Psyllid ID: psy13439

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-
MDHEDNQHESLKKKRKLLTVYLHSKNEVLSVENGKWNGLIADLVNRKTDMALTSLVINSRRESVVDFTVPIMETGIAIVVAKRTGIISPTAFLEPFDTASWMLVGVVAIQASAFTIFFFEWLSPSGFDMKISFSYRPLPFLPPEPFDTASWMLVGVVAIQASAFTIFFFEWLSPSGFDMKTTALQPSHRFSLFRTYWLVWAVLFQAAVHIDTPKGFTAKFMTNMWAMFAVVFLAIYTANLAAFMITREEFHEFTGVDDVRI
ccccccccccHHHHHHcEEEEEccccccccccccccHHHHHHHHcccccEEEEcccccccHHcccccccccccccEEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHccccEEEEccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccc
cHHHHHHHHcccEEEEEEEEccccccccEccccccEcHHHHHHHcccccEEccccEccHHHHccEEEccccEEEcEEEEEEcccccccEEEccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccHcccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHcc
MDHEDNQHESLKKKRKLLTVYLHSKnevlsvengkwNGLIADLVNRKTDMALTSLVINsrresvvdftvpIMETGIAIVVAKrtgiisptaflepfdtaSWMLVGVVAIQASAFTIFFFewlspsgfdmkisfsyrplpflppepfdtasWMLVGVVAIQASAFTIFFFewlspsgfdmkttalqpshrfslFRTYWLVWAVLFQAAVhidtpkgftAKFMTNMWAMFAVVFLAIYTANLAAFMITREefheftgvddvri
mdhednqheslkkkrKLLTVYLHSKnevlsvengkWNGLIADLVNRKTDMALTslvinsrresvvdftvpIMETGIAIVVAKRTGIISPTAFLEPFDTASWMLVGVVAIQASAFTIFFFEWLSPSGFDMKISFSYRPLPFLPPEPFDTASWMLVGVVAIQASAFTIFFFEWLSPSGFDMKTTALQPSHRFSLFRTYWLVWAVLFQAAVHIDTPKGFTAKFMTNMWAMFAVVFLAIYTANLAAFMITREefheftgvddvri
MDHEDNQHESLKKKRKLLTVYLHSKNEVLSVENGKWNGLIADLVNRKTDMALTSLVINSRRESVVDFTVPIMETGIAIVVAKRTGIISPTAFLEPFDTASWMLVGVVAIQASAFTIFFFEWLSPSGFDMKISFSYRPLPFLPPEPFDTASWMLVGVVAIQASAFTIFFFEWLSPSGFDMKTTALQPSHRFSLFRTYWLVWAVLFQAAVHIDTPKGFTAKFMTNMWAMFAVVFLAIYTANLAAFMITREEFHEFTGVDDVRI
***************KLLTVYLHSKNEVLSVENGKWNGLIADLVNRKTDMALTSLVINSRRESVVDFTVPIMETGIAIVVAKRTGIISPTAFLEPFDTASWMLVGVVAIQASAFTIFFFEWLSPSGFDMKISFSYRPLPFLPPEPFDTASWMLVGVVAIQASAFTIFFFEWLSPSGFDMKTTALQPSHRFSLFRTYWLVWAVLFQAAVHIDTPKGFTAKFMTNMWAMFAVVFLAIYTANLAAFMITREEFHEFTGV*****
***E*N*HESLKKKRKLLTVYLHSKNEVLSVENGKWNGLIADLVNRKTDMALTSLVINSRRESVVDFTVPIMETGIAIVVAKRTGIISPTAFLEPFDTASWMLVGVVAIQASAFTIFFFEWLSPSGFDMK**************PFDTASWMLVGVVAIQASAFTIFFFEWLS***************RFSLFRTYWLVWAVLFQAAVHIDTPKGFTAKFMTNMWAMFAVVFLAIYTANLAAFMITREEFHEFT*VDDVRI
************KKRKLLTVYLHSKNEVLSVENGKWNGLIADLVNRKTDMALTSLVINSRRESVVDFTVPIMETGIAIVVAKRTGIISPTAFLEPFDTASWMLVGVVAIQASAFTIFFFEWLSPSGFDMKISFSYRPLPFLPPEPFDTASWMLVGVVAIQASAFTIFFFEWLSPSGFDMKTTALQPSHRFSLFRTYWLVWAVLFQAAVHIDTPKGFTAKFMTNMWAMFAVVFLAIYTANLAAFMITREEFHEFTGVDDVRI
MDHEDNQHESLKKKRKLLTVYLHSKNEVLSVENGKWNGLIADLVNRKTDMALTSLVINSRRESVVDFTVPIMETGIAIVVAKRTGIISPTAFLEPFDTASWMLVGVVAIQASAFTIFFFEWLSPSGFDMKISFSYRPLPFLPPEPFDTASWMLVGVVAIQASAFTIFFFEWLSP******TTALQPSHRFSLFRTYWLVWAVLFQAAVHIDTPKGFTAKFMTNMWAMFAVVFLAIYTANLAAFMITREEFHEFTG******
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDHEDNQHESLKKKRKLLTVYLHSKNEVLSVENGKWNGLIADLVNRKTDMALTSLVINSRRESVVDFTVPIMETGIAIVVAKRTGIISPTAFLEPFDTASWMLVGVVAIQASAFTIFFFEWLSPSGFDMKISFSYRPLPFLPPEPFDTASWMLVGVVAIQASAFTIFFFEWLSPSGFDMKTTALQPSHRFSLFRTYWLVWAVLFQAAVHIDTPKGFTAKFMTNMWAMFAVVFLAIYTANLAAFMITREEFHEFTGVDDVRI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query261 2.2.26 [Sep-21-2011]
Q03391 1323 Glutamate receptor ionotr yes N/A 0.681 0.134 0.362 4e-39
Q62645 1323 Glutamate receptor ionotr yes N/A 0.681 0.134 0.362 5e-39
O15399 1336 Glutamate receptor ionotr yes N/A 0.681 0.133 0.362 6e-39
Q00961 1237 Glutamate receptor ionotr no N/A 0.678 0.143 0.337 8e-37
Q01097 1482 Glutamate receptor ionotr no N/A 0.681 0.120 0.353 1e-36
Q5R1P3 1485 Glutamate receptor ionotr no N/A 0.681 0.119 0.353 1e-36
Q00960 1482 Glutamate receptor ionotr no N/A 0.681 0.120 0.353 2e-36
Q13224 1484 Glutamate receptor ionotr no N/A 0.681 0.119 0.353 2e-36
Q01098 1239 Glutamate receptor ionotr no N/A 0.678 0.142 0.346 2e-36
Q14957 1233 Glutamate receptor ionotr no N/A 0.678 0.143 0.346 3e-36
>sp|Q03391|NMDE4_MOUSE Glutamate receptor ionotropic, NMDA 2D OS=Mus musculus GN=Grin2d PE=1 SV=3 Back     alignment and function desciption
 Score =  161 bits (408), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 82/226 (36%), Positives = 124/226 (54%), Gaps = 48/226 (21%)

Query: 33  NGKWNGLIADLVNRKTDMALTSLVINSRRESVVDFTVPIMETGIAIVVAKRTGIISPTAF 92
           +G WNG+I ++  ++ DMA+ SL IN  R  +VDF+VP +ETGI+++VA+  G +SP+AF
Sbjct: 515 DGVWNGMIGEVFYQRADMAIGSLTINEERSEIVDFSVPFVETGISVMVARSNGTVSPSAF 574

Query: 93  LEPFDTASWMLVGVVAIQASAFTIFFFEWLSPSGFDMKISFSYRPLPFLPPEPFDTASWM 152
           LEP+  A W+++ V+ +   A T+F FE+LSP G++  ++   RP               
Sbjct: 575 LEPYSPAVWVMMFVMCLTVVAVTVFIFEYLSPVGYNRSLATGKRP--------------- 619

Query: 153 LVGVVAIQASAFTIFFFEWLSPSGFDMKTTALQPSHRFSLFRTYWLVWAVLFQAAVHIDT 212
                    S FTI                           ++ WL+WA++F  +V ++ 
Sbjct: 620 -------GGSTFTI--------------------------GKSIWLLWALVFNNSVPVEN 646

Query: 213 PKGFTAKFMTNMWAMFAVVFLAIYTANLAAFMITREEFHEFTGVDD 258
           P+G T+K M  +WA FAV+FLA YTANLAAFMI  E     +G+ D
Sbjct: 647 PRGTTSKIMVLVWAFFAVIFLASYTANLAAFMIQEEYVDTVSGLSD 692
NMDA receptor subtype of glutamate-gated ion channels possesses high calcium permeability and voltage-dependent sensitivity to magnesium. Mediated by glycine.
Mus musculus (taxid: 10090)
>sp|Q62645|NMDE4_RAT Glutamate receptor ionotropic, NMDA 2D OS=Rattus norvegicus GN=Grin2d PE=1 SV=2 Back     alignment and function description
>sp|O15399|NMDE4_HUMAN Glutamate receptor ionotropic, NMDA 2D OS=Homo sapiens GN=GRIN2D PE=2 SV=2 Back     alignment and function description
>sp|Q00961|NMDE3_RAT Glutamate receptor ionotropic, NMDA 2C OS=Rattus norvegicus GN=Grin2c PE=1 SV=1 Back     alignment and function description
>sp|Q01097|NMDE2_MOUSE Glutamate receptor ionotropic, NMDA 2B OS=Mus musculus GN=Grin2b PE=1 SV=3 Back     alignment and function description
>sp|Q5R1P3|NMDE2_CANFA Glutamate receptor ionotropic, NMDA 2B OS=Canis familiaris GN=GRIN2B PE=2 SV=1 Back     alignment and function description
>sp|Q00960|NMDE2_RAT Glutamate receptor ionotropic, NMDA 2B OS=Rattus norvegicus GN=Grin2b PE=1 SV=1 Back     alignment and function description
>sp|Q13224|NMDE2_HUMAN Glutamate receptor ionotropic, NMDA 2B OS=Homo sapiens GN=GRIN2B PE=1 SV=3 Back     alignment and function description
>sp|Q01098|NMDE3_MOUSE Glutamate receptor ionotropic, NMDA 2C OS=Mus musculus GN=Grin2c PE=2 SV=2 Back     alignment and function description
>sp|Q14957|NMDE3_HUMAN Glutamate receptor ionotropic, NMDA 2C OS=Homo sapiens GN=GRIN2C PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query261
270004449 1000 hypothetical protein TcasGA2_TC003802 [T 0.704 0.184 0.673 3e-80
380018465 1052 PREDICTED: glutamate [NMDA] receptor sub 0.708 0.175 0.655 2e-79
194763914 1089 GF21362 [Drosophila ananassae] gi|190619 0.708 0.169 0.637 9e-79
3292888 1012 EG:80H7.7 [Drosophila melanogaster] 0.708 0.182 0.637 1e-78
195133877 1145 GI16039 [Drosophila mojavensis] gi|19390 0.708 0.161 0.637 1e-78
195457349 1087 GK14575 [Drosophila willistoni] gi|19417 0.708 0.170 0.637 1e-78
195469758 1089 GE16522 [Drosophila yakuba] gi|194187327 0.708 0.169 0.637 2e-78
195060385 1013 GH17573 [Drosophila grimshawi] gi|193896 0.708 0.182 0.637 2e-78
62473388 1083 NMDA receptor 2, isoform C [Drosophila m 0.708 0.170 0.637 2e-78
195162171 1109 GL14372 [Drosophila persimilis] gi|19410 0.708 0.166 0.637 2e-78
>gi|270004449|gb|EFA00897.1| hypothetical protein TcasGA2_TC003802 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  304 bits (778), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 155/230 (67%), Positives = 173/230 (75%), Gaps = 46/230 (20%)

Query: 32  ENGKWNGLIADLVNRKTDMALTSLVINSRRESVVDFTVPIMETGIAIVVAKRTGIISPTA 91
           ENGKWNGLIADLVNRKTDM LTSL+IN+ RE+VVDF+VP METGIAIVVAKRTGIISPTA
Sbjct: 521 ENGKWNGLIADLVNRKTDMVLTSLMINAEREAVVDFSVPFMETGIAIVVAKRTGIISPTA 580

Query: 92  FLEPFDTASWMLVGVVAIQASAFTIFFFEWLSPSGFDMKISFSYRPLPFLPPEPFDTASW 151
           FLEPFDTASWMLVGVVAIQA+ FTIF FEWLSPSGF+M++S +                 
Sbjct: 581 FLEPFDTASWMLVGVVAIQAATFTIFLFEWLSPSGFNMRLSLNQS--------------- 625

Query: 152 MLVGVVAIQASAFTIFFFEWLSPSGFDMKTTALQPSHRFSLFRTYWLVWAVLFQAAVHID 211
                                +PS           SHRFSLFRTYWLVWAVLFQAAVH+D
Sbjct: 626 ---------------------TPSA----------SHRFSLFRTYWLVWAVLFQAAVHVD 654

Query: 212 TPKGFTAKFMTNMWAMFAVVFLAIYTANLAAFMITREEFHEFTGVDDVRI 261
           +P+GFTA+FMTN+WAMFAVVFLAIYTANLAAFMITREEF EF+G+DD R+
Sbjct: 655 SPRGFTARFMTNVWAMFAVVFLAIYTANLAAFMITREEFFEFSGLDDHRL 704

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|380018465|ref|XP_003693148.1| PREDICTED: glutamate [NMDA] receptor subunit epsilon-2-like [Apis florea] Back     alignment and taxonomy information
>gi|194763914|ref|XP_001964077.1| GF21362 [Drosophila ananassae] gi|190619002|gb|EDV34526.1| GF21362 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|3292888|emb|CAA19838.1| EG:80H7.7 [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195133877|ref|XP_002011365.1| GI16039 [Drosophila mojavensis] gi|193907340|gb|EDW06207.1| GI16039 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|195457349|ref|XP_002075535.1| GK14575 [Drosophila willistoni] gi|194171620|gb|EDW86521.1| GK14575 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|195469758|ref|XP_002099803.1| GE16522 [Drosophila yakuba] gi|194187327|gb|EDX00911.1| GE16522 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|195060385|ref|XP_001995793.1| GH17573 [Drosophila grimshawi] gi|193896579|gb|EDV95445.1| GH17573 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|62473388|ref|NP_001014714.1| NMDA receptor 2, isoform C [Drosophila melanogaster] gi|48095783|gb|AAT40461.1| NMDA receptor subunit 2-2 [Drosophila melanogaster] gi|61677865|gb|AAF45640.2| NMDA receptor 2, isoform C [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195162171|ref|XP_002021929.1| GL14372 [Drosophila persimilis] gi|194103827|gb|EDW25870.1| GL14372 [Drosophila persimilis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query261
FB|FBgn0053513 1083 Nmdar2 "NMDA receptor 2" [Dros 0.467 0.112 0.751 1e-47
WB|WBGene00003775 990 nmr-2 [Caenorhabditis elegans 0.455 0.120 0.491 6.1e-29
UNIPROTKB|F1RKZ8307 GRIN2A "Uncharacterized protei 0.471 0.400 0.401 3.8e-23
ZFIN|ZDB-GENE-070424-223 1445 grin2ab "glutamate receptor, i 0.547 0.098 0.370 1.6e-22
ZFIN|ZDB-GENE-070424-129 1460 grin2aa "glutamate receptor, i 0.471 0.084 0.4 2.2e-22
UNIPROTKB|F1MR40 993 F1MR40 "Uncharacterized protei 0.402 0.105 0.438 3.4e-22
UNIPROTKB|F1P6H3 1126 GRIN2D "Uncharacterized protei 0.402 0.093 0.438 4.1e-22
MGI|MGI:95823 1323 Grin2d "glutamate receptor, io 0.402 0.079 0.438 5.2e-22
RGD|2740 1323 Grin2d "glutamate receptor, io 0.402 0.079 0.438 5.2e-22
UNIPROTKB|Q62645 1323 Grin2d "Glutamate receptor ion 0.402 0.079 0.438 5.2e-22
FB|FBgn0053513 Nmdar2 "NMDA receptor 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 509 (184.2 bits), Expect = 1.0e-47, P = 1.0e-47
 Identities = 97/129 (75%), Positives = 113/129 (87%)

Query:   137 PLPFLPPEPFDTASWMLVGVVAIQASAFTIFFFEWLSPSGFDMK----TTALQPSHRFSL 192
             P  FL  EPFDTASWMLVG+VAIQA+ F IF FEWLSPSG+DMK     T + P +RFSL
Sbjct:   653 PTAFL--EPFDTASWMLVGIVAIQAATFMIFLFEWLSPSGYDMKLYLQNTNVTP-YRFSL 709

Query:   193 FRTYWLVWAVLFQAAVHIDTPKGFTAKFMTNMWAMFAVVFLAIYTANLAAFMITREEFHE 252
             FRTYWLVWAVLFQAAVH+D+P+GFT++FMTN+WA+FAVVFLAIYTANLAAFMITREEFHE
Sbjct:   710 FRTYWLVWAVLFQAAVHVDSPRGFTSRFMTNVWALFAVVFLAIYTANLAAFMITREEFHE 769

Query:   253 FTGVDDVRI 261
             F+G++D R+
Sbjct:   770 FSGLNDSRL 778
GO:0004972 "N-methyl-D-aspartate selective glutamate receptor activity" evidence=ISS;IDA
GO:0006811 "ion transport" evidence=IEA
GO:0030288 "outer membrane-bounded periplasmic space" evidence=IEA
GO:0005234 "extracellular-glutamate-gated ion channel activity" evidence=IEA
GO:0035235 "ionotropic glutamate receptor signaling pathway" evidence=IDA
GO:0008328 "ionotropic glutamate receptor complex" evidence=IPI
GO:0016021 "integral to membrane" evidence=IDA
GO:0072375 "medium-term memory" evidence=IMP
GO:0007616 "long-term memory" evidence=IGI;IMP
GO:0050975 "sensory perception of touch" evidence=IMP
WB|WBGene00003775 nmr-2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|F1RKZ8 GRIN2A "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070424-223 grin2ab "glutamate receptor, ionotropic, N-methyl D-aspartate 2A, b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070424-129 grin2aa "glutamate receptor, ionotropic, N-methyl D-aspartate 2A, a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1MR40 F1MR40 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1P6H3 GRIN2D "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:95823 Grin2d "glutamate receptor, ionotropic, NMDA2D (epsilon 4)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|2740 Grin2d "glutamate receptor, ionotropic, N-methyl D-aspartate 2D" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q62645 Grin2d "Glutamate receptor ionotropic, NMDA 2D" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query261
pfam00060 268 pfam00060, Lig_chan, Ligand-gated ion channel 2e-24
pfam00497220 pfam00497, SBP_bac_3, Bacterial extracellular solu 1e-08
cd00134218 cd00134, PBPb, Bacterial periplasmic transport sys 1e-07
smart00062219 smart00062, PBPb, Bacterial periplasmic substrate- 2e-05
TIGR01096250 TIGR01096, 3A0103s03R, lysine-arginine-ornithine-b 2e-05
COG0834275 COG0834, HisJ, ABC-type amino acid transport/signa 7e-05
>gnl|CDD|215685 pfam00060, Lig_chan, Ligand-gated ion channel Back     alignment and domain information 
 Score = 97.7 bits (244), Expect = 2e-24
 Identities = 25/108 (23%), Positives = 47/108 (43%), Gaps = 5/108 (4%)

Query: 151 WMLVGVVAIQASAFTIFFFEWLSPSGFDMKTTALQPSHRFSLFRTYWLVWAVLFQAAVHI 210
           W+ +    +      +F  E  SP  +          ++F+L  + W  +  L Q   H 
Sbjct: 3   WLCILAAYLL-VGVVLFLLERFSPYEWRGPPEE---PNQFTLSNSLWFSFGALVQQG-HR 57

Query: 211 DTPKGFTAKFMTNMWAMFAVVFLAIYTANLAAFMITREEFHEFTGVDD 258
           + P+  + + +  +W  FA++ L+ YTANLAAF+           ++D
Sbjct: 58  ELPRSLSGRILVGVWWFFALILLSSYTANLAAFLTVERMQSPIQSLED 105

This family includes the four transmembrane regions of the ionotropic glutamate receptors and NMDA receptors. Length = 268
>gnl|CDD|215950 pfam00497, SBP_bac_3, Bacterial extracellular solute-binding proteins, family 3 Back     alignment and domain information
>gnl|CDD|238078 cd00134, PBPb, Bacterial periplasmic transport systems use membrane-bound complexes and substrate-bound, membrane-associated, periplasmic binding proteins (PBPs) to transport a wide variety of substrates, such as, amino acids, peptides, sugars, vitamins and inorganic ions Back     alignment and domain information
>gnl|CDD|214497 smart00062, PBPb, Bacterial periplasmic substrate-binding proteins Back     alignment and domain information
>gnl|CDD|233269 TIGR01096, 3A0103s03R, lysine-arginine-ornithine-binding periplasmic protein Back     alignment and domain information
>gnl|CDD|223904 COG0834, HisJ, ABC-type amino acid transport/signal transduction systems, periplasmic component/domain [Amino acid transport and metabolism / Signal transduction mechanisms] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 261
KOG1054|consensus 897 100.0
KOG1053|consensus 1258 100.0
KOG4440|consensus 993 100.0
KOG1052|consensus 656 99.97
PF00060148 Lig_chan: Ligand-gated ion channel; InterPro: IPR0 99.66
PRK10797302 glutamate and aspartate transporter subunit; Provi 98.28
PRK11917259 bifunctional adhesin/ABC transporter aspartate/glu 98.16
COG0834275 HisJ ABC-type amino acid transport/signal transduc 97.99
PF1061365 Lig_chan-Glu_bd: Ligated ion channel L-glutamate- 97.99
PF00497225 SBP_bac_3: Bacterial extracellular solute-binding 97.91
PRK15437259 histidine ABC transporter substrate-binding protei 97.89
PRK09495247 glnH glutamine ABC transporter periplasmic protein 97.88
PRK15010260 ABC transporter lysine/arginine/ornithine binding 97.82
TIGR03870246 ABC_MoxJ methanol oxidation system protein MoxJ. T 97.73
TIGR02995275 ectoine_ehuB ectoine/hydroxyectoine ABC transporte 97.71
PRK15007243 putative ABC transporter arginine-biding protein; 97.63
PRK10859 482 membrane-bound lytic transglycosylase F; Provision 97.6
PRK00489287 hisG ATP phosphoribosyltransferase; Reviewed 97.35
PRK11260266 cystine transporter subunit; Provisional 97.32
TIGR02285268 conserved hypothetical protein. Members of this fa 97.29
TIGR01096250 3A0103s03R lysine-arginine-ornithine-binding perip 97.27
PRK09959 1197 hybrid sensory histidine kinase in two-component r 97.24
cd00134218 PBPb Bacterial periplasmic transport systems use m 96.63
TIGR03871232 ABC_peri_MoxJ_2 quinoprotein dehydrogenase-associa 96.53
smart00062219 PBPb Bacterial periplasmic substrate-binding prote 96.49
PF0788579 Ion_trans_2: Ion channel; InterPro: IPR013099 This 95.76
PRK09959 1197 hybrid sensory histidine kinase in two-component r 95.39
KOG1053|consensus 1258 94.55
COG4623 473 Predicted soluble lytic transglycosylase fused to 94.22
TIGR01098254 3A0109s03R phosphate/phosphite/phosphonate ABC tra 93.39
TIGR03431288 PhnD phosphonate ABC transporter, periplasmic phos 89.47
KOG1419|consensus 654 88.11
PRK11553314 alkanesulfonate transporter substrate-binding subu 80.91
>KOG1054|consensus Back     alignment and domain information 
Probab=100.00  E-value=4.4e-42  Score=316.81  Aligned_cols=206  Identities=25%  Similarity=0.519  Sum_probs=183.3

Q ss_pred             hHhhhhcCcEEEEEEecCCceeEe-eCCc-hhhHHHHHhcCceeEEEeCCCCChhhhhhccccccccccceEEEEEccC-
Q psy13439          8 HESLKKKRKLLTVYLHSKNEVLSV-ENGK-WNGLIADLVNRKTDMALTSLVINSRRESVVDFTVPIMETGIAIVVAKRT-   84 (261)
Q Consensus         8 ~e~l~k~~~~~~~~~~~~~~~g~~-~~~~-~~gli~~L~~g~~Di~i~~i~it~eR~~~vdfS~py~~~~~~~lv~~~~-   84 (261)
                      .|..|+-+.-|++....||++|.. .+++ |+||++.|..|++|+++++++||.+|.+.+|||.|++..++.+++++|. 
T Consensus       454 ~~iAkhi~~~Y~l~iv~dgkyGardaD~k~WnGMvGeLv~grAdiavApLTIt~~REeviDFSKPfMslGISIMIKKPqK  533 (897)
T KOG1054|consen  454 AEIAKHIGIKYKLFIVGDGKYGARDADTKIWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQK  533 (897)
T ss_pred             HHHHHhcCceEEEEEecCCcccccCCCcccccchhHHHhcCccceEEeeeeeehhhhhhhccccchhhcCeEEEEeCccc
Confidence            344556667799999999999997 6777 9999999999999999999999999999999999999999999999996 


Q ss_pred             CCCCcccccCCCCcccccceehhhhHHHHHHHHHHHHhCCCCCcccccccCCCCCCCCCCCCCcchhhhhhhhhhhhcch
Q psy13439         85 GIISPTAFLEPFDTASWMLVGVVAIQASAFTIFFFEWLSPSGFDMKISFSYRPLPFLPPEPFDTASWMLVGVVAIQASAF  164 (261)
Q Consensus        85 ~~~~~~~~l~pF~~~vW~~i~~~~l~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  164 (261)
                      +..+.++|++|+...+|++++... ++++.++++..|++|++                                      
T Consensus       534 sk~gVFSFldPLa~eIWm~ivfaY-iGVSvvlFLVSrFSPYE--------------------------------------  574 (897)
T KOG1054|consen  534 SKPGVFSFLDPLAYEIWMCIVFAY-IGVSVVLFLVSRFSPYE--------------------------------------  574 (897)
T ss_pred             CCCCeeeecchhHHHHHHHHHHHH-hcceEEEEEEeccCchh--------------------------------------
Confidence            567889999999999999998754 46667889999999854                                      


Q ss_pred             hhhhhhccCCCCCCCcccCCCCCCCCcchhhHHHHHHHHHhcccCCCCCCchhhHHHHHHHHHHHHHHHHhhcccceeee
Q psy13439        165 TIFFFEWLSPSGFDMKTTALQPSHRFSLFRTYWLVWAVLFQAAVHIDTPKGFTAKFMTNMWAMFAVVFLAIYTANLAAFM  244 (261)
Q Consensus       165 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~l~~qg~~~~~p~s~s~Ril~~~w~l~~lil~~~Yta~L~s~L  244 (261)
                            |+.....+++..+....+.|+++||+||++++++|||+++ +|++.|+||+.++||||++|++++|||||||||
T Consensus       575 ------wh~Ee~~rg~~t~~~~~NeFgifNsLWFsLgAFMQQG~DI-~PRslSGRIvggvWWFFTlIIiSSYTANLAAFL  647 (897)
T KOG1054|consen  575 ------WHTEEFERGRFTPSDPPNEFGIFNSLWFSLGAFMQQGCDI-SPRSLSGRIVGGVWWFFTLIIISSYTANLAAFL  647 (897)
T ss_pred             ------eeccccccCCCCCCCCCccchhhHHHHHHHHHHHhcCCCC-CccccccceeccchhhhhhhhhhhhhhHHHHHH
Confidence                  4444443444344467789999999999999999999999 999999999999999999999999999999999


Q ss_pred             eccccccccCCccCC
Q psy13439        245 ITREEFHEFTGVDDV  259 (261)
Q Consensus       245 t~~~~~~~i~sl~Dl  259 (261)
                      |.++..+||.|.+||
T Consensus       648 TvErMvsPIESaEDL  662 (897)
T KOG1054|consen  648 TVERMVSPIESAEDL  662 (897)
T ss_pred             hHHhhcCcchhHHHH
Confidence            999999999999998

>KOG1053|consensus Back     alignment and domain information
>KOG4440|consensus Back     alignment and domain information
>KOG1052|consensus Back     alignment and domain information
>PF00060 Lig_chan: Ligand-gated ion channel; InterPro: IPR001320 The ability of synapses to modify their synaptic strength in response to activity is a fundamental property of the nervous system and may be an essential component of learning and memory Back     alignment and domain information
>PRK10797 glutamate and aspartate transporter subunit; Provisional Back     alignment and domain information
>PRK11917 bifunctional adhesin/ABC transporter aspartate/glutamate-binding protein; Reviewed Back     alignment and domain information
>COG0834 HisJ ABC-type amino acid transport/signal transduction systems, periplasmic component/domain [Amino acid transport and metabolism / Signal transduction mechanisms] Back     alignment and domain information
>PF10613 Lig_chan-Glu_bd: Ligated ion channel L-glutamate- and glycine-binding site; InterPro: IPR019594 This entry, sometimes called the S1 domain, is the luminal domain just upstream of the first, M1, transmembrane region of transmembrane ion-channel proteins, and binds L-glutamate and glycine [, ] Back     alignment and domain information
>PF00497 SBP_bac_3: Bacterial extracellular solute-binding proteins, family 3; InterPro: IPR001638 Bacterial high affinity transport systems are involved in active transport of solutes across the cytoplasmic membrane Back     alignment and domain information
>PRK15437 histidine ABC transporter substrate-binding protein HisJ; Provisional Back     alignment and domain information
>PRK09495 glnH glutamine ABC transporter periplasmic protein; Reviewed Back     alignment and domain information
>PRK15010 ABC transporter lysine/arginine/ornithine binding periplasmic protein; Provisional Back     alignment and domain information
>TIGR03870 ABC_MoxJ methanol oxidation system protein MoxJ Back     alignment and domain information
>TIGR02995 ectoine_ehuB ectoine/hydroxyectoine ABC transporter solute-binding protein Back     alignment and domain information
>PRK15007 putative ABC transporter arginine-biding protein; Provisional Back     alignment and domain information
>PRK10859 membrane-bound lytic transglycosylase F; Provisional Back     alignment and domain information
>PRK00489 hisG ATP phosphoribosyltransferase; Reviewed Back     alignment and domain information
>PRK11260 cystine transporter subunit; Provisional Back     alignment and domain information
>TIGR02285 conserved hypothetical protein Back     alignment and domain information
>TIGR01096 3A0103s03R lysine-arginine-ornithine-binding periplasmic protein Back     alignment and domain information
>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>cd00134 PBPb Bacterial periplasmic transport systems use membrane-bound complexes and substrate-bound, membrane-associated, periplasmic binding proteins (PBPs) to transport a wide variety of substrates, such as, amino acids, peptides, sugars, vitamins and inorganic ions Back     alignment and domain information
>TIGR03871 ABC_peri_MoxJ_2 quinoprotein dehydrogenase-associated probable ABC transporter substrate-binding protein Back     alignment and domain information
>smart00062 PBPb Bacterial periplasmic substrate-binding proteins Back     alignment and domain information
>PF07885 Ion_trans_2: Ion channel; InterPro: IPR013099 This entry includes the two membrane helix type ion channels found in bacteria [] Back     alignment and domain information
>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>KOG1053|consensus Back     alignment and domain information
>COG4623 Predicted soluble lytic transglycosylase fused to an ABC-type amino acid-binding protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR01098 3A0109s03R phosphate/phosphite/phosphonate ABC transporters, periplasmic binding protein Back     alignment and domain information
>TIGR03431 PhnD phosphonate ABC transporter, periplasmic phosphonate binding protein Back     alignment and domain information
>KOG1419|consensus Back     alignment and domain information
>PRK11553 alkanesulfonate transporter substrate-binding subunit; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query261
3kg2_A 823 Ampa Subtype Ionotropic Glutamate Receptor In Compl 4e-14
3oek_A286 Crystal Structure Of Glun2d Ligand-Binding Core In 3e-10
2a5s_A284 Crystal Structure Of The Nr2a Ligand Binding Core I 9e-10
2i0c_A259 Crystal Structure Of The Glur6 Ligand Binding Core 9e-09
3g3k_A259 Crystal Structure Of The Glur6 Ligand Binding Domai 1e-08
3g3j_A259 Crystal Structure Of The Glur6 Ligand Binding Domai 1e-08
3g3i_A259 Crystal Structure Of The Glur6 Ligand Binding Domai 1e-08
2rca_B292 Crystal Structure Of The Nr3b Ligand Binding Core C 1e-08
3qxm_A258 Crystal Structure Of Human Gluk2 Ligand-Binding Cor 1e-08
3g3h_A259 Crystal Structure Of The Glur6 Ligand Binding Domai 1e-08
3g3g_A259 Crystal Structure Of The Glur6 Ligand Binding Domai 1e-08
2i0b_A259 Crystal Structure Of The Glur6 Ligand Binding Core 1e-08
2xxr_A261 Crystal Structure Of The Gluk2 (Glur6) Wild-Type Lb 1e-08
2xxw_A261 Crystal Structure Of The Gluk2 (Glur6) D776k Lbd Di 1e-08
2xxu_A261 Crystal Structure Of The Gluk2 (Glur6) M770k Lbd Di 1e-08
1s50_A259 X-Ray Structure Of The Glur6 Ligand Binding Core (S 2e-08
1yae_A312 Structure Of The Kainate Receptor Subunit Glur6 Ago 5e-08
2rc7_A294 Crystal Structure Of The Nr3a Ligand Binding Core C 6e-08
3s9e_A258 Crystal Structure Of The Kainate Receptor Gluk3 Lig 1e-07
3u92_A257 Crystal Structure Of The Gluk3 Ligand Binding Domai 1e-07
2v3u_A265 Structure Of The Ligand-binding Core Of The Ionotro 2e-07
2wky_A258 Crystal Structure Of The Ligand-Binding Core Of Glu 2e-07
2f34_A258 Crystal Structure Of The Glur5 Ligand Binding Core 2e-07
1ycj_A257 Crystal Structure Of The Kainate Receptor Glur5 Lig 2e-07
1txf_A258 Crystal Structure Of The Glur5 Ligand Binding Core 2e-07
2zns_A256 Crystal Structure Of The Ligand-Binding Core Of The 2e-07
3t9x_B258 Glutamate Bound To A Double Cysteine Mutant (V484cE 7e-07
3tdj_A263 Crystal Structure Of The Glua2 Ligand-Binding Domai 7e-07
1lb8_A263 Crystal Structure Of The Non-Desensitizing Glur2 Li 7e-07
3t93_B258 Glutamate Bound To A Double Cysteine Mutant (A452cS 7e-07
1p1w_A263 Crystal Structure Of The Glur2 Ligand-Binding Core 7e-07
3o28_A263 Ligand-Binding Domain Of Glua2 (Flip) Ionotropic Gl 8e-07
3o29_A263 Ligand-Binding Domain Of Glua2 (Flip) Ionotropic Gl 8e-07
2xhd_A263 Crystal Structure Of N-((2s)-5-(6-Fluoro-3-Pyridiny 9e-07
3ijo_B258 Crystal Structure Of The Ampa Subunit Glur2 Bound T 9e-07
3h03_A258 Crystal Structure Of The Binding Domain Of The Ampa 9e-07
2uxa_A261 Crystal Structure Of The Glur2-Flip Ligand Binding 9e-07
3b6t_A263 Crystal Structure Of The Glur2 Ligand Binding Core 9e-07
2i3w_A259 Measurement Of Conformational Changes Accompanying 9e-07
2i3v_A259 Measurement Of Conformational Changes Accompanying 9e-07
1lbc_A263 Crystal Structure Of Glur2 Ligand Binding Core (S1s 1e-06
3b6w_C263 Crystal Structure Of The Glur2 Ligand Binding Core 1e-06
1lbb_A263 Crystal Structure Of The Glur2 Ligand Binding Domai 1e-06
1fw0_A263 Crystal Structure Of The Glur2 Ligand Binding Core 1e-06
1mqh_A263 Crystal Structure Of The Glur2 Ligand Binding Core 1e-06
1m5d_A263 X-ray Structure Of The Glur2 Ligand Binding Core (s 1e-06
1p1n_A263 Glur2 Ligand Binding Core (S1s2j) Mutant L650t In C 1e-06
3r7x_A263 Crystal Structure Analysis Of A Quinazolinedione Su 1e-06
1mqd_A261 X-Ray Structure Of The Glur2 Ligand-Binding Core (S 1e-06
3pd9_A260 X-Ray Structure Of The Ligand-Binding Core Of Glua2 1e-06
3pd8_A261 X-Ray Structure Of The Ligand-Binding Core Of Glua2 1e-06
2gfe_A262 Crystal Structure Of The Glur2 A476e S673d Ligand B 1e-06
2anj_A263 Crystal Structure Of The Glur2 Ligand Binding Core 1e-06
2xx7_A291 Crystal Structure Of 1-(4-(1-Pyrrolidinylcarbonyl)p 1e-06
2v3t_A265 Structure Of The Ligand-Binding Core Of The Ionotro 1e-06
3rn8_A280 Crystal Structure Of Iglur2 Ligand Binding Domain A 1e-06
3dp6_A279 Crystal Structure Of The Binding Domain Of The Ampa 1e-06
3rnn_A292 Crystal Structure Of Iglur2 Ligand Binding Domain W 1e-06
4f2o_A258 Quisqualate Bound To The D655a Mutant Of The Ligand 2e-06
4f22_A258 Kainate Bound To The K660a Mutant Of The Ligand Bin 2e-06
3lsw_A258 Aniracetam Bound To The Ligand Binding Domain Of Gl 2e-06
3m3f_A258 Pepa Bound To The Ligand Binding Domain Of Glua3 (F 2e-06
3dp4_A278 Crystal Structure Of The Binding Domain Of The Ampa 2e-06
3en3_A257 Crystal Structure Of The Glur4 Ligand-Binding Domai 3e-06
3kei_A257 Crystal Structure Of The Glua4 Ligand-Binding Domai 3e-06
3fat_A260 X-Ray Structure Of Iglur4 Flip Ligand-Binding Core 3e-06
1gr2_A279 Structure Of A Glutamate Receptor Ligand Binding Co 4e-06
1pb8_A292 Crystal Structure Of The Nr1 Ligand Binding Core In 8e-05
1pb7_A292 Crystal Structure Of The Nr1 Ligand Binding Core In 8e-05
>pdb|3KG2|A Chain A, Ampa Subtype Ionotropic Glutamate Receptor In Complex With Competitive Antagonist Zk 200775 Length = 823 Back     alignment and structure 
Iteration: 1

 Score = 75.1 bits (183), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 59/243 (24%), Positives = 98/243 (40%), Gaps = 57/243 (23%)
Query: 7   QHESLKKKRKLLTVYLHSKNEVLSVENGKWNGLIADLVNRKTDMALTSLVINSRRESVVD 66
           +H   K K   LT+    K      +   WNG++ +LV  K D+A+  L I   RE V+D
Sbjct: 425 KHCGFKYK---LTIVGDGKYGARDADTKIWNGMVGELVYGKADIAIAPLTITLVREEVID 481
Query: 67  FTVPIMETGIAIVVAK----RTGIISPTAFLEPFDTASWMLVGVVAIQASAFTIFFFEWL 122
           F+ P M  GI+I++ K    + G+ S   FL+P     WM + V A    +  +F     
Sbjct: 482 FSKPFMSLGISIMIKKPQKSKPGVFS---FLDPLAYEIWMCI-VFAYIGVSVVLFLVSRF 537
Query: 123 SPSGFDMKISFSYRPLPFLPPEPFDTASWMLVGVVAIQASAFTIFFFEWLSPSGFDMK-T 181
           SP                                            +EW +    D + T
Sbjct: 538 SP--------------------------------------------YEWHTEEFEDGRET 553
Query: 182 TALQPSHRFSLFRTYWLVWAVLFQAAVHIDTPKGFTAKFMTNMWAMFAVVFLAIYTANLA 241
            + + ++ F +F + W       Q    I +P+  + + +  +W  F ++ ++ YTANLA
Sbjct: 554 QSSESTNEFGIFNSLWFSLGAFMQQGADI-SPRSLSGRIVGGVWWFFTLIIISSYTANLA 612
Query: 242 AFM 244
           AF+
Sbjct: 613 AFL 615
>pdb|3OEK|A Chain A, Crystal Structure Of Glun2d Ligand-Binding Core In Complex With L- Aspartate Length = 286 Back     alignment and structure
>pdb|2A5S|A Chain A, Crystal Structure Of The Nr2a Ligand Binding Core In Complex With Glutamate Length = 284 Back     alignment and structure
>pdb|2I0C|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Core Dimer Crosslinked By Disulfide Bonds Between Y490c And L752c At 2.25 Angstroms Resolution Length = 259 Back     alignment and structure
>pdb|3G3K|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Domain Dimer I442h K494e K665r I749l Q753k E757q Mutant With Glutamate And Nacl At 1.24 Angstrom Resolution Length = 259 Back     alignment and structure
>pdb|3G3J|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Domain Dimer I442h K494e K665r I749l Q753k Mutant With Glutamate And Nacl At 1.32 Angstrom Resolution Length = 259 Back     alignment and structure
>pdb|3G3I|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Domain Dimer I442h K494e I749l Q753k Mutant With Glutamate And Nacl At 1.37 Angstrom Resolution Length = 259 Back     alignment and structure
>pdb|2RCA|B Chain B, Crystal Structure Of The Nr3b Ligand Binding Core Complex With Glycine At 1.58 Angstrom Resolution Length = 292 Back     alignment and structure
>pdb|3QXM|A Chain A, Crystal Structure Of Human Gluk2 Ligand-Binding Core In Complex With Novel Marine-Derived Toxins, Neodysiherbaine A Length = 258 Back     alignment and structure
>pdb|3G3H|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Domain Dimer K665r I749l Q753k Mutant With Glutamate And Nacl At 1.5 Angstrom Resolution Length = 259 Back     alignment and structure
>pdb|3G3G|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Domain Dimer K665r Mutant With Glutamate And Nacl At 1.3 Angstrom Resolution Length = 259 Back     alignment and structure
>pdb|2I0B|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Core Elkq Mutant Dimer At 1.96 Angstroms Resolution Length = 259 Back     alignment and structure
>pdb|2XXR|A Chain A, Crystal Structure Of The Gluk2 (Glur6) Wild-Type Lbd Dimer In Complex With Glutamate Length = 261 Back     alignment and structure
>pdb|2XXW|A Chain A, Crystal Structure Of The Gluk2 (Glur6) D776k Lbd Dimer In Complex With Glutamate Length = 261 Back     alignment and structure
>pdb|2XXU|A Chain A, Crystal Structure Of The Gluk2 (Glur6) M770k Lbd Dimer In Complex With Glutamate Length = 261 Back     alignment and structure
>pdb|1S50|A Chain A, X-Ray Structure Of The Glur6 Ligand Binding Core (S1s2a) In Complex With Glutamate At 1.65 A Resolution Length = 259 Back     alignment and structure
>pdb|1YAE|A Chain A, Structure Of The Kainate Receptor Subunit Glur6 Agonist Binding Domain Complexed With Domoic Acid Length = 312 Back     alignment and structure
>pdb|2RC7|A Chain A, Crystal Structure Of The Nr3a Ligand Binding Core Complex With Glycine At 1.58 Angstrom Resolution Length = 294 Back     alignment and structure
>pdb|3S9E|A Chain A, Crystal Structure Of The Kainate Receptor Gluk3 Ligand Binding Domain In Complex With (S)-Glutamate Length = 258 Back     alignment and structure
>pdb|3U92|A Chain A, Crystal Structure Of The Gluk3 Ligand Binding Domain Complex With Kainate And Zinc: P2221 Form Length = 257 Back     alignment and structure
>pdb|2V3U|A Chain A, Structure Of The Ligand-binding Core Of The Ionotropic Glutamate Receptor-like Glurdelta2 In Complex With D- Serine Length = 265 Back     alignment and structure
>pdb|2WKY|A Chain A, Crystal Structure Of The Ligand-Binding Core Of Glur5 In Complex With The Agonist 4-Ahcp Length = 258 Back     alignment and structure
>pdb|2F34|A Chain A, Crystal Structure Of The Glur5 Ligand Binding Core Dimer With Ubp310 At 1.74 Angstroms Resolution Length = 258 Back     alignment and structure
>pdb|1YCJ|A Chain A, Crystal Structure Of The Kainate Receptor Glur5 Ligand- Binding Core In Complex With (S)-Glutamate Length = 257 Back     alignment and structure
>pdb|1TXF|A Chain A, Crystal Structure Of The Glur5 Ligand Binding Core In Complex With Glutamate At 2.1 Angstrom Resolution Length = 258 Back     alignment and structure
>pdb|2ZNS|A Chain A, Crystal Structure Of The Ligand-Binding Core Of The Human Ionotropic Glutamate Receptor, Glur5, In Complex With Glutamate Length = 256 Back     alignment and structure
>pdb|3T9X|B Chain B, Glutamate Bound To A Double Cysteine Mutant (V484cE657C) OF THE Ligand Binding Domain Of Glua2 Length = 258 Back     alignment and structure
>pdb|3TDJ|A Chain A, Crystal Structure Of The Glua2 Ligand-Binding Domain (S1s2j-L483y- N754s) In Complex With Glutamate And Bpam-97 At 1.95 A Resolution Length = 263 Back     alignment and structure
>pdb|1LB8|A Chain A, Crystal Structure Of The Non-Desensitizing Glur2 Ligand Binding Core Mutant (S1s2j-L483y) In Complex With Ampa At 2.3 Resolution Length = 263 Back     alignment and structure
>pdb|3T93|B Chain B, Glutamate Bound To A Double Cysteine Mutant (A452cS652C) OF THE Ligand Binding Domain Of Glua2 Length = 258 Back     alignment and structure
>pdb|1P1W|A Chain A, Crystal Structure Of The Glur2 Ligand-Binding Core (S1s2j) With The L483y And L650t Mutations And In Complex With Ampa Length = 263 Back     alignment and structure
>pdb|3O28|A Chain A, Ligand-Binding Domain Of Glua2 (Flip) Ionotropic Glutamate Receptor In Complex With An Allosteric Modulator Length = 263 Back     alignment and structure
>pdb|3O29|A Chain A, Ligand-Binding Domain Of Glua2 (Flip) Ionotropic Glutamate Receptor In Complex With An Allosteric Modulator Length = 263 Back     alignment and structure
>pdb|2XHD|A Chain A, Crystal Structure Of N-((2s)-5-(6-Fluoro-3-Pyridinyl)-2,3- Dihydro-1h-Inden-2-Yl)-2-Propanesulfonamide In Complex With The Ligand Binding Domain Of The Human Glua2 Receptor Length = 263 Back     alignment and structure
>pdb|3IJO|B Chain B, Crystal Structure Of The Ampa Subunit Glur2 Bound To The Allosteric Modulator, Althiazide Length = 258 Back     alignment and structure
>pdb|3H03|A Chain A, Crystal Structure Of The Binding Domain Of The Ampa Subunit Glur2 Bound To Ubp277 Length = 258 Back     alignment and structure
>pdb|2UXA|A Chain A, Crystal Structure Of The Glur2-Flip Ligand Binding Domain, RG UNEDITED. Length = 261 Back     alignment and structure
>pdb|3B6T|A Chain A, Crystal Structure Of The Glur2 Ligand Binding Core (S1s2j) T686a Mutant In Complex With Quisqualate At 2.1 Resolution Length = 263 Back     alignment and structure
>pdb|2I3W|A Chain A, Measurement Of Conformational Changes Accompanying Desensitization In An Ionotropic Glutamate Receptor: Structure Of S729c Mutant Length = 259 Back     alignment and structure
>pdb|2I3V|A Chain A, Measurement Of Conformational Changes Accompanying Desensitization In An Ionotropic Glutamate Receptor: Structure Of G725c Mutant Length = 259 Back     alignment and structure
>pdb|1LBC|A Chain A, Crystal Structure Of Glur2 Ligand Binding Core (S1s2j- N775s) In Complex With Cyclothiazide (Ctz) As Well As Glutamate At 1.8 A Resolution Length = 263 Back     alignment and structure
>pdb|3B6W|C Chain C, Crystal Structure Of The Glur2 Ligand Binding Core (S1s2j) T686s Mutant In Complex With Glutamate At 1.7 Resolution Length = 263 Back     alignment and structure
>pdb|1LBB|A Chain A, Crystal Structure Of The Glur2 Ligand Binding Domain Mutant (s1s2j-n754d) In Complex With Kainate At 2.1 A Resolution Length = 263 Back     alignment and structure
>pdb|1FW0|A Chain A, Crystal Structure Of The Glur2 Ligand Binding Core (S1s2j) In Complex With Kainate At 2.0 A Resolution Length = 263 Back     alignment and structure
>pdb|1MQH|A Chain A, Crystal Structure Of The Glur2 Ligand Binding Core (S1s2j) In Complex With Bromo-Willardiine At 1.8 Angstroms Resolution Length = 263 Back     alignment and structure
>pdb|1M5D|A Chain A, X-ray Structure Of The Glur2 Ligand Binding Core (s1s2j- Y702f) In Complex With Br-hibo At 1.73 A Resolution Length = 263 Back     alignment and structure
>pdb|1P1N|A Chain A, Glur2 Ligand Binding Core (S1s2j) Mutant L650t In Complex With Kainate Length = 263 Back     alignment and structure
>pdb|3R7X|A Chain A, Crystal Structure Analysis Of A Quinazolinedione Sulfonamide Bound To Human Glur2: A Novel Class Of Competitive Ampa Receptor Antagonists With Oral Activity Length = 263 Back     alignment and structure
>pdb|1MQD|A Chain A, X-Ray Structure Of The Glur2 Ligand-Binding Core (S1s2j) In Complex With (S)-Des-Me-Ampa At 1.46 A Resolution. Crystallization In The Presence Of Lithium Sulfate. Length = 261 Back     alignment and structure
>pdb|3PD9|A Chain A, X-Ray Structure Of The Ligand-Binding Core Of Glua2 In Complex With (R)-5-Hpca At 2.1 A Resolution Length = 260 Back     alignment and structure
>pdb|3PD8|A Chain A, X-Ray Structure Of The Ligand-Binding Core Of Glua2 In Complex With (S)-7-Hpca At 2.5 A Resolution Length = 261 Back     alignment and structure
>pdb|2GFE|A Chain A, Crystal Structure Of The Glur2 A476e S673d Ligand Binding Core Mutant At 1.54 Angstroms Resolution Length = 262 Back     alignment and structure
>pdb|2ANJ|A Chain A, Crystal Structure Of The Glur2 Ligand Binding Core (S1s2j- Y450w) Mutant In Complex With The Partial Agonist Kainic Acid At 2.1 A Resolution Length = 263 Back     alignment and structure
>pdb|2XX7|A Chain A, Crystal Structure Of 1-(4-(1-Pyrrolidinylcarbonyl)phenyl)-3- (Trifluoromethyl)-4,5,6,7-Tetrahydro-1h-Indazole In Complex With The Ligand Binding Domain Of The Rat Glua2 Receptor And Glutamate At 2.2a Resolution. Length = 291 Back     alignment and structure
>pdb|2V3T|A Chain A, Structure Of The Ligand-Binding Core Of The Ionotropic Glutamate Receptor-Like Glurdelta2 In The Apo Form Length = 265 Back     alignment and structure
>pdb|3RN8|A Chain A, Crystal Structure Of Iglur2 Ligand Binding Domain And Symmetrical Carboxyl Containing Potentiator Length = 280 Back     alignment and structure
>pdb|3DP6|A Chain A, Crystal Structure Of The Binding Domain Of The Ampa Subunit Glur2 Bound To Glutamate Length = 279 Back     alignment and structure
>pdb|3RNN|A Chain A, Crystal Structure Of Iglur2 Ligand Binding Domain With Symmetric Sulfonamide Containing Potentiator Length = 292 Back     alignment and structure
>pdb|4F2O|A Chain A, Quisqualate Bound To The D655a Mutant Of The Ligand Binding Domain Of Glua3 Length = 258 Back     alignment and structure
>pdb|4F22|A Chain A, Kainate Bound To The K660a Mutant Of The Ligand Binding Domain Of Glua3 Length = 258 Back     alignment and structure
>pdb|3LSW|A Chain A, Aniracetam Bound To The Ligand Binding Domain Of Glua3 Length = 258 Back     alignment and structure
>pdb|3M3F|A Chain A, Pepa Bound To The Ligand Binding Domain Of Glua3 (Flop Form) Length = 258 Back     alignment and structure
>pdb|3DP4|A Chain A, Crystal Structure Of The Binding Domain Of The Ampa Subunit Glur3 Bound To Ampa Length = 278 Back     alignment and structure
>pdb|3EN3|A Chain A, Crystal Structure Of The Glur4 Ligand-Binding Domain In Complex With Kainate Length = 257 Back     alignment and structure
>pdb|3KEI|A Chain A, Crystal Structure Of The Glua4 Ligand-Binding Domain L651v Mutant In Complex With Glutamate Length = 257 Back     alignment and structure
>pdb|3FAT|A Chain A, X-Ray Structure Of Iglur4 Flip Ligand-Binding Core (S1s2) In Complex With (S)-Ampa At 1.90a Resolution Length = 260 Back     alignment and structure
>pdb|1GR2|A Chain A, Structure Of A Glutamate Receptor Ligand Binding Core (Glur2) Complexed With Kainate Length = 279 Back     alignment and structure
>pdb|1PB8|A Chain A, Crystal Structure Of The Nr1 Ligand Binding Core In Complex With D-Serine At 1.45 Angstroms Resolution Length = 292 Back     alignment and structure
>pdb|1PB7|A Chain A, Crystal Structure Of The Nr1 Ligand Binding Core In Complex With Glycine At 1.35 Angstroms Resolution Length = 292 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query261
3kg2_A 823 Glutamate receptor 2; ION channel, membrane protei 3e-33
2rc8_A294 Glutamate [NMDA] receptor subunit 3A; membrane pro 2e-15
2a5s_A284 N-methyl-D-aspartate receptor nmdar2A subunit, NMD 5e-15
1pb7_A292 N-methyl-D-aspartate receptor subunit 1; ligand bi 9e-15
3g3k_A259 Glutamate receptor, ionotropic kainate 2; membrane 2e-14
1yae_A312 Glutamate receptor, ionotropic kainate 2; kainate 6e-14
2v3u_A265 Glutamate receptor delta-2 subunit; postsynaptic m 1e-13
1mqi_A263 Glutamate receptor 2; GLUR2, ligand binding core, 2e-10
2y7i_A229 STM4351; arginine-binding protein; HET: ARG; 1.90A 2e-09
3kzg_A237 Arginine 3RD transport system periplasmic binding 4e-09
1lst_A239 Lysine, arginine, ornithine-binding protein; amino 4e-09
3hv1_A268 Polar amino acid ABC uptake transporter substrate 2e-08
3tql_A227 Arginine-binding protein; transport and binding pr 2e-08
2q88_A257 EHUB, putative ABC transporter amino acid-binding 4e-08
3qax_A268 Probable ABC transporter arginine-binding protein; 6e-08
2pvu_A272 ARTJ; basic amino acid binding protein, ABC transp 6e-08
1wdn_A226 GLNBP, glutamine binding protein; closed form, com 6e-08
3i6v_A232 Periplasmic His/Glu/Gln/Arg/opine family-binding; 1e-07
3del_B242 Arginine binding protein; alpha and beta protein ( 1e-07
3k4u_A245 Binding component of ABC transporter; structural g 2e-07
2yln_A283 Putative ABC transporter, periplasmic binding Pro 2e-07
4dz1_A259 DALS D-alanine transporter; D-alanine binding, per 2e-07
2pyy_A228 Ionotropic glutamate receptor bacterial homologue; 3e-07
4f3p_A249 Glutamine-binding periplasmic protein; ssgcid, str 5e-07
4eq9_A246 ABC transporter substrate-binding protein-amino A 5e-07
3kbr_A239 Cyclohexadienyl dehydratase; pseudomonas aeruginos 6e-07
3mpk_A267 Virulence sensor protein BVGS; venus flytrap, sens 7e-07
2iee_A271 ORF2, probable ABC transporter extracellular-bindi 7e-07
3h7m_A234 Sensor protein; histidine kinase sensor domain, ki 1e-06
2yjp_A291 Putative ABC transporter, periplasmic binding Pro 1e-06
1ii5_A233 SLR1257 protein; membrane protein; HET: GLU; 1.60A 4e-06
2vha_A287 Periplasmic binding transport protein; periplasmic 1e-05
1xt8_A292 Putative amino-acid transporter periplasmic solut 1e-05
2o1m_A258 Probable amino-acid ABC transporter extracellular- 6e-05
2v25_A259 Major cell-binding factor; antigen, adhesin, aspar 9e-05
>3kg2_A Glutamate receptor 2; ION channel, membrane protein, cell membrane, glycoprotein, transport, membrane, postsynaptic cell membrane, editing; HET: ZK1 NAG BMA; 3.60A {Rattus norvegicus} Length = 823 Back     alignment and structure
 Score =  126 bits (318), Expect = 3e-33
 Identities = 51/229 (22%), Positives = 88/229 (38%), Gaps = 48/229 (20%)

Query: 32  ENGKWNGLIADLVNRKTDMALTSLVINSRRESVVDFTVPIMETGIAIVVAKRTGI-ISPT 90
           +   WNG++ +LV  K D+A+  L I   RE V+DF+ P M  GI+I++ K         
Sbjct: 447 DTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVF 506

Query: 91  AFLEPFDTASWMLVGVVAIQASAFTIFFFEWLSPSGFDMKISFSYRPLPFLPPEPFDTAS 150
           +FL+P     WM +    I   +  +F     SP                          
Sbjct: 507 SFLDPLAYEIWMCIVFAYI-GVSVVLFLVSRFSP-------------------------- 539

Query: 151 WMLVGVVAIQASAFTIFFFEWLSPSGFDMKTT-ALQPSHRFSLFRTYWLVWAVLFQAAVH 209
                             +EW +    D + T + + ++ F +F + W       Q    
Sbjct: 540 ------------------YEWHTEEFEDGRETQSSESTNEFGIFNSLWFSLGAFMQQGAD 581

Query: 210 IDTPKGFTAKFMTNMWAMFAVVFLAIYTANLAAFMITREEFHEFTGVDD 258
           I +P+  + + +  +W  F ++ ++ YTANLAAF+            +D
Sbjct: 582 I-SPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAED 629
>2rc8_A Glutamate [NMDA] receptor subunit 3A; membrane protein, cell junction, glycoprotein, ION transport channel, magnesium; 1.45A {Rattus norvegicus} PDB: 2rc7_A 2rc9_A 2rca_A 2rcb_A Length = 294 Back     alignment and structure
>2a5s_A N-methyl-D-aspartate receptor nmdar2A subunit, NMDA receptor nmdar2A; protein-ligand complex, metal transport,membrane protein; HET: GLU; 1.70A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 2a5t_B* 3oen_A* 3oel_A* 3oem_A* 3oek_A* Length = 284 Back     alignment and structure
>1pb7_A N-methyl-D-aspartate receptor subunit 1; ligand binding receptor, NR1, ligand binding protein; 1.35A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 1pbq_A* 1y1m_A 1y1z_A 1y20_A 2a5t_A* 1pb8_A 1pb9_A Length = 292 Back     alignment and structure
>3g3k_A Glutamate receptor, ionotropic kainate 2; membrane protein, cell junction, cell membrane, glycoprotein, ION transport, ionic channel, membrane; HET: GLU IPA; 1.24A {Rattus norvegicus} PDB: 3g3j_A* 3g3i_A* 2i0b_A* 3g3h_A* 3g3g_A* 3g3f_A* 1s7y_A* 1s9t_A* 1sd3_A* 1tt1_A* 1s50_A* 2xxr_A* 2xxt_A* 2xxx_A* 2xxw_A* 2xxy_A* 2xxu_A* 2xxv_A* 3qxm_A* 2i0c_A* ... Length = 259 Back     alignment and structure
>1yae_A Glutamate receptor, ionotropic kainate 2; kainate receptor, membrane protein; HET: NAG FUC DOQ; 3.11A {Rattus norvegicus} SCOP: c.94.1.1 Length = 312 Back     alignment and structure
>2v3u_A Glutamate receptor delta-2 subunit; postsynaptic membrane, ionotropic glutamate receptors, transmembrane, membrane protein; 1.74A {Rattus norvegicus} PDB: 2v3t_A Length = 265 Back     alignment and structure
>1mqi_A Glutamate receptor 2; GLUR2, ligand binding core, S1S2, partial agonist, WILLARDIINES, fluoro-WILLARDIINE, membrane protein; HET: FWD; 1.35A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 1ftj_A* 1ftl_A* 1fto_A 1fw0_A* 1m5b_A* 1ftm_A* 1m5c_A* 1mm6_A* 1mm7_A* 1mqg_A* 1m5e_A* 1mqj_A* 1ms7_A* 1mxu_A* 1mxv_A 1mxw_A 1mxx_A 1mxy_A 1mxz_A 1my0_A ... Length = 263 Back     alignment and structure
>2y7i_A STM4351; arginine-binding protein; HET: ARG; 1.90A {Salmonella enterica subsp} Length = 229 Back     alignment and structure
>3kzg_A Arginine 3RD transport system periplasmic binding protein; arginine transport system, protein structure initiative II(PSI II); 2.06A {Legionella pneumophila subsp} Length = 237 Back     alignment and structure
>1lst_A Lysine, arginine, ornithine-binding protein; amino-acid binding protein; HET: LYS; 1.80A {Salmonella typhimurium} SCOP: c.94.1.1 PDB: 2lao_A 1lag_E* 1lah_E 1laf_E 1hsl_A* 1hpb_P* Length = 239 Back     alignment and structure
>3hv1_A Polar amino acid ABC uptake transporter substrate binding protein; protein structure initiative II(PSI II), nysgxrc; 1.90A {Streptococcus thermophilus lmg 18311} Length = 268 Back     alignment and structure
>3tql_A Arginine-binding protein; transport and binding proteins, transport protein; HET: MSE ARG; 1.59A {Coxiella burnetii} Length = 227 Back     alignment and structure
>2q88_A EHUB, putative ABC transporter amino acid-binding prote; substrate-binding protein, compatible solues, ABC-transporte osmoprotection; HET: 4CS; 1.90A {Sinorhizobium meliloti} PDB: 2q89_A* Length = 257 Back     alignment and structure
>3qax_A Probable ABC transporter arginine-binding protein; periplasmic, transport PR; HET: ARG; 2.00A {Chlamydophila pneumoniae} PDB: 3g41_A* 3n26_A* Length = 268 Back     alignment and structure
>2pvu_A ARTJ; basic amino acid binding protein, ABC transport system, THER bacterium, transport protein; HET: LYS; 1.79A {Geobacillus stearothermophilus} PDB: 2q2a_A* 2q2c_A* Length = 272 Back     alignment and structure
>1wdn_A GLNBP, glutamine binding protein; closed form, complex, peptide, complex (binding protein/peptide); 1.94A {Escherichia coli} SCOP: c.94.1.1 PDB: 1ggg_A Length = 226 Back     alignment and structure
>3i6v_A Periplasmic His/Glu/Gln/Arg/opine family-binding; structural genomics, transporter, PSI-2, protein structure initiative; HET: LYS; 2.00A {Silicibacter pomeroyi} Length = 232 Back     alignment and structure
>3del_B Arginine binding protein; alpha and beta protein (A/B), periplasmic protein, arginine protein binding, transport protein; 1.92A {Chlamydia trachomatis} Length = 242 Back     alignment and structure
>3k4u_A Binding component of ABC transporter; structural genomics, protein structure INI NEW YORK structural genomix research consortium, nysgxrc; HET: LYS; 2.62A {Wolinella succinogenes} Length = 245 Back     alignment and structure
>2yln_A Putative ABC transporter, periplasmic binding Pro amino acid; transport protein, solute-BIND protein; HET: CYS GOL; 1.12A {Neisseria gonorrhoeae} PDB: 3zsf_A Length = 283 Back     alignment and structure
>4dz1_A DALS D-alanine transporter; D-alanine binding, periplasmic, transport protein; 1.90A {Salmonella enterica} PDB: 3r39_A 4f3s_A Length = 259 Back     alignment and structure
>2pyy_A Ionotropic glutamate receptor bacterial homologue; GLUR0 ligand binding domain, transport protein; HET: GLU; 2.10A {Nostoc punctiforme} Length = 228 Back     alignment and structure
>4f3p_A Glutamine-binding periplasmic protein; ssgcid, structural genomics, GLUT seattle structural genomics center for infectious disease; 2.40A {Burkholderia pseudomallei} Length = 249 Back     alignment and structure
>4eq9_A ABC transporter substrate-binding protein-amino A transport; structural genomics, niaid; HET: GSH; 1.40A {Streptococcus pneumoniae} Length = 246 Back     alignment and structure
>3kbr_A Cyclohexadienyl dehydratase; pseudomonas aeruginos structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Pseudomonas aeruginosa} Length = 239 Back     alignment and structure
>3mpk_A Virulence sensor protein BVGS; venus flytrap, sensor domain, signaling protein; 2.04A {Bordetella pertussis} PDB: 3mpl_A Length = 267 Back     alignment and structure
>2iee_A ORF2, probable ABC transporter extracellular-binding protein YCKB; SR574, NESG, X-RAY, structural genomics, PSI-2; 2.20A {Bacillus subtilis} Length = 271 Back     alignment and structure
>3h7m_A Sensor protein; histidine kinase sensor domain, kinase, phosphoprotein, transferase; 2.40A {Geobacter sulfurreducens} Length = 234 Back     alignment and structure
>2yjp_A Putative ABC transporter, periplasmic binding Pro amino acid; transport protein, solute-binding protein; 2.26A {Neisseria gonorrhoeae} Length = 291 Back     alignment and structure
>1ii5_A SLR1257 protein; membrane protein; HET: GLU; 1.60A {Synechocystis SP} SCOP: c.94.1.1 PDB: 1iit_A 1iiw_A Length = 233 Back     alignment and structure
>2vha_A Periplasmic binding transport protein; periplasmic binding protein, ligand binding, ultrahigh resolution; HET: GLU; 1.00A {Shigella flexneri} PDB: 2ia4_A* Length = 287 Back     alignment and structure
>1xt8_A Putative amino-acid transporter periplasmic solut protein; ABC transport, cysteine uptake; 2.00A {Campylobacter jejuni} SCOP: c.94.1.1 Length = 292 Back     alignment and structure
>2o1m_A Probable amino-acid ABC transporter extracellular-binding protein YTMK; NESG X-RAY O34852 YTMK_bacsu, structural genomics, PSI-2; 2.00A {Bacillus subtilis} Length = 258 Back     alignment and structure
>2v25_A Major cell-binding factor; antigen, adhesin, aspartate, glutamate, transport, ABC transport, virulence factor, receptor; 1.49A {Campylobacter jejuni} Length = 259 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query261
3kg2_A 823 Glutamate receptor 2; ION channel, membrane protei 99.97
1yae_A312 Glutamate receptor, ionotropic kainate 2; kainate 99.09
2rc8_A294 Glutamate [NMDA] receptor subunit 3A; membrane pro 99.07
2a5s_A284 N-methyl-D-aspartate receptor nmdar2A subunit, NMD 99.04
1pb7_A292 N-methyl-D-aspartate receptor subunit 1; ligand bi 99.01
3g3k_A259 Glutamate receptor, ionotropic kainate 2; membrane 98.94
2v3u_A265 Glutamate receptor delta-2 subunit; postsynaptic m 98.85
1mqi_A263 Glutamate receptor 2; GLUR2, ligand binding core, 98.78
4h5g_A243 Amino acid ABC superfamily ATP binding cassette tr 98.28
4gvo_A243 LMO2349 protein; structural genomics, IDP05245, L- 98.18
3kzg_A237 Arginine 3RD transport system periplasmic binding 98.06
3i6v_A232 Periplasmic His/Glu/Gln/Arg/opine family-binding; 97.98
1lst_A239 Lysine, arginine, ornithine-binding protein; amino 97.96
3tql_A227 Arginine-binding protein; transport and binding pr 97.95
4eq9_A246 ABC transporter substrate-binding protein-amino A 97.94
3k4u_A245 Binding component of ABC transporter; structural g 97.93
3hv1_A268 Polar amino acid ABC uptake transporter substrate 97.93
3kbr_A239 Cyclohexadienyl dehydratase; pseudomonas aeruginos 97.9
2iee_A271 ORF2, probable ABC transporter extracellular-bindi 97.8
4dz1_A259 DALS D-alanine transporter; D-alanine binding, per 97.8
1wdn_A226 GLNBP, glutamine binding protein; closed form, com 97.76
2vha_A287 Periplasmic binding transport protein; periplasmic 97.76
2y7i_A229 STM4351; arginine-binding protein; HET: ARG; 1.90A 97.74
1ii5_A233 SLR1257 protein; membrane protein; HET: GLU; 1.60A 97.74
4f3p_A249 Glutamine-binding periplasmic protein; ssgcid, str 97.74
3del_B242 Arginine binding protein; alpha and beta protein ( 97.73
2ozz_A231 Hypothetical protein YHFZ; alpha-beta structure, s 97.71
2q88_A257 EHUB, putative ABC transporter amino acid-binding 97.69
2pvu_A272 ARTJ; basic amino acid binding protein, ABC transp 97.67
1xt8_A292 Putative amino-acid transporter periplasmic solut 97.62
2yjp_A291 Putative ABC transporter, periplasmic binding Pro 97.61
2yln_A283 Putative ABC transporter, periplasmic binding Pro 97.59
2v25_A259 Major cell-binding factor; antigen, adhesin, aspar 97.59
2pyy_A228 Ionotropic glutamate receptor bacterial homologue; 97.58
4i62_A269 Amino acid ABC transporter, periplasmic amino ACI 97.58
3mpk_A267 Virulence sensor protein BVGS; venus flytrap, sens 97.52
3h7m_A234 Sensor protein; histidine kinase sensor domain, ki 97.48
3qax_A268 Probable ABC transporter arginine-binding protein; 97.42
2ih3_C122 Voltage-gated potassium channel; ION channel D-ami 97.09
2k1e_A103 Water soluble analogue of potassium channel, KCSA; 96.9
2a9h_A155 Voltage-gated potassium channel; potassium channel 96.76
4h33_A137 LMO2059 protein; bilayers, KVLM, lipidic cubic pha 95.9
3eff_K139 Voltage-gated potassium channel; FULL length KCSA, 95.63
3ouf_A97 Potassium channel protein; ION channel, membrane, 95.45
3pjs_K166 KCSA, voltage-gated potassium channel; ION channel 95.08
2q67_A114 Potassium channel protein; inverted teepee, helix 94.98
3ldc_A82 Calcium-gated potassium channel MTHK; transmembran 94.83
1orq_C223 Potassium channel; voltage-dependent, KVAP, FAB co 93.99
3vou_A148 ION transport 2 domain protein, voltage-gated SOD 93.58
1xl4_A 301 Inward rectifier potassium channel; integral membr 92.21
3uif_A348 Sulfonate ABC transporter, periplasmic sulfonate- 91.94
2qks_A 321 KIR3.1-prokaryotic KIR channel chimera; G-protein 91.33
1p7b_A 333 Integral membrane channel and cytosolic domains; t 91.2
2r9r_B514 Paddle chimera voltage gated potassium channel KV; 90.51
3qsl_A346 Putative exported protein; unknown, structural gen 90.02
3um7_A 309 Potassium channel subfamily K member 4; potassium 89.26
3beh_A 355 MLL3241 protein; transmembrane protein, membrane p 88.93
3ix1_A302 N-formyl-4-amino-5-aminomethyl-2-methylpyrimidine 88.51
2x26_A308 Periplasmic aliphatic sulphonates-binding protein; 87.9
1lnq_A 336 MTHK channels, potassium channel related protein; 87.83
3ukm_A280 Potassium channel subfamily K member 1; membrane p 86.14
3ukm_A 280 Potassium channel subfamily K member 1; membrane p 85.55
4gx0_A 565 TRKA domain protein; membrane protein, ION channel 84.56
3n5l_A310 Binding protein component of ABC phosphonate TRAN; 84.38
3p7i_A321 PHND, subunit of alkylphosphonate ABC transporter; 83.93
2nr1_A27 NR1 M2, M2; receptor, signal, postsynaptic membran 83.5
3un6_A341 Hypothetical protein saouhsc_00137; structural gen 82.3
>3kg2_A Glutamate receptor 2; ION channel, membrane protein, cell membrane, glycoprotein, transport, membrane, postsynaptic cell membrane, editing; HET: ZK1 NAG BMA; 3.60A {Rattus norvegicus} Back     alignment and structure
Probab=99.97  E-value=3.1e-33  Score=277.64  Aligned_cols=206  Identities=24%  Similarity=0.487  Sum_probs=162.3

Q ss_pred             HhhhhcCcEEEEEEecCCceeEe--eCCchhhHHHHHhcCceeEEEeCCCCChhhhhhccccccccccceEEEEEccC-C
Q psy13439          9 ESLKKKRKLLTVYLHSKNEVLSV--ENGKWNGLIADLVNRKTDMALTSLVINSRRESVVDFTVPIMETGIAIVVAKRT-G   85 (261)
Q Consensus         9 e~l~k~~~~~~~~~~~~~~~g~~--~~~~~~gli~~L~~g~~Di~i~~i~it~eR~~~vdfS~py~~~~~~~lv~~~~-~   85 (261)
                      +..+++|+.++++..+++.||..  .|++|+|++++|.+|++|++++++++|++|.+.+|||.||+.++..++++++. .
T Consensus       422 ~~a~~l~~~~~~~~~~~~~~g~~~~~~g~~~~~~~~l~~~~~D~~~~~~~~t~~R~~~~dfs~py~~~~~~~~v~~~~~~  501 (823)
T 3kg2_A          422 EIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKS  501 (823)
T ss_dssp             HHHHHHTCCEEEEECSSCCCCCBCTTTCCBCHHHHHHHTTSCSEECSCCBCCHHHHTTEEECSCSEEECEEEEEECCCCC
T ss_pred             HHHHHcCCcEEEEEccCCcccccCCCCCchhhHHHhhccccCcEEecceecchhheeeEEeccchhhCCEEEEEECCCcc
Confidence            44567999999999999999985  57899999999999999999999999999999999999999999999999986 3


Q ss_pred             CCCcccccCCCCcccccceehhhhHHHHHHHHHHHHhCCCCCcccccccCCCCCCCCCCCCCcchhhhhhhhhhhhcchh
Q psy13439         86 IISPTAFLEPFDTASWMLVGVVAIQASAFTIFFFEWLSPSGFDMKISFSYRPLPFLPPEPFDTASWMLVGVVAIQASAFT  165 (261)
Q Consensus        86 ~~~~~~~l~pF~~~vW~~i~~~~l~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  165 (261)
                      ..+++.|++||++.+|++++++ ++++++++|+.++++|++|                                      
T Consensus       502 ~~~~~~fl~Pf~~~vW~~i~~~-~~~~~~~l~~~~~~~p~~w--------------------------------------  542 (823)
T 3kg2_A          502 KPGVFSFLDPLAYEIWMCIVFA-YIGVSVVLFLVSRFSPYEW--------------------------------------  542 (823)
T ss_dssp             CCCGGGTTTTSCHHHHHHHHHH-HHHHHTTGGGTC---------------------------------------------
T ss_pred             cccchHhhcCCchhHHHHHHHH-HHHHHHHHHHHHhcChhhc--------------------------------------
Confidence            4678899999999999999874 4556677788888776544                                      


Q ss_pred             hhhhhccCCCCCCCcc-cCCCCCCCCcchhhHHHHHHHHHhcccCCCCCCchhhHHHHHHHHHHHHHHHHhhcccceeee
Q psy13439        166 IFFFEWLSPSGFDMKT-TALQPSHRFSLFRTYWLVWAVLFQAAVHIDTPKGFTAKFMTNMWAMFAVVFLAIYTANLAAFM  244 (261)
Q Consensus       166 ~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~s~~~~~~~l~~qg~~~~~p~s~s~Ril~~~w~l~~lil~~~Yta~L~s~L  244 (261)
                            ++++.+..+. ......+.+++.+++|++++++++||.+. .|++.++|+++++||++++|++++|||+|+|+|
T Consensus       543 ------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~g~~~-~p~~~~~R~~~~~w~~~~lil~~~Yta~L~s~L  615 (823)
T 3kg2_A          543 ------HTEEFEDGRETQSSESTNEFGIFNSLWFSLGAFMQQGADI-SPRSLSGRIVGGVWWFFTLIIISSYTANLAAFL  615 (823)
T ss_dssp             ----------------------CHHHHHHHHHHHTTTTSCC-------CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             ------cCcccccccccccccccccccHHHHHHHHHHHHHhcCCCc-CCcchhhhhHHHHHHHHHHHHHHHHHHHHHHHh
Confidence                  3333222110 11223445678899999999999999987 999999999999999999999999999999999


Q ss_pred             eccccccccCCccCCC
Q psy13439        245 ITREEFHEFTGVDDVR  260 (261)
Q Consensus       245 t~~~~~~~i~sl~Dl~  260 (261)
                      |.++..++|+|++||.
T Consensus       616 t~~~~~~~I~s~~dL~  631 (823)
T 3kg2_A          616 TVERMVSPIESAEDLS  631 (823)
T ss_dssp             HHHHHCCCCCSSHHHH
T ss_pred             cccccCCCCCCHHHHh
Confidence            9999999999999973
>1yae_A Glutamate receptor, ionotropic kainate 2; kainate receptor, membrane protein; HET: NAG FUC DOQ; 3.11A {Rattus norvegicus} SCOP: c.94.1.1 Back     alignment and structure
>2rc8_A Glutamate [NMDA] receptor subunit 3A; membrane protein, cell junction, glycoprotein, ION transport channel, magnesium; 1.45A {Rattus norvegicus} PDB: 2rc7_A 2rc9_A 2rca_A 2rcb_A Back     alignment and structure
>2a5s_A N-methyl-D-aspartate receptor nmdar2A subunit, NMDA receptor nmdar2A; protein-ligand complex, metal transport,membrane protein; HET: GLU; 1.70A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 2a5t_B* 3oen_A* 3oel_A* 3oem_A* 3oek_A* Back     alignment and structure
>1pb7_A N-methyl-D-aspartate receptor subunit 1; ligand binding receptor, NR1, ligand binding protein; 1.35A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 1pbq_A* 1y1m_A 1y1z_A 1y20_A 2a5t_A* 1pb8_A 1pb9_A Back     alignment and structure
>3g3k_A Glutamate receptor, ionotropic kainate 2; membrane protein, cell junction, cell membrane, glycoprotein, ION transport, ionic channel, membrane; HET: GLU IPA; 1.24A {Rattus norvegicus} PDB: 3g3j_A* 3g3i_A* 2i0b_A* 3g3h_A* 3g3g_A* 3g3f_A* 1s7y_A* 1s9t_A* 1sd3_A* 1tt1_A* 1s50_A* 2xxr_A* 2xxt_A* 2xxx_A* 2xxw_A* 2xxy_A* 2xxu_A* 2xxv_A* 3qxm_A* 2i0c_A* ... Back     alignment and structure
>2v3u_A Glutamate receptor delta-2 subunit; postsynaptic membrane, ionotropic glutamate receptors, transmembrane, membrane protein; 1.74A {Rattus norvegicus} PDB: 2v3t_A Back     alignment and structure
>1mqi_A Glutamate receptor 2; GLUR2, ligand binding core, S1S2, partial agonist, WILLARDIINES, fluoro-WILLARDIINE, membrane protein; HET: FWD; 1.35A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 1ftj_A* 1ftl_A* 1fto_A 1fw0_A* 1m5b_A* 1ftm_A* 1m5c_A* 1mm6_A* 1mm7_A* 1mqg_A* 1m5e_A* 1mqj_A* 1ms7_A* 1mxu_A* 1mxv_A 1mxw_A 1mxx_A 1mxy_A 1mxz_A 1my0_A ... Back     alignment and structure
>4h5g_A Amino acid ABC superfamily ATP binding cassette transporter, binding protein; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases; HET: ARG; 1.78A {Streptococcus pneumoniae} PDB: 4h5f_A* Back     alignment and structure
>4gvo_A LMO2349 protein; structural genomics, IDP05245, L-cystine, ABC transporter, periplasmic binding protein, niaid; HET: HIS; 1.45A {Listeria monocytogenes} PDB: 2o1m_A Back     alignment and structure
>3kzg_A Arginine 3RD transport system periplasmic binding protein; arginine transport system, protein structure initiative II(PSI II); 2.06A {Legionella pneumophila subsp} SCOP: c.94.1.0 Back     alignment and structure
>3i6v_A Periplasmic His/Glu/Gln/Arg/opine family-binding; structural genomics, transporter, PSI-2, protein structure initiative; HET: LYS; 2.00A {Silicibacter pomeroyi} SCOP: c.94.1.0 Back     alignment and structure
>1lst_A Lysine, arginine, ornithine-binding protein; amino-acid binding protein; HET: LYS; 1.80A {Salmonella typhimurium} SCOP: c.94.1.1 PDB: 2lao_A 1lag_E* 1lah_E 1laf_E 1hsl_A* 1hpb_P* Back     alignment and structure
>3tql_A Arginine-binding protein; transport and binding proteins, transport protein; HET: MSE ARG; 1.59A {Coxiella burnetii} SCOP: c.94.1.0 Back     alignment and structure
>4eq9_A ABC transporter substrate-binding protein-amino A transport; structural genomics, niaid; HET: GSH; 1.40A {Streptococcus pneumoniae} Back     alignment and structure
>3k4u_A Binding component of ABC transporter; structural genomics, protein structure INI NEW YORK structural genomix research consortium, nysgxrc; HET: LYS; 2.62A {Wolinella succinogenes} SCOP: c.94.1.0 Back     alignment and structure
>3hv1_A Polar amino acid ABC uptake transporter substrate binding protein; protein structure initiative II(PSI II), nysgxrc; 1.90A {Streptococcus thermophilus lmg 18311} Back     alignment and structure
>3kbr_A Cyclohexadienyl dehydratase; pseudomonas aeruginos structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Pseudomonas aeruginosa} Back     alignment and structure
>2iee_A ORF2, probable ABC transporter extracellular-binding protein YCKB; SR574, NESG, X-RAY, structural genomics, PSI-2; 2.20A {Bacillus subtilis} Back     alignment and structure
>4dz1_A DALS D-alanine transporter; D-alanine binding, periplasmic, transport protein; 1.90A {Salmonella enterica} PDB: 3r39_A 4f3s_A Back     alignment and structure
>1wdn_A GLNBP, glutamine binding protein; closed form, complex, peptide, complex (binding protein/peptide); 1.94A {Escherichia coli} SCOP: c.94.1.1 PDB: 1ggg_A Back     alignment and structure
>2vha_A Periplasmic binding transport protein; periplasmic binding protein, ligand binding, ultrahigh resolution; HET: GLU; 1.00A {Shigella flexneri} PDB: 2ia4_A* Back     alignment and structure
>2y7i_A STM4351; arginine-binding protein; HET: ARG; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>1ii5_A SLR1257 protein; membrane protein; HET: GLU; 1.60A {Synechocystis SP} SCOP: c.94.1.1 PDB: 1iit_A 1iiw_A Back     alignment and structure
>4f3p_A Glutamine-binding periplasmic protein; ssgcid, structural genomics, GLUT seattle structural genomics center for infectious disease; 2.40A {Burkholderia pseudomallei} Back     alignment and structure
>3del_B Arginine binding protein; alpha and beta protein (A/B), periplasmic protein, arginine protein binding, transport protein; 1.92A {Chlamydia trachomatis} SCOP: c.94.1.0 Back     alignment and structure
>2ozz_A Hypothetical protein YHFZ; alpha-beta structure, structural genomics, PSI-2, protein structure initiative; 2.30A {Shigella flexneri 2A} SCOP: c.94.1.1 Back     alignment and structure
>2q88_A EHUB, putative ABC transporter amino acid-binding prote; substrate-binding protein, compatible solues, ABC-transporte osmoprotection; HET: 4CS; 1.90A {Sinorhizobium meliloti} PDB: 2q89_A* Back     alignment and structure
>2pvu_A ARTJ; basic amino acid binding protein, ABC transport system, THER bacterium, transport protein; HET: LYS; 1.79A {Geobacillus stearothermophilus} PDB: 2q2a_A* 2q2c_A* Back     alignment and structure
>1xt8_A Putative amino-acid transporter periplasmic solut protein; ABC transport, cysteine uptake; 2.00A {Campylobacter jejuni} SCOP: c.94.1.1 Back     alignment and structure
>2yjp_A Putative ABC transporter, periplasmic binding Pro amino acid; transport protein, solute-binding protein; 2.26A {Neisseria gonorrhoeae} Back     alignment and structure
>2yln_A Putative ABC transporter, periplasmic binding Pro amino acid; transport protein, solute-BIND protein; HET: CYS GOL; 1.12A {Neisseria gonorrhoeae} PDB: 3zsf_A Back     alignment and structure
>2v25_A Major cell-binding factor; antigen, adhesin, aspartate, glutamate, transport, ABC transport, virulence factor, receptor; 1.49A {Campylobacter jejuni} Back     alignment and structure
>2pyy_A Ionotropic glutamate receptor bacterial homologue; GLUR0 ligand binding domain, transport protein; HET: GLU; 2.10A {Nostoc punctiforme} Back     alignment and structure
>4i62_A Amino acid ABC transporter, periplasmic amino ACI protein, putative; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases (NIAI niaid; HET: ARG; 1.05A {Streptococcus pneumoniae} Back     alignment and structure
>3mpk_A Virulence sensor protein BVGS; venus flytrap, sensor domain, signaling protein; 2.04A {Bordetella pertussis} PDB: 3mpl_A Back     alignment and structure
>3h7m_A Sensor protein; histidine kinase sensor domain, kinase, phosphoprotein, transferase; 2.40A {Geobacter sulfurreducens} SCOP: c.94.1.0 Back     alignment and structure
>3qax_A Probable ABC transporter arginine-binding protein; periplasmic, transport PR; HET: ARG; 2.00A {Chlamydophila pneumoniae} PDB: 3g41_A* 3n26_A* Back     alignment and structure
>2ih3_C Voltage-gated potassium channel; ION channel D-amino acid semi-synthetic, membrane protein; HET: 1EM; 1.72A {Streptomyces lividans} PDB: 2ih1_C* 1r3j_C* 1k4d_C* 1r3i_C* 1k4c_C* 1r3k_C* 1r3l_C* 2bob_C* 2boc_C* 2hvj_C* 2hvk_C* 2itc_C 2itd_C 3gb7_C* 3iga_C* 1jvm_A 1s5h_C* 3ifx_A* 1j95_A 2jk5_C* ... Back     alignment and structure
>2k1e_A Water soluble analogue of potassium channel, KCSA; homotetramer, ION transport, ionic channel, membrane, transmembrane, transport; NMR {Escherichia coli} PDB: 2kb1_A Back     alignment and structure
>2a9h_A Voltage-gated potassium channel; potassium channel, KCSA, structure, membrane protein, metal transport; HET: PCA; NMR {Streptomyces lividans} SCOP: f.14.1.1 Back     alignment and structure
>4h33_A LMO2059 protein; bilayers, KVLM, lipidic cubic phase (LCP), pore module, ION membrane protein; HET: OLC; 3.10A {Listeria monocytogenes} PDB: 4h37_A Back     alignment and structure
>3eff_K Voltage-gated potassium channel; FULL length KCSA, bulge helix, cell membrane, ION transport, ionic channel, membrane, transmembrane; 3.80A {Streptomyces lividans} Back     alignment and structure
>3ouf_A Potassium channel protein; ION channel, membrane, membrane protein; 1.55A {Bacillus cereus} PDB: 3t4z_A 3tcu_A 3t1c_A 3tet_A 3t4d_A 3t2m_A 3e86_A 3e83_A 3e89_A 3e8b_A 3e8f_A 3e8g_A 3e8h_A 3k0d_A 3k0g_A 3k06_A 3k08_A 3k04_A 3k03_A Back     alignment and structure
>3pjs_K KCSA, voltage-gated potassium channel; ION channel, conducts K+ IONS, cell membrane, transport PROT; 3.80A {Streptomyces lividans} PDB: 1f6g_A Back     alignment and structure
>2q67_A Potassium channel protein; inverted teepee, helix bundle, tetramer, central cavity, ION metal transport, membrane protein; 2.30A {Bacillus cereus} PDB: 2q68_A 2q6a_A 2q69_A 2ahy_A 2ahz_A Back     alignment and structure
>3ldc_A Calcium-gated potassium channel MTHK; transmembrane, ION channel, open conformation, IO transport; 1.45A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3lde_A 4hyo_A 4hz3_D 3r65_A 3ous_A 3ldd_A Back     alignment and structure
>1orq_C Potassium channel; voltage-dependent, KVAP, FAB complex, MEM protein; 3.20A {Aeropyrum pernix} SCOP: f.14.1.1 PDB: 2a0l_A Back     alignment and structure
>3vou_A ION transport 2 domain protein, voltage-gated SOD channel; 4-helical bundle, ION channel, membrane, transport protein; 3.20A {Bacillus weihenstephanensis} Back     alignment and structure
>1xl4_A Inward rectifier potassium channel; integral membrane protein, ION channel, inwardly rectifying channel, metal transport; 2.60A {Magnetospirillum magnetotacticum} SCOP: b.1.18.16 f.14.1.1 PDB: 1xl6_A* 2wlh_A 2wli_B 2wlj_A* 2wlk_A* 2wlm_A 2wlo_A 2wln_A 3zrs_A 2wli_A 2x6c_A* 2x6b_A* 2x6a_A* Back     alignment and structure
>3uif_A Sulfonate ABC transporter, periplasmic sulfonate- protein SSUA; structural genomics; 2.60A {Methylobacillus flagellatus} Back     alignment and structure
>2qks_A KIR3.1-prokaryotic KIR channel chimera; G-protein gated inward rectifier, potassium channel selectivity filter, metal transport; HET: BNG; 2.20A {Burkholderia xenovorans} Back     alignment and structure
>1p7b_A Integral membrane channel and cytosolic domains; transmembrane helices, ION conduction, immunoglobulin fold, assembly; 3.65A {Burkholderia pseudomallei} SCOP: b.1.18.16 f.14.1.1 PDB: 2wll_B* 2wll_A* Back     alignment and structure
>2r9r_B Paddle chimera voltage gated potassium channel KV; voltage sensor, voltage dependent, ION CH shaker, membrane protein, eukaryotic; HET: NAP PGW; 2.40A {Rattus norvegicus} PDB: 3lnm_B* 3lut_B* 2a79_B* Back     alignment and structure
>3qsl_A Putative exported protein; unknown, structural genomics, PSI-biology, midwest center FO structural genomics, MCSG, unknown function; HET: MSE CIT; 2.00A {Bordetella bronchiseptica} Back     alignment and structure
>3um7_A Potassium channel subfamily K member 4; potassium ION channel, metal transport; 3.31A {Homo sapiens} Back     alignment and structure
>3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* Back     alignment and structure
>3ix1_A N-formyl-4-amino-5-aminomethyl-2-methylpyrimidine protein; periplasmic N-formyl-4-amino-5-aminomethyl-2-methylpyrimidin protein; HET: NFM; 2.40A {Bacillus halodurans c-125} Back     alignment and structure
>2x26_A Periplasmic aliphatic sulphonates-binding protein; transport protein; 1.75A {Escherichia coli} Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Back     alignment and structure
>3ukm_A Potassium channel subfamily K member 1; membrane protein, eukaryotic, two-pore DO potassium channel, K2P channel, membrane; HET: UND; 3.40A {Homo sapiens} Back     alignment and structure
>3ukm_A Potassium channel subfamily K member 1; membrane protein, eukaryotic, two-pore DO potassium channel, K2P channel, membrane; HET: UND; 3.40A {Homo sapiens} Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>3n5l_A Binding protein component of ABC phosphonate TRAN; structural genomics, joint center for structural genomics; HET: UNL; 1.97A {Pseudomonas aeruginosa} Back     alignment and structure
>3p7i_A PHND, subunit of alkylphosphonate ABC transporter; phosphonate binding protein, transport protein; 1.71A {Escherichia coli UTI89} PDB: 3qk6_A 3quj_A* 3s4u_A Back     alignment and structure
>2nr1_A NR1 M2, M2; receptor, signal, postsynaptic membrane; NMR {Homo sapiens} SCOP: j.35.1.1 Back     alignment and structure
>3un6_A Hypothetical protein saouhsc_00137; structural genomics, center for structural genomics of infec diseases, csgid; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 261
d2a5sa1277 c.94.1.1 (A:7-142,A:145-285) N-methyl-D-aspartate 9e-07
d1pb7a_289 c.94.1.1 (A:) N-methyl-D-aspartate receptor subuni 2e-05
>d2a5sa1 c.94.1.1 (A:7-142,A:145-285) N-methyl-D-aspartate receptor subunit 1 {Rat (Rattus norvegicus), subtype 2A [TaxId: 10116]} Length = 277 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Periplasmic binding protein-like II
superfamily: Periplasmic binding protein-like II
family: Phosphate binding protein-like
domain: N-methyl-D-aspartate receptor subunit 1
species: Rat (Rattus norvegicus), subtype 2A [TaxId: 10116]

 Score = 46.6 bits (109), Expect = 9e-07
 Identities = 28/73 (38%), Positives = 44/73 (60%)

Query: 30  SVENGKWNGLIADLVNRKTDMALTSLVINSRRESVVDFTVPIMETGIAIVVAKRTGIISP 89
              N  WNG+I ++V ++  MA+ SL IN  R  VVDF+VP +ETGI+++V+++   +S 
Sbjct: 84  KKVNNVWNGMIGEVVYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRQVTGLSD 143

Query: 90  TAFLEPFDTASWM 102
             F  P D +   
Sbjct: 144 KKFQRPHDYSPPF 156
>d1pb7a_ c.94.1.1 (A:) N-methyl-D-aspartate receptor subunit 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 289 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query261
d2a5sa1277 N-methyl-D-aspartate receptor subunit 1 {Rat (Ratt 99.5
d1pb7a_289 N-methyl-D-aspartate receptor subunit 1 {Rat (Ratt 99.07
d1mqia_260 Glutamate receptor ligand binding core {Rat (Rattu 98.89
d2f34a1246 Glutamate receptor ligand binding core {Rat (Rattu 98.68
d1xt8a1248 Putative amino-acid transporter CjaA {Campylobacte 98.04
d1wdna_223 Glutamine-binding protein {Escherichia coli [TaxId 97.97
d1ii5a_226 Glutamate receptor ligand binding core {Synechocys 97.72
d1r3jc_103 Potassium channel protein {Streptomyces coelicolor 97.38
d1lsta_238 Lysine-,arginine-,ornithine-binding (LAO) protein 97.3
d1xl4a2116 Inward rectifier potassium channel kirbac3.1 {Magn 95.54
d1p7ba2116 Inward rectifier potassium channel Kirbac1.1 {Burk 92.9
d1lnqa280 Potassium channel-related protein MthK {Archaeon M 92.8
>d2a5sa1 c.94.1.1 (A:7-142,A:145-285) N-methyl-D-aspartate receptor subunit 1 {Rat (Rattus norvegicus), subtype 2A [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Periplasmic binding protein-like II
superfamily: Periplasmic binding protein-like II
family: Phosphate binding protein-like
domain: N-methyl-D-aspartate receptor subunit 1
species: Rat (Rattus norvegicus), subtype 2A [TaxId: 10116]

Probab=99.50  E-value=7.2e-15  Score=126.23  Aligned_cols=109  Identities=28%  Similarity=0.453  Sum_probs=94.7

Q ss_pred             HhhhhcCcEEEEEEecCCceeEeeCCchhhHHHHHhcCceeEEEeCCCCChhhhhhccccccccccceEEEEEccCCCCC
Q psy13439          9 ESLKKKRKLLTVYLHSKNEVLSVENGKWNGLIADLVNRKTDMALTSLVINSRRESVVDFTVPIMETGIAIVVAKRTGIIS   88 (261)
Q Consensus         9 e~l~k~~~~~~~~~~~~~~~g~~~~~~~~gli~~L~~g~~Di~i~~i~it~eR~~~vdfS~py~~~~~~~lv~~~~~~~~   88 (261)
                      +..+++|+.|+++.++++.+|...+++|++++++|.+|++|++++++++|++|.+.++||.||+..+..++++++....+
T Consensus        63 ~ia~~lg~~~e~~~v~~~~~g~~~~~~w~~~l~~l~~g~~Di~i~~~tit~eR~~~v~Fs~Py~~~~~~ilv~k~~~~~~  142 (277)
T d2a5sa1          63 KLSRTVKFTYDLYLVTNGKHGKKVNNVWNGMIGEVVYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRQVTGLS  142 (277)
T ss_dssp             HHHHHHTCCEEEEECCSSSSCCEETTEECHHHHHHHTTSCSEECSSCBCCHHHHTTEEECCCCEEECEEEEEETCCCSTT
T ss_pred             HHHHHhCCCEEEEEccCCCcCccCCCCHHHHHhhhhcccEEEEEEccEeehhhhhhhcccCCceecceEEEEecCcccCC
Confidence            33457999999999999999999999999999999999999999999999999999999999999999999999887777


Q ss_pred             cccccCCCCcccccceehhhhHHHHHHHHHH
Q psy13439         89 PTAFLEPFDTASWMLVGVVAIQASAFTIFFF  119 (261)
Q Consensus        89 ~~~~l~pF~~~vW~~i~~~~l~~~~~~~~l~  119 (261)
                      ..++.+|+....|..+++  +.+++...++.
T Consensus       143 ~~~~~~~~~~~~~~~~g~--v~~~~~~~~~~  171 (277)
T d2a5sa1         143 DKKFQRPHDYSPPFRFGT--VPNGSTERNIR  171 (277)
T ss_dssp             SHHHHSGGGSSSCCCEEC--CTTSHHHHHHH
T ss_pred             hhHhcCccccchheeeec--cchhhHHHHHH
Confidence            788899999888888776  33444444443
>d1pb7a_ c.94.1.1 (A:) N-methyl-D-aspartate receptor subunit 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mqia_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR2 [TaxId: 10116]} Back     information, alignment and structure
>d2f34a1 c.94.1.1 (A:5-116,A:119-252) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR5 [TaxId: 10116]} Back     information, alignment and structure
>d1xt8a1 c.94.1.1 (A:10-257) Putative amino-acid transporter CjaA {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1wdna_ c.94.1.1 (A:) Glutamine-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ii5a_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Synechocystis sp., GluR0 [TaxId: 1143]} Back     information, alignment and structure
>d1r3jc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1lsta_ c.94.1.1 (A:) Lysine-,arginine-,ornithine-binding (LAO) protein {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1xl4a2 f.14.1.1 (A:23-138) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]} Back     information, alignment and structure
>d1p7ba2 f.14.1.1 (A:36-151) Inward rectifier potassium channel Kirbac1.1 {Burkholderia pseudomallei [TaxId: 28450]} Back     information, alignment and structure
>d1lnqa2 f.14.1.1 (A:19-98) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure