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 7e-07
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 1e-06
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 3e-06
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 9e-06
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 7e-05
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 1e-04
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-11
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-09
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-09
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-09
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-09
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-08
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-08
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-07
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-07
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-06
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-06
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-06
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-04
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-04
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-11
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-09
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-09
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-09
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-09
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-08
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-08
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-07
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-07
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-06
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-06
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-06
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-05
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-04
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-11
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-10
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-10
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 8e-10
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-09
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-09
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-08
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-07
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-07
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-07
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 9e-07
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-06
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-05
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-05
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-11
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-09
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-09
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-08
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-08
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-07
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-07
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-07
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-07
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-07
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-06
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-05
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-04
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-04
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 5e-11
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 5e-09
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 6e-09
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-08
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 6e-08
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 8e-08
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-07
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-07
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-07
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-06
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-06
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 5e-06
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 6e-05
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-04
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-11
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-10
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-09
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-09
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-09
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-08
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-08
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-07
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-06
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-06
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-06
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-06
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-05
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-04
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-11
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-09
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-09
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-09
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-09
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-08
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-08
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-07
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-07
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-06
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-06
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-06
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-04
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-04
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 6e-11
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-09
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-09
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-09
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-09
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-08
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-08
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-07
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-07
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 5e-07
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-06
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-06
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 8e-06
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-04
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-11
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-09
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-09
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-09
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-08
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-08
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-08
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-07
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-07
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-06
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-06
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-05
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-04
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 7e-11
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-09
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-09
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-08
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-08
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-08
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-07
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-07
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-06
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-06
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-06
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-06
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 9e-05
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-04
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 8e-11
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-09
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-09
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 7e-09
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 7e-09
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-08
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 6e-08
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-07
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-06
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-06
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 5e-06
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 8e-06
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 6e-05
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 5e-04
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-11
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-09
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-09
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-09
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-08
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-07
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-07
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-07
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-07
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-06
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-06
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-06
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-04
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-04
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-11
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-09
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-09
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-09
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-08
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-08
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-08
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-07
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-06
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-06
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-06
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-06
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-05
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-04
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-11
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-10
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-09
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-09
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-09
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-09
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-08
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-07
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-07
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-07
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-06
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-06
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-04
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-04
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-11
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-10
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-09
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-09
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-09
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-09
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-08
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-07
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-07
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-07
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-05
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-11
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-09
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-09
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-09
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-08
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-07
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-07
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-07
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-06
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-06
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-06
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-06
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-04
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-11
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-09
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-09
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-09
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-09
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-07
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-07
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-07
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-06
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-06
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-06
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-06
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-04
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-04
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-11
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-09
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-09
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-09
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-09
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-08
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-08
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-08
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-07
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-06
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-06
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-06
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-04
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-04
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-10
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 8e-10
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 9e-10
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-09
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 6e-09
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 6e-09
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-08
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-07
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-07
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-06
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-06
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-05
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 8e-05
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 6e-04
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-10
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-09
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 7e-09
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-08
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-08
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-07
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-07
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 5e-07
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-06
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-06
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-06
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 5e-06
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-04
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-04
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 1e-10
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 1e-09
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 2e-08
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 3e-08
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 6e-08
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 3e-07
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 3e-07
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 4e-07
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 6e-07
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 5e-06
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 9e-06
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 2e-05
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 2e-05
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 4e-04
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-10
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-09
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-09
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-09
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-08
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-08
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-08
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-07
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-07
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-06
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-06
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-04
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-04
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-10
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-10
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-09
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-09
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 7e-09
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-08
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 5e-08
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-07
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 8e-07
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-06
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-06
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-06
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-05
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-04
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-10
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-09
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-09
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-09
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-09
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-08
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-08
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-07
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-06
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-06
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-06
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-06
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-04
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-04
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-10
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-09
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-09
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-09
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-09
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-08
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-08
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-08
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-07
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-06
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-06
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-06
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-04
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 1e-10
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 6e-10
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 8e-09
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 4e-08
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 5e-08
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 5e-08
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 4e-07
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 6e-07
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 9e-07
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 2e-06
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 6e-06
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 9e-06
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 3e-05
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 2e-04
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-10
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-09
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-09
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-09
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-08
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-08
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-08
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-07
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-06
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-06
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-06
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-05
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-04
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-10
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-09
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-09
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-09
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-08
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-08
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-08
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-07
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-06
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-06
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-06
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-06
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-04
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-04
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-10
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-09
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-09
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-08
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-08
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-08
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-07
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-07
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-07
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-06
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-06
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-05
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-10
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-09
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-09
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-08
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-08
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-08
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-07
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-07
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-07
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-06
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-06
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-05
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-04
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-10
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 7e-10
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-09
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 5e-09
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-08
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-08
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-08
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 5e-07
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-06
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-06
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-06
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-06
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 7e-05
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-04
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 2e-10
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 3e-10
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 1e-07
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 3e-07
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 1e-06
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 2e-06
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 3e-06
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-10
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-09
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-09
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-08
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-08
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-08
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-08
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-07
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-06
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-06
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-06
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-06
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-04
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-04
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-10
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-09
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-09
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-09
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-08
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-08
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-07
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-07
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-06
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-06
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-06
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-06
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-04
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-04
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-10
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-09
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-09
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-08
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-08
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-07
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-07
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-07
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-07
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-06
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-06
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-06
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-04
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-04
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-10
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-09
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 6e-09
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 9e-09
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-08
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-08
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 6e-08
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-07
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-07
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-06
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-06
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-05
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-04
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 8e-04
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-10
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-09
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-08
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-08
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-08
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-07
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-07
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-07
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-06
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 9e-06
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-05
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-05
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-05
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-04
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-10
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-10
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-09
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-09
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-09
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-08
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-08
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-07
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-07
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-06
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-06
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-05
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-05
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-05
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-10
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-09
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-08
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-08
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-07
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-07
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-07
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-07
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-06
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 7e-06
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-05
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-05
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-05
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 8e-04
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-10
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-09
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-08
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-08
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-08
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-07
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-07
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-06
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-06
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-05
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-05
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-05
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-04
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-04
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-10
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-09
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-09
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 9e-09
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 9e-09
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-08
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-08
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-08
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-06
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-06
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-05
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-05
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-05
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-10
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-09
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-09
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-08
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-08
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-08
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 7e-08
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-07
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-06
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-06
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-06
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-05
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-05
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 8e-04
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 2e-10
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 3e-10
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 2e-09
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 2e-09
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 8e-09
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 9e-09
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 1e-08
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 2e-08
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 7e-07
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 2e-06
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 3e-06
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 3e-06
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 6e-05
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 1e-04
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 3e-04
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 4e-04
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-10
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-09
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-09
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-08
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-08
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-08
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-07
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-06
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-06
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-06
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-06
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-06
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-04
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-04
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 3e-10
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 8e-09
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 3e-08
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 6e-08
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 8e-08
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 2e-07
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 3e-07
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 4e-07
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 4e-07
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 9e-07
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 2e-06
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 2e-06
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 3e-06
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 4e-05
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 4e-05
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 2e-04
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-10
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-09
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-09
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-09
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-09
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-08
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-08
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-07
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-07
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-06
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-05
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-05
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-04
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-10
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-08
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-08
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 9e-08
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-07
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-07
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-07
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 7e-07
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 8e-06
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 8e-06
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-05
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-05
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-04
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 5e-04
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-10
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-09
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-09
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-09
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-09
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-08
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-08
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-07
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-07
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-06
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-06
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-06
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-04
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 3e-10
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 4e-09
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 8e-09
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 8e-09
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 3e-08
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 4e-08
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 9e-08
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 1e-07
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 4e-07
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 5e-06
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 9e-06
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 1e-05
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 6e-05
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 6e-04
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 3e-10
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 3e-09
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 5e-09
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 5e-09
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 6e-09
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 3e-08
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-07
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 5e-07
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-06
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-06
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-06
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-05
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-04
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-10
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-09
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 7e-09
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-08
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-08
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-08
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-07
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-07
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-06
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-06
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 9e-06
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-05
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-05
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 7e-04
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-10
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-09
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-09
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 8e-09
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-08
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-08
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-08
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-07
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-07
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 9e-07
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 7e-06
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 9e-06
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-04
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-04
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-10
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-09
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-08
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-08
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-08
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-07
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-07
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-07
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-06
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-06
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-06
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-05
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-04
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 4e-10
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 2e-09
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 3e-08
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 6e-08
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 6e-08
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 9e-08
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 2e-07
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 3e-07
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 2e-06
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 7e-06
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 8e-06
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 1e-05
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 1e-04
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 2e-04
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-10
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-09
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-09
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-08
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-08
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-07
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-07
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-07
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-06
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-06
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-06
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-05
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-04
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 4e-10
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 2e-09
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 2e-09
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 3e-09
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 5e-08
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 7e-08
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 2e-07
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 4e-06
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 8e-06
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 6e-05
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 2e-04
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 5e-10
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-09
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-08
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-08
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 5e-08
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-07
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-07
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 5e-07
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 7e-07
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-06
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-06
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-05
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 5e-04
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 6e-10
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 9e-10
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 1e-09
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 6e-09
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 2e-07
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 5e-07
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 2e-05
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 9e-05
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 1e-04
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 2e-04
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 3e-04
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 5e-04
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-10
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-08
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-08
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-08
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-08
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-07
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-07
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-07
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-06
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-06
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-05
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-05
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-04
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-04
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-10
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 7e-09
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-08
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 5e-08
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 7e-08
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-07
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 8e-07
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-06
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-06
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-06
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-05
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-05
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-10
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-09
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-09
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-08
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-08
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-07
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-07
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-07
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-06
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-06
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-05
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-05
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-04
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-10
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-09
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-09
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-08
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-08
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-08
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-07
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-07
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-07
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-06
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-06
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-05
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-05
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-05
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-10
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-09
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-09
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-08
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-08
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-07
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-07
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-07
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-06
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-06
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-05
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-05
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-04
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 7e-10
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 8e-09
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 7e-08
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 9e-08
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-07
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-07
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-07
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 6e-07
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-06
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 9e-06
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-05
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-05
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-04
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 9e-10
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 3e-08
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 3e-08
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 8e-08
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 3e-07
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-06
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-06
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-06
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 6e-06
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-05
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 3e-05
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 8e-05
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 1e-04
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 3e-04
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-10
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-09
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-08
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-08
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-08
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-07
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-07
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-07
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-06
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-06
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-05
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-05
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-04
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 9e-10
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-09
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-08
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-08
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-07
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-07
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-06
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-06
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-06
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-05
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-05
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-05
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-04
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-04
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 1e-09
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 9e-09
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-08
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 5e-08
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-07
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 5e-07
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-06
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 4e-06
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 8e-06
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 1e-05
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 3e-05
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 5e-05
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 1e-04
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-04
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-09
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-08
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-07
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-07
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-07
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-07
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-07
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-06
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-06
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 9e-06
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-05
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-05
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 9e-05
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-04
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-09
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-08
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-08
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-08
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-07
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-07
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-07
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-06
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-06
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-06
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-05
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-05
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-04
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 1e-09
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 3e-09
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 6e-09
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 8e-08
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 1e-07
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 2e-07
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 9e-07
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 2e-06
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 9e-06
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 1e-05
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 2e-05
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 4e-05
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 6e-05
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 9e-05
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 2e-09
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 1e-08
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 4e-07
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 2e-06
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 3e-06
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 3e-06
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 7e-06
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 3e-05
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 8e-05
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 1e-04
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 2e-04
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 2e-04
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 3e-04
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 8e-04
1ej6_B 1275 Lambda1; icosahedral, non-equivalence, dsRNA virus 9e-09
1ej6_B 1275 Lambda1; icosahedral, non-equivalence, dsRNA virus 2e-06
1ej6_B 1275 Lambda1; icosahedral, non-equivalence, dsRNA virus 7e-05
1ej6_B 1275 Lambda1; icosahedral, non-equivalence, dsRNA virus 2e-04
1ej6_B 1275 Lambda1; icosahedral, non-equivalence, dsRNA virus 7e-04
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-08
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-07
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-07
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-07
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-07
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 4e-07
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 6e-07
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 7e-07
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 5e-06
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 4e-05
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 9e-05
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-04
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-04
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-08
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-07
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-07
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-07
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 8e-07
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-06
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-06
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 8e-06
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-05
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 9e-05
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-04
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 8e-04
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 3e-08
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 2e-07
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 2e-07
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 3e-07
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 2e-06
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 3e-06
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 4e-06
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 5e-06
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 1e-05
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 6e-05
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 5e-04
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 6e-08
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 9e-08
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 2e-07
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 3e-07
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 3e-07
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 4e-07
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 7e-07
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 5e-06
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 1e-05
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 5e-05
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 3e-04
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-07
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-07
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-07
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-06
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-06
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-06
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-05
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-05
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-05
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-05
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-05
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-04
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 2e-07
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 1e-06
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 1e-06
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 4e-06
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 9e-06
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 1e-05
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 2e-05
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 5e-05
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 2e-04
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 2e-04
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 3e-07
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 4e-07
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 1e-06
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 4e-06
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 3e-05
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 1e-04
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 2e-04
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 5e-07
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 3e-06
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 5e-06
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 6e-05
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 8e-05
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 9e-05
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 3e-04
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 3e-04
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 4e-04
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 6e-04
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 5e-07
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 1e-06
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 2e-06
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 3e-06
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 4e-06
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 4e-06
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 1e-05
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 1e-05
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 1e-05
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 3e-05
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 5e-05
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 6e-05
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 5e-06
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 1e-05
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 5e-05
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 1e-04
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 1e-05
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 2e-05
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 3e-05
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 8e-05
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 5e-04
1paa_A30 Yeast transcription factor ADR1; transcription reg 3e-05
1paa_A30 Yeast transcription factor ADR1; transcription reg 3e-04
1ard_A29 Yeast transcription factor ADR1; transcription reg 6e-05
1ard_A29 Yeast transcription factor ADR1; transcription reg 2e-04
1ard_A29 Yeast transcription factor ADR1; transcription reg 2e-04
1ard_A29 Yeast transcription factor ADR1; transcription reg 3e-04
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
 Score =  193 bits (494), Expect = 6e-57
 Identities = 66/179 (36%), Positives = 95/179 (53%)

Query: 159 TFTDKVKFNRHMRAHEGIKPFQCSVCSESFTQRSNLNIHLRIHDGIRPFQCNVCYICFTN 218
           +               G KP+ C  C +SF++  +L  H R H G +P++C  C   F++
Sbjct: 2   SEFGSSSSVAQAALEPGEKPYACPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFSD 61

Query: 219 KSDLNRHSRIHNGIKPFLCSMCAKCFSRKDDLNRHMKIHEGSKRYLCTMCPKCFTRKDDL 278
           K DL RH R H G KP+ C  C K FS++ +L  H + H G K Y C  C K F++   L
Sbjct: 62  KKDLTRHQRTHTGEKPYKCPECGKSFSQRANLRAHQRTHTGEKPYACPECGKSFSQLAHL 121

Query: 279 NRHMRNHDGLKPFHCSVCFESFTQKALLNIHLRIHTNSKPHACSICTESFSQKSNLYIH 337
             H R H G KP+ C  C +SF+++  L+ H R HT  KP+ C  C +SFS++  L +H
Sbjct: 122 RAHQRTHTGEKPYKCPECGKSFSREDNLHTHQRTHTGEKPYKCPECGKSFSRRDALNVH 180


>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>1ej6_B Lambda1; icosahedral, non-equivalence, dsRNA virus, methylase, methyltransferase, guanylyltransferase, zinc finger, icosahedral virus; 3.60A {Reovirus SP} SCOP: i.7.1.1 PDB: 2cse_V Length = 1275 Back     alignment and structure
>1ej6_B Lambda1; icosahedral, non-equivalence, dsRNA virus, methylase, methyltransferase, guanylyltransferase, zinc finger, icosahedral virus; 3.60A {Reovirus SP} SCOP: i.7.1.1 PDB: 2cse_V Length = 1275 Back     alignment and structure
>1ej6_B Lambda1; icosahedral, non-equivalence, dsRNA virus, methylase, methyltransferase, guanylyltransferase, zinc finger, icosahedral virus; 3.60A {Reovirus SP} SCOP: i.7.1.1 PDB: 2cse_V Length = 1275 Back     alignment and structure
>1ej6_B Lambda1; icosahedral, non-equivalence, dsRNA virus, methylase, methyltransferase, guanylyltransferase, zinc finger, icosahedral virus; 3.60A {Reovirus SP} SCOP: i.7.1.1 PDB: 2cse_V Length = 1275 Back     alignment and structure
>1ej6_B Lambda1; icosahedral, non-equivalence, dsRNA virus, methylase, methyltransferase, guanylyltransferase, zinc finger, icosahedral virus; 3.60A {Reovirus SP} SCOP: i.7.1.1 PDB: 2cse_V Length = 1275 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Length = 31 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Length = 31 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Length = 31 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Length = 31 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Length = 30 Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Length = 30 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Length = 29 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Length = 29 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Length = 29 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Length = 29 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1043
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 100.0
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 100.0
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.96
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.96
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.93
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.91
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.89
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.88
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.88
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.87
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.87
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.86
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.85
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.85
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.84
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.84
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.76
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.76
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.74
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.74
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.73
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.73
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.73
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.72
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.71
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.71
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.71
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.69
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.69
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.69
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.68
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.68
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.64
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.64
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.63
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.63
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.62
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.62
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.62
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.61
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.56
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.55
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.55
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.55
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.53
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.52
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.52
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.5
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.5
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.5
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.5
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.48
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.47
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.46
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.45
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.45
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.45
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.44
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.41
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.41
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.4
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.4
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.4
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.37
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.37
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.36
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.36
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.35
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.35
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.33
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.32
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.3
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.3
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.3
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.29
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.25
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.25
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.21
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.21
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.2
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.2
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.19
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.12
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.11
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.11
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.1
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.1
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.1
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.1
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.09
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.09
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.09
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.09
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.09
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.09
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.08
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.08
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.08
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.08
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.08
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.08
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.08
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.07
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.07
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.07
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.07
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.07
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.07
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.07
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.07
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.07
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.07
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.07
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.07
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.07
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.07
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.07
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.06
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.06
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.06
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.06
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.06
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.06
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.06
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.06
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.06
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.06
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.06
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.06
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.06
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.06
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.06
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.06
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.06
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.06
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.06
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.06
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.06
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.05
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.05
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.05
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.05
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.05
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.05
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.05
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.05
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.05
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.05
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.05
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.05
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.05
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.05
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.05
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.04
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.04
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.04
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.04
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.04
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.03
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.03
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.03
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.03
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.02
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.02
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.02
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.02
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.02
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.02
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.01
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.01
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.0
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.0
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 98.99
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.99
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 98.99
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.99
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.99
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.99
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.98
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.98
2epa_A72 Krueppel-like factor 10; transforming growth facto 98.98
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.97
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.95
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.95
2epa_A72 Krueppel-like factor 10; transforming growth facto 98.95
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.94
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.94
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.94
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.94
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.93
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.93
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.93
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.93
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.93
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.93
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.93
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.93
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.93
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.93
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.93
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.93
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.93
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.93
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.93
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.93
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.93
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.92
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.92
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.92
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.92
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.92
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.92
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.92
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.92
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.92
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.92
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 98.92
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.92
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.91
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.91
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.91
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.91
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.91
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.91
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.91
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.91
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.91
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.91
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.91
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.91
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.91
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.91
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.91
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.9
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.9
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.9
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.9
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.9
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.89
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.89
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.89
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.89
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.89
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.89
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.88
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.88
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.88
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.88
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.88
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.88
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.88
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.88
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.87
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.87
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.87
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.87
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.86
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.86
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.86
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.86
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.85
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.85
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.85
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.85
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.85
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.85
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.84
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.84
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.84
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.84
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.83
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.83
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.83
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.82
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.82
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.81
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.81
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.8
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.8
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.8
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.8
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.79
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.78
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.77
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.77
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.77
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.75
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.74
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.74
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.73
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.72
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.68
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.56
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.54
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.51
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.5
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.5
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.5
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.46
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.45
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.42
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.38
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.38
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.35
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.34
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.33
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.32
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.31
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.3
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.24
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.2
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.17
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.16
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.15
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.15
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.15
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.15
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.14
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.14
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.14
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.14
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.14
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.13
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.09
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.05
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.05
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.04
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.03
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.02
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.02
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.01
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 97.98
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 97.97
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 97.91
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 97.87
1ard_A29 Yeast transcription factor ADR1; transcription reg 97.87
1ard_A29 Yeast transcription factor ADR1; transcription reg 97.86
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 97.85
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 97.84
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.06
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 97.83
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 97.83
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.02
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 97.81
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.79
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 97.79
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 97.79
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 97.78
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.78
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.76
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.76
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.76
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 97.76
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.75
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 97.75
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.74
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 97.74
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 96.93
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.74
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 97.72
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 96.9
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 97.71
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.68
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.67
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 96.82
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.56
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 96.7
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.52
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.26
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.2
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 96.95
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 96.81
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 96.11
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 95.87
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 95.43
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 95.32
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 95.02
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 94.52
2e72_A49 POGO transposable element with ZNF domain; zinc fi 94.45
2e72_A49 POGO transposable element with ZNF domain; zinc fi 92.88
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 86.06
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 81.93
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
Probab=100.00  E-value=5.8e-36  Score=298.84  Aligned_cols=179  Identities=39%  Similarity=0.793  Sum_probs=59.8

Q ss_pred             HHHHhhhccCCCccccccCCccccCHHHHHHHHHhccCCcceecccCCcccCCHHHHHHHHHhcCCCCCeecCCCccccc
Q psy13406        110 LNRHLKSHSENKVFRCEQCRFDFYVKREYNRHMKIHDGVKVFLCSVCSKTFTDKVKFNRHMRAHEGIKPFQCSVCSESFT  189 (1043)
Q Consensus       110 l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~  189 (1043)
                      |..|+..|.++++|.|++|++.|.....|..|++.|.++++|.|++|++.|.+...|..|++.|.++++|.|++|++.|.
T Consensus         9 l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~   88 (190)
T 2i13_A            9 SVAQAALEPGEKPYACPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFSDKKDLTRHQRTHTGEKPYKCPECGKSFS   88 (190)
T ss_dssp             ----------------------CCSSHHHHHGGGCC---CCEECTTTCCEESSHHHHHHHHHHHHCCCCEECTTTCCEES
T ss_pred             chhhhhhcCCCCCCcCCCCccccCCHHHHHHHHHHcCCCCCccCCCcCchhCCHHHHHHHHHhcCCCCCccCcccCCccC
Confidence            33333334333444444444444444444444444443344444444444444444444444444434444444444444


Q ss_pred             CcchHHHHHhhccCCCCccCCCCCccccChhHHHhhhhhccCCCcccCCccccccCChhhHHhhhccccCCcceeCCCCC
Q psy13406        190 QRSNLNIHLRIHDGIRPFQCNVCYICFTNKSDLNRHSRIHNGIKPFLCSMCAKCFSRKDDLNRHMKIHEGSKRYLCTMCP  269 (1043)
Q Consensus       190 ~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~  269 (1043)
                      +...|..|+++|.++++|.|++|++.|.+...|..|+++|+++++|.|++|++.|.....|..|+++|.++++|.|++|+
T Consensus        89 ~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~H~~~~~~~C~~C~  168 (190)
T 2i13_A           89 QRANLRAHQRTHTGEKPYACPECGKSFSQLAHLRAHQRTHTGEKPYKCPECGKSFSREDNLHTHQRTHTGEKPYKCPECG  168 (190)
T ss_dssp             CHHHHHHHHHHHHTCCCEECTTTCCEESSHHHHHHHHHHHHCCCCEECTTTCCEESCHHHHHHHHHHHHCCCCEECTTTC
T ss_pred             CHHHHHHHHHhcCCCCCCcCCCCCCccCCHHHHHHHHHHhCCCCCeECCCCCcccCCHHHHHHHHHhcCCCCCeECCCCC
Confidence            44444444444433333333333333333333333333333333333333333333333333333333333333333333


Q ss_pred             CcCCCHHHHHHHHHHhCCC
Q psy13406        270 KCFTRKDDLNRHMRNHDGL  288 (1043)
Q Consensus       270 ~~f~~~~~l~~H~~~h~~~  288 (1043)
                      +.|.....|..|+++|+|+
T Consensus       169 ~~f~~~~~L~~H~~~H~~~  187 (190)
T 2i13_A          169 KSFSRRDALNVHQRTHTGK  187 (190)
T ss_dssp             CEESSHHHHHHHHTTC---
T ss_pred             CccCCHHHHHHHHHhcCCC
Confidence            3333333333333333333



>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1043
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 5e-10
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 8e-10
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 2e-09
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 2e-09
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 4e-09
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 5e-09
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 5e-09
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 1e-08
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 3e-08
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 3e-08
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 1e-06
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 2e-06
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 4e-05
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 6e-05
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 7e-05
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 1e-04
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 2e-09
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 2e-08
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 6e-08
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 7e-08
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 2e-07
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 6e-07
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 8e-07
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 9e-07
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 2e-06
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 6e-06
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 1e-05
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 3e-04
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 3e-04
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 0.001
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 1e-08
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 3e-08
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 3e-08
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 1e-07
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 1e-07
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 2e-07
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 4e-07
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 5e-07
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 6e-07
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 6e-07
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 4e-05
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 8e-05
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 2e-04
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 4e-04
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 5e-04
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 2e-08
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 4e-08
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 2e-07
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 6e-07
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 6e-07
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 8e-07
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 9e-07
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 9e-07
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 7e-06
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 8e-06
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 4e-05
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 6e-05
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 7e-05
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 0.001
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 0.002
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 0.002
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 4e-08
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 6e-08
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 3e-07
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 4e-07
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 1e-06
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-06
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-06
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 4e-06
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 5e-06
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-05
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-05
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 3e-05
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-04
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 4e-04
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 0.003
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 0.004
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 6e-08
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 5e-07
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 1e-06
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 3e-06
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 4e-06
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 5e-06
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 9e-06
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 9e-06
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 9e-06
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 1e-05
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 8e-05
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 2e-04
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 5e-04
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 6e-04
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 0.003
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 0.004
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 2e-07
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 3e-06
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 3e-06
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 1e-05
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 4e-05
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 5e-05
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 5e-05
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 1e-04
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 2e-04
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 3e-04
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 6e-04
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 7e-04
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 0.001
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 4e-07
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 1e-06
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-06
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 3e-06
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 4e-06
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-05
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 4e-05
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 5e-05
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 6e-05
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-04
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-04
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 4e-04
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 0.003
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 0.003
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 5e-07
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 2e-06
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 7e-06
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 3e-05
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 6e-05
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 1e-04
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 1e-04
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 2e-04
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 3e-04
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 5e-04
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 0.002
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 0.004
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 0.004
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 5e-07
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 2e-05
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 7e-05
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 3e-04
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 3e-04
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 7e-04
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 8e-04
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 0.001
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 0.001
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 0.002
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 0.002
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 1e-06
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 9e-06
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 1e-05
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 3e-05
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 8e-05
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 9e-05
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 1e-04
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 2e-04
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 4e-04
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 4e-04
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 0.001
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 0.001
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 0.002
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 5e-06
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 6e-06
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 2e-05
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 4e-05
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 8e-05
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 1e-04
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 1e-04
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 4e-04
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 5e-04
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 7e-04
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 0.001
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 0.003
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 5e-06
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 1e-04
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 1e-04
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 3e-04
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 0.001
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 0.002
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 0.003
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 0.004
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 1e-05
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 2e-05
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 2e-04
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 5e-04
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 0.001
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 0.003
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 1e-05
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 2e-04
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 4e-04
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 0.001
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 0.004
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 2e-05
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 8e-05
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 4e-04
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 0.001
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 0.004
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 1e-04
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 1e-04
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 2e-04
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 3e-04
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 7e-04
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 0.001
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 0.002
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 0.003
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 2e-04
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 5e-04
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 3e-04
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 0.001
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 0.001
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 0.003
d2adra231 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Sac 4e-04
d1ubdc428 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger 0.001
d1ubdc428 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger 0.002
d1ubdc428 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger 0.003
d1ubdc428 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger 0.004
d1a1ia328 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) 0.002
d1a1ia328 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) 0.003
d2epqa132 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [ 0.002
d2epqa132 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [ 0.003
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 53.5 bits (128), Expect = 5e-10
 Identities = 21/53 (39%), Positives = 28/53 (52%), Gaps = 1/53 (1%)

Query: 233 KPFLCSMCAKCFSRKDDLNRHMKIHEGSKRYLCTMCPKCFTRKDDLNRHMRNH 285
           K + C  C K F+ K   +RHM +H G + Y C +C K F  K  L  HM+ H
Sbjct: 2   KLYPCQ-CGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIH 53


>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 31 Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 32 Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 32 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1043
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.53
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.48
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.14
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.1
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.09
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.05
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.05
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.01
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.99
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.96
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.95
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.94
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.93
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.91
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.9
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.88
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.86
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.85
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.84
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.83
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.79
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.79
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.77
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.75
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.74
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.64
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.57
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.53
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.52
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.51
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.5
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.47
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.46
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.46
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.25
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.24
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.21
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.2
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.15
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.09
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.09
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.07
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.96
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.93
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.88
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.87
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.84
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.8
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.8
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.72
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.68
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.68
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.67
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.56
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.51
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.49
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.44
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.34
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.33
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.26
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.16
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.14
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.13
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.08
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.05
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.02
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 96.93
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.91
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 96.82
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 96.77
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 96.72
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 96.7
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.66
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 96.65
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 96.47
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.41
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 96.36
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.24
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.22
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.87
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.53
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.53
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 95.49
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.04
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 95.03
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 94.99
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 94.89
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 94.88
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 94.72
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 94.71
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 94.4
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 94.33
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 94.3
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 94.23
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 94.18
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 94.17
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 94.15
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 92.68
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 92.58
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 92.32
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 91.49
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 90.8
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 88.92
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 88.39
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 87.23
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 86.75
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 86.43
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 86.41
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 86.28
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 86.1
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 85.91
d1y0jb136 U-shaped transcription factor, different fingers { 85.78
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 84.84
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 84.8
d1y0jb136 U-shaped transcription factor, different fingers { 84.06
d1tf3a331 Transcription factor IIIA, TFIIIA {Xenopus laevis 83.95
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 82.98
d1tf3a331 Transcription factor IIIA, TFIIIA {Xenopus laevis 80.05
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.53  E-value=1.1e-15  Score=111.01  Aligned_cols=53  Identities=38%  Similarity=0.819  Sum_probs=32.2

Q ss_pred             CCCcCccchhHHhCChHHHHHHHHhccCCCcccCccchhhcCCHHHHHHHHhhh
Q psy13406        890 VKPFLCSICAKNFSRKDDLNRHMRKHDGIKPFLCSMCAEAFSRKDHLKKHMRKC  943 (1043)
Q Consensus       890 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~  943 (1043)
                      ||||.|+ ||+.|..+.+|.+|+++|+|++||.|.+||++|.+...|..||+.|
T Consensus         1 EK~y~C~-Cgk~F~~~~~l~~H~~~Ht~ekpy~C~~C~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           1 DKLYPCQ-CGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             CCCEECT-TSCEESSHHHHHHHHHHHSCCCSEECTTTSCEESSSHHHHHHHTTT
T ss_pred             CcCCCCC-CCCeECCHHHhHHHhhccccccCCcCCCcCCEecCHHHHHHHHhcC
Confidence            4566663 6666666666666666666666666666666666666666666543



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1tf3a3 g.37.1.1 (A:71-101) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a3 g.37.1.1 (A:71-101) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure