Psyllid ID: psy13445


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-----
MVMSSYGMNFRICYSKIVFFYSSGVWCHHCEQFLPSSVDDLLLHSRKCASAHRPDKSYNYVCCICDYKSYKKSHMRDHIQSHLGDKPFVCEHCFSNFARLRRLKEHILRMHPELI
cccccHHHHHHHHcccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccHHHHHHcccccccccccccccHHcccccHHHHHHHHHccccc
cccccccccHHHHHHHHHEEEccccEcccccccccccHHHHHHHHHHcccccccccccccEcccccccEcccHHHHHHHHHccccccccccHccccHHHHHHHHHHHHHHcHHHc
mvmssygmnfRICYSKIVFFYssgvwchhceqflpssvDDLLLHSrkcasahrpdksynyvccicdyksykkshmrdhiqshlgdkpfvcehCFSNFARLRRLKEHILRMHPELI
MVMSSYGMNFRICYSKIVFFYSSGVWCHHCEQFLPSSVDDLLLHSRKCAsahrpdksynyvCCICDYKSYKKSHMRDHIQSHLGDKPFVCEHCFSNFARLRRLKEHILRMHPELI
MVMSSYGMNFRICYSKIVFFYSSGVWCHHCEQFLPSSVDDLLLHSRKCASAHRPDKSYNYVCCICDYKSYKKSHMRDHIQSHLGDKPFVCEHCFSNFARLRRLKEHILRMHPELI
*****YGMNFRICYSKIVFFYSSGVWCHHCEQFLPSSVDDLLLHSRKCASAHRPDKSYNYVCCICDYKSYKKSHMRDHIQSHLGDKPFVCEHCFSNFARLRRLKEHIL*******
*VMSSYGMNFRICYSKIVFFYSSGVWCHHCEQFLPSSVDDLLLHSRKCASAHRPDKSYNYVCCICDYKSYKKSHMRDHIQSHLGDKPFVCEHCFSNFARLRRLKEHIL**H****
MVMSSYGMNFRICYSKIVFFYSSGVWCHHCEQFLPSSVDDLLLHSRKCASAHRPDKSYNYVCCICDYKSYKKSHMRDHIQSHLGDKPFVCEHCFSNFARLRRLKEHILRMHPELI
****SYGMNFRICYSKIVFFYSSGVWCHHCEQFLPSSVDDLLLHSRKCASAHRPDKSYNYVCCICDYKSYKKSHMRDHIQSHLGDKPFVCEHCFSNFARLRRLKEHILRMHPELI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVMSSYGMNFRICYSKIVFFYSSGVWCHHCEQFLPSSVDDLLLHSRKCASAHRPDKSYNYVCCICDYKSYKKSHMRDHIQSHLGDKPFVCEHCFSNFARLRRLKEHILRMHPELI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query115 2.2.26 [Sep-21-2011]
Q92010448 Zinc finger protein 161 h yes N/A 0.591 0.151 0.418 2e-07
Q9R1Y5 733 Hypermethylated in cancer yes N/A 0.573 0.090 0.379 5e-07
Q14526 733 Hypermethylated in cancer yes N/A 0.573 0.090 0.379 5e-07
Q08376449 Zinc finger protein 161 O no N/A 0.591 0.151 0.418 1e-06
O43829449 Zinc finger protein 161 h no N/A 0.591 0.151 0.418 1e-06
P39959443 Zinc finger protein YER13 yes N/A 0.521 0.135 0.354 2e-06
Q90850 676 Hypermethylated in cancer no N/A 0.443 0.075 0.461 2e-06
Q9NPC7610 Myoneurin OS=Homo sapiens no N/A 0.678 0.127 0.317 4e-06
Q2EI21 1501 RE1-silencing transcripti N/A N/A 0.678 0.051 0.294 4e-06
Q99MD8610 Myoneurin OS=Mus musculus no N/A 0.565 0.106 0.323 5e-06
>sp|Q92010|ZF161_CHICK Zinc finger protein 161 homolog OS=Gallus gallus GN=ZFP161 PE=2 SV=1 Back     alignment and function desciption
 Score = 54.7 bits (130), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 31/74 (41%), Positives = 38/74 (51%), Gaps = 6/74 (8%)

Query: 40  DLLLHSRKCASAHRPDKSYNYVCCICDYKSYKKSHMRDHIQSHLGDKPFVCEHCFSNFAR 99
           DL  H R   S  RP     + C +CD     KSH++DH + H G+KPFVC  C   FA+
Sbjct: 345 DLKKHER-VHSNERP-----FACHMCDKAFKHKSHLKDHERRHRGEKPFVCGSCTKAFAK 398

Query: 100 LRRLKEHILRMHPE 113
              LK H   MH E
Sbjct: 399 ASDLKRHENNMHSE 412




Transcriptional repressor of MYC and thymidine kinase promoters.
Gallus gallus (taxid: 9031)
>sp|Q9R1Y5|HIC1_MOUSE Hypermethylated in cancer 1 protein OS=Mus musculus GN=Hic1 PE=1 SV=4 Back     alignment and function description
>sp|Q14526|HIC1_HUMAN Hypermethylated in cancer 1 protein OS=Homo sapiens GN=HIC1 PE=1 SV=5 Back     alignment and function description
>sp|Q08376|ZF161_MOUSE Zinc finger protein 161 OS=Mus musculus GN=Zfp161 PE=2 SV=1 Back     alignment and function description
>sp|O43829|ZF161_HUMAN Zinc finger protein 161 homolog OS=Homo sapiens GN=ZFP161 PE=2 SV=2 Back     alignment and function description
>sp|P39959|YEW0_YEAST Zinc finger protein YER130C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YER130C PE=4 SV=2 Back     alignment and function description
>sp|Q90850|HIC1_CHICK Hypermethylated in cancer 1 protein (Fragment) OS=Gallus gallus GN=HIC1 PE=2 SV=2 Back     alignment and function description
>sp|Q9NPC7|MYNN_HUMAN Myoneurin OS=Homo sapiens GN=MYNN PE=1 SV=1 Back     alignment and function description
>sp|Q2EI21|RESTA_XENLA RE1-silencing transcription factor A OS=Xenopus laevis GN=rest-a PE=2 SV=1 Back     alignment and function description
>sp|Q99MD8|MYNN_MOUSE Myoneurin OS=Mus musculus GN=Mynn PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query115
255720641 463 predicted protein [Candida tropicalis MY 0.547 0.136 0.396 1e-07
405972910 953 hypothetical protein CGI_10024210 [Crass 0.686 0.082 0.356 3e-07
444727221 1603 Zinc finger protein 161 like protein [Tu 0.591 0.042 0.418 4e-07
345486845 410 PREDICTED: zinc finger protein 778-like 0.478 0.134 0.418 1e-06
357626639 1091 hypothetical protein KGM_16713 [Danaus p 0.808 0.085 0.333 2e-06
403283576 612 PREDICTED: hypermethylated in cancer 1 p 0.573 0.107 0.379 5e-06
348526416 1099 PREDICTED: zinc finger protein 574-like 0.660 0.069 0.365 6e-06
410050884 610 PREDICTED: LOW QUALITY PROTEIN: hypermet 0.573 0.108 0.379 6e-06
345328272 772 PREDICTED: transcriptional repressor CTC 0.852 0.126 0.304 7e-06
45384040 448 zinc finger protein 161 homolog [Gallus 0.591 0.151 0.418 8e-06
>gi|255720641|ref|XP_002545255.1| predicted protein [Candida tropicalis MYA-3404] gi|240135744|gb|EER35297.1| predicted protein [Candida tropicalis MYA-3404] Back     alignment and taxonomy information
 Score = 60.5 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 25/63 (39%), Positives = 37/63 (58%)

Query: 49  ASAHRPDKSYNYVCCICDYKSYKKSHMRDHIQSHLGDKPFVCEHCFSNFARLRRLKEHIL 108
           ++  R DK+  Y C ICD +  +  H++ H++SH  +KPF CE C   F R   LK HI 
Sbjct: 398 STQSREDKNKKYSCPICDGRFMRPEHVKRHLRSHTSEKPFECEQCQKTFNRKDNLKAHIK 457

Query: 109 RMH 111
           ++H
Sbjct: 458 KIH 460




Source: Candida tropicalis MYA-3404

Species: Candida tropicalis

Genus: Candida

Family:

Order: Saccharomycetales

Class: Saccharomycetes

Phylum: Ascomycota

Superkingdom: Eukaryota

>gi|405972910|gb|EKC37656.1| hypothetical protein CGI_10024210 [Crassostrea gigas] Back     alignment and taxonomy information
>gi|444727221|gb|ELW67724.1| Zinc finger protein 161 like protein [Tupaia chinensis] Back     alignment and taxonomy information
>gi|345486845|ref|XP_001607343.2| PREDICTED: zinc finger protein 778-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|357626639|gb|EHJ76661.1| hypothetical protein KGM_16713 [Danaus plexippus] Back     alignment and taxonomy information
>gi|403283576|ref|XP_003933193.1| PREDICTED: hypermethylated in cancer 1 protein [Saimiri boliviensis boliviensis] Back     alignment and taxonomy information
>gi|348526416|ref|XP_003450715.1| PREDICTED: zinc finger protein 574-like [Oreochromis niloticus] Back     alignment and taxonomy information
>gi|410050884|ref|XP_001174287.3| PREDICTED: LOW QUALITY PROTEIN: hypermethylated in cancer 1 protein [Pan troglodytes] Back     alignment and taxonomy information
>gi|345328272|ref|XP_001510594.2| PREDICTED: transcriptional repressor CTCFL [Ornithorhynchus anatinus] Back     alignment and taxonomy information
>gi|45384040|ref|NP_990492.1| zinc finger protein 161 homolog [Gallus gallus] gi|20141006|sp|Q92010.1|ZF161_CHICK RecName: Full=Zinc finger protein 161 homolog; Short=Zfp-161; AltName: Full=Zinc finger protein 5; Short=ZF5 gi|1399185|gb|AAB38387.1| zinc finger 5 protein [Gallus gallus] gi|1399187|gb|AAB38388.1| zinc finger 5 protein [Gallus gallus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query115
FB|FBgn0050431418 CG30431 [Drosophila melanogast 0.730 0.200 0.292 1.6e-09
UNIPROTKB|F1NA20448 ZFP161 "Zinc finger protein 16 0.678 0.174 0.404 5.1e-09
UNIPROTKB|Q92010448 ZBTB14 "Zinc finger and BTB do 0.678 0.174 0.404 5.1e-09
UNIPROTKB|F1MB88448 F1MB88 "Uncharacterized protei 0.678 0.174 0.404 5.1e-09
UNIPROTKB|F1LMU5448 Zfp161 "Protein Zfp161" [Rattu 0.678 0.174 0.404 5.1e-09
UNIPROTKB|J9NRM6449 ZFP161 "Uncharacterized protei 0.678 0.173 0.404 5.1e-09
UNIPROTKB|O43829449 ZBTB14 "Zinc finger and BTB do 0.678 0.173 0.404 5.1e-09
MGI|MGI:1195345449 Zbtb14 "zinc finger and BTB do 0.678 0.173 0.404 5.1e-09
UNIPROTKB|E2RED5593 MYNN "Uncharacterized protein" 0.565 0.109 0.338 5.3e-09
ZFIN|ZDB-GENE-040426-2946442 zbtb14 "zinc finger and BTB do 0.678 0.176 0.393 6.3e-09
FB|FBgn0050431 CG30431 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 146 (56.5 bits), Expect = 1.6e-09, P = 1.6e-09
 Identities = 26/89 (29%), Positives = 44/89 (49%)

Query:    27 CHHCEQFLPSSVDDLLLHSRKCASAHRPDKSYNYVCCICDYKSYKKSHMRDHIQSHLGDK 86
             C  C +  P+   DL  H R    +H P+    + C  C    + + H+  H+  H G+K
Sbjct:   324 CQRCSKSWPTK-SDLRTHMR----SHNPNMERPFKCDRCSKAFFTRGHLNSHLLVHTGEK 378

Query:    87 PFVCEHCFSNFARLRRLKEHILRMHPELI 115
             PF CE+C   +  +  L  H++R+H ++I
Sbjct:   379 PFACEYCDKCYQSVGNLNNHMVRLHADII 407




GO:0003676 "nucleic acid binding" evidence=ISS
GO:0008270 "zinc ion binding" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
GO:0003677 "DNA binding" evidence=IDA
UNIPROTKB|F1NA20 ZFP161 "Zinc finger protein 161 homolog" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q92010 ZBTB14 "Zinc finger and BTB domain-containing protein 14" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MB88 F1MB88 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1LMU5 Zfp161 "Protein Zfp161" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|J9NRM6 ZFP161 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|O43829 ZBTB14 "Zinc finger and BTB domain-containing protein 14" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1195345 Zbtb14 "zinc finger and BTB domain containing 14" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2RED5 MYNN "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2946 zbtb14 "zinc finger and BTB domain containing 14" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005


Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query115
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 1e-04
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 4e-04
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 5e-04
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 5e-04
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 5e-04
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 6e-04
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 6e-04
1llm_C88 Crystal Structure Of A Zif23-Gcn4 Chimera Bound To 6e-04
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 6e-04
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 6e-04
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 6e-04
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 6e-04
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure

Iteration: 1

Score = 41.2 bits (95), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 28/92 (30%), Positives = 45/92 (48%), Gaps = 9/92 (9%) Query: 22 SSGVWCHHCEQFLPSSVDDLLLHSRKCASAHRPDKSYNYVCCICDYKSYKKSHMRDHIQS 81 SSGV C C + + H + +H +K Y+ C +C + +K M H++S Sbjct: 5 SSGVACEICGKIFRD-----VYHLNRHKLSHSGEKPYS--CPVCGLRFKRKDRMSYHVRS 57 Query: 82 HLG--DKPFVCEHCFSNFARLRRLKEHILRMH 111 H G KP++C+ C F+R L HI ++H Sbjct: 58 HDGSVGKPYICQSCGKGFSRPDHLNGHIKQVH 89
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|1LLM|C Chain C, Crystal Structure Of A Zif23-Gcn4 Chimera Bound To Dna Length = 88 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query115
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 2e-07
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 1e-06
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-06
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 9e-04
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 4e-06
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 1e-05
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 6e-05
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 6e-05
2epa_A72 Krueppel-like factor 10; transforming growth facto 7e-05
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 2e-04
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 3e-04
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 4e-04
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 6e-04
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 8e-04
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 8e-04
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
 Score = 44.3 bits (105), Expect = 2e-07
 Identities = 14/57 (24%), Positives = 23/57 (40%), Gaps = 3/57 (5%)

Query: 60  YVCCICDYKSYKKSHMRDHIQSH---LGDKPFVCEHCFSNFARLRRLKEHILRMHPE 113
             C IC +   +K+ +  H + H   +    F CE C   F +   +  H  + HP 
Sbjct: 8   LQCEICGFTCRQKASLNWHQRKHAETVAALRFPCEFCGKRFEKPDSVAAHRSKSHPA 64


>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 102 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query115
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.93
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.89
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.89
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.88
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.88
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.88
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.88
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.87
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.87
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.86
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.86
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.86
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.86
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.84
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.83
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.83
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.83
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.82
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.82
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.82
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.82
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.81
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.79
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.79
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.79
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.79
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.77
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.77
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.77
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.76
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.75
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.75
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.75
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.73
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.72
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.7
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.68
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.67
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.67
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.66
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.66
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.66
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.66
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.65
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.64
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.63
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.63
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.63
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.63
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.63
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.62
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.62
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.62
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.61
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.61
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.59
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.59
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.59
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.59
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.58
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.58
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.58
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.58
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.57
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.55
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.54
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.53
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.52
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.5
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.5
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.48
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.48
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.46
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.46
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.45
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.45
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.45
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.43
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.42
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.42
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.4
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.4
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.39
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.39
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.39
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.38
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.38
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.38
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.38
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.38
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.38
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.37
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.37
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.37
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.37
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.37
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.37
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.37
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.37
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.37
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.37
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.37
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.37
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.37
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.37
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.36
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.36
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.36
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.36
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.36
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.36
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.36
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.36
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.36
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.36
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.36
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.36
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.35
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.35
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.35
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.35
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.35
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.35
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.34
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.34
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.34
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.34
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.34
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.34
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.34
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.33
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.33
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.33
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.33
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.33
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.33
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.33
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.33
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.33
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.33
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.33
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.33
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.33
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.32
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.32
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.32
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.32
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.32
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.32
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.32
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.32
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.32
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.32
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.32
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.32
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.31
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.31
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.31
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.31
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.31
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.3
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.3
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.3
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.3
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.3
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.3
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.3
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.3
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.3
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.3
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.3
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.3
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.29
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.29
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.29
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.29
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.29
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.28
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.28
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.28
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.28
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.28
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.28
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.27
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.27
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.27
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.27
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.26
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.26
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.26
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.26
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.26
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.25
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.25
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.25
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.25
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.25
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.25
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.25
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.25
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.25
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.24
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.24
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.24
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.24
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.24
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.24
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.24
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.24
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.24
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.24
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.24
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.24
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.24
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.23
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.23
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.23
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.23
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.23
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.23
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.22
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.22
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.22
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.22
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.22
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.22
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.22
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.22
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.22
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.21
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.21
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.21
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.21
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.21
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.21
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.21
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.21
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.2
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.2
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.2
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.2
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.2
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.2
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.2
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.2
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.2
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.19
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.19
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.19
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.19
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 99.19
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.19
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.18
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.18
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 99.18
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.18
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.18
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 99.18
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.18
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.17
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.17
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.17
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.17
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.17
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.17
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.17
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.16
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.16
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.16
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.16
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.16
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.16
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 99.16
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.15
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.15
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.15
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.14
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.13
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.13
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 99.12
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.12
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.12
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.11
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 99.11
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.09
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.09
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.08
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.08
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.07
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.06
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 99.05
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 99.02
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 99.0
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.96
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.95
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.94
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.94
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.93
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.91
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.91
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.9
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.9
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.9
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.9
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.89
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.89
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.89
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.88
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.87
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.86
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.85
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.83
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.82
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.8
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.79
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.78
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.78
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.78
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.75
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.75
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.74
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.74
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.74
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.73
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.72
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.72
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.71
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.67
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.63
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.63
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.6
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.6
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.59
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.59
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.56
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.56
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.54
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.54
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.52
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.52
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.51
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.51
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.91
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.51
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.5
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.9
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.5
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.49
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.49
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.44
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.43
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.41
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.41
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.41
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.4
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.39
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.37
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.36
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.36
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.36
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.34
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.33
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.32
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.31
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.3
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.3
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.59
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.55
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.52
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 98.13
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.36
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.98
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.92
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.72
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 97.22
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 96.97
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.4
2e72_A49 POGO transposable element with ZNF domain; zinc fi 95.96
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 95.8
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 95.74
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 94.86
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 94.59
2e72_A49 POGO transposable element with ZNF domain; zinc fi 94.1
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 93.28
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 93.23
2k5c_A95 Uncharacterized protein PF0385; structural genomic 92.3
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 88.83
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 88.57
1yuz_A202 Nigerythrin; rubrythrin, rubredoxin, hemerythrin, 84.55
2elu_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 81.86
2jvx_A28 NF-kappa-B essential modulator; CCHC classical zin 81.27
2jsp_A87 Transcriptional regulatory protein ROS; prokaryoti 80.21
3pwf_A170 Rubrerythrin; non heme iron peroxidases, oxidative 80.19
2i5o_A39 DNA polymerase ETA; zinc finger, DNA polymerase,PO 80.09
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
Probab=99.93  E-value=2.9e-26  Score=136.60  Aligned_cols=94  Identities=18%  Similarity=0.272  Sum_probs=88.4

Q ss_pred             ecceeeeecCCceeccccccccccchHHHHHHHHhhhccCCCCCCCCeEcCcCCcccCChhHHHHHHHhhCCCCCeecCc
Q psy13445         13 CYSKIVFFYSSGVWCHHCEQFLPSSVDDLLLHSRKCASAHRPDKSYNYVCCICDYKSYKKSHMRDHIQSHLGDKPFVCEH   92 (115)
Q Consensus        13 ~~~~~~~~~~~~~~C~~C~~~f~~~~~~l~~h~~~~~~~h~~~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~~k~~~C~~   92 (115)
                      +.++.++.|+++|.|.+|++.| .....|..|++    .|.++++  |.|++|++.|.....|..|+++|+|++||.|..
T Consensus        11 ~h~~~~h~Gek~y~C~~C~k~F-~~~~~L~~H~~----~H~~~k~--~~C~~C~k~F~~~~~L~~H~~~H~~~k~~~C~~   83 (133)
T 2lt7_A           11 DHYELIVDGRVYYICIVCKRSY-VCLTSLRRHFN----IHSWEKK--YPCRYCEKVFPLAEYRTKHEIHHTGERRYQCLA   83 (133)
T ss_dssp             SEEEEEETTEEEEEETTTCCEE-SCHHHHHHHHH----HHHCCSC--EECSSSSCEESSHHHHHHHHHHHHTCCCEEESS
T ss_pred             hhceeecCCCcCeECCCCCCCc-CCHHHHHHHHH----HcCCCCC--eeCCccCeecccccchhhhccccCCCccccCCC
Confidence            4567889999999999999999 99999999999    9999999  999999999999999999999999999999999


Q ss_pred             ccccccChHHHHHHHHhhCCCC
Q psy13445         93 CFSNFARLRRLKEHILRMHPEL  114 (115)
Q Consensus        93 C~~~f~~~~~l~~H~~~~h~~~  114 (115)
                      |++.|.+...|..|+ ++|.++
T Consensus        84 C~k~F~~~~~L~~H~-~~hh~~  104 (133)
T 2lt7_A           84 CGKSFINYQFMSSHI-KSVHSQ  104 (133)
T ss_dssp             SCCEESSHHHHHHHH-HHHTCC
T ss_pred             CCCCcCCHHHHHHHh-HHhcCC
Confidence            999999999999999 665543



>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>2k5c_A Uncharacterized protein PF0385; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Pyrococcus furiosus} Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>1yuz_A Nigerythrin; rubrythrin, rubredoxin, hemerythrin, electron transfer, DIIR center, oxidoreductase; 1.40A {Desulfovibrio vulgaris subsp} SCOP: a.25.1.1 g.41.5.1 PDB: 1yv1_A 1yux_A Back     alignment and structure
>2elu_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2elw_A Back     alignment and structure
>2jvx_A NF-kappa-B essential modulator; CCHC classical zinc finger, NEMO zinc finger, beta-BETA- alpha fold, coiled coil, cytoplasm, disease mutation; NMR {Synthetic} PDB: 2jvy_A Back     alignment and structure
>2jsp_A Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens} Back     alignment and structure
>3pwf_A Rubrerythrin; non heme iron peroxidases, oxidative stress, oxidoreductase; 1.64A {Pyrococcus furiosus} PDB: 3mps_A 3pza_A 3qvd_A 1nnq_A 2hr5_A Back     alignment and structure
>2i5o_A DNA polymerase ETA; zinc finger, DNA polymerase,POL ETA, UBZ, ubiquitin-binding zinc finger, translesion synthesis, ubiquitin-binding domain; HET: DNA; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 115
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 8e-05
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 0.002
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Transcriptional repressor CTCF
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 35.3 bits (82), Expect = 8e-05
 Identities = 13/32 (40%), Positives = 19/32 (59%)

Query: 82  HLGDKPFVCEHCFSNFARLRRLKEHILRMHPE 113
           H G+KP+ C  C + F +   +K HIL+ H E
Sbjct: 3   HSGEKPYECYICHARFTQSGTMKMHILQKHTE 34


>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query115
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.74
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.69
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.45
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.45
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.4
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.38
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.38
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.36
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.35
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.35
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.3
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.28
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.27
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.23
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.18
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.17
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.16
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.15
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.13
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 99.11
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.1
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.1
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.09
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.05
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.99
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.97
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.97
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.93
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.91
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.9
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.78
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.74
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.73
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.71
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.68
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.61
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.57
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.57
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.5
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.49
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.46
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.42
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.39
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.36
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.33
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.32
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.27
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.14
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.11
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.04
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 98.03
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 98.01
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.0
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.95
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.94
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.9
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.86
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.85
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.7
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.7
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.68
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.65
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.65
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.58
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.56
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.5
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.45
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.43
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.4
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.39
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.37
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.36
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.32
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.28
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.23
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.19
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.15
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.1
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.07
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.05
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.03
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.01
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 96.93
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 96.83
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.75
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.69
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.64
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.4
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 96.33
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 96.13
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 95.94
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.77
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.74
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 95.46
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 95.42
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.38
d1y0jb136 U-shaped transcription factor, different fingers { 95.04
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 94.48
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 94.45
d1y0jb136 U-shaped transcription factor, different fingers { 94.29
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 93.8
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 93.7
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 93.7
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 93.08
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 92.66
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 92.45
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 92.31
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 92.24
d1tf3a331 Transcription factor IIIA, TFIIIA {Xenopus laevis 92.23
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 91.89
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 91.74
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 91.58
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 91.4
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 90.88
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 90.54
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 90.17
d1wjpa341 Zinc finger protein 295, ZNF295 {Human (Homo sapie 89.32
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 89.18
d2ak3a237 Microbial and mitochondrial ADK, insert "zinc fing 87.93
d1fu9a_36 U-shaped transcription factor, different fingers { 86.0
d1m36a_33 Monocytic leukemia zinc finger protein Moz {Human 85.07
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 84.16
d1akya238 Microbial and mitochondrial ADK, insert "zinc fing 83.9
d2ghfa158 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 81.99
d2dkta174 RING finger and CHY zinc finger domain-containing 81.53
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.74  E-value=1.8e-18  Score=86.15  Aligned_cols=53  Identities=34%  Similarity=0.656  Sum_probs=43.3

Q ss_pred             CCCCCeEcCcCCcccCChhHHHHHHHhhCCCCCeecCcccccccChHHHHHHHHhhC
Q psy13445         55 DKSYNYVCCICDYKSYKKSHMRDHIQSHLGDKPFVCEHCFSNFARLRRLKEHILRMH  111 (115)
Q Consensus        55 ~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~~k~~~C~~C~~~f~~~~~l~~H~~~~h  111 (115)
                      +++  |.| .||+.|.....|..|+++|+|++||.|..||+.|.+.+.|..|+ ++|
T Consensus         1 EK~--y~C-~Cgk~F~~~~~l~~H~~~Ht~ekpy~C~~C~k~F~~~~~L~~H~-r~H   53 (53)
T d2csha1           1 DKL--YPC-QCGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHM-KIH   53 (53)
T ss_dssp             CCC--EEC-TTSCEESSHHHHHHHHHHHSCCCSEECTTTSCEESSSHHHHHHH-TTT
T ss_pred             CcC--CCC-CCCCeECCHHHhHHHhhccccccCCcCCCcCCEecCHHHHHHHH-hcC
Confidence            456  888 48888888888888888888888888888888888888888887 766



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1tf3a3 g.37.1.1 (A:71-101) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjpa3 g.37.1.1 (A:67-107) Zinc finger protein 295, ZNF295 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ak3a2 g.41.2.1 (A:125-161) Microbial and mitochondrial ADK, insert "zinc finger" domain {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1fu9a_ g.37.1.2 (A:) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m36a_ g.37.1.2 (A:) Monocytic leukemia zinc finger protein Moz {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1akya2 g.41.2.1 (A:131-168) Microbial and mitochondrial ADK, insert "zinc finger" domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dkta1 g.89.1.1 (A:8-81) RING finger and CHY zinc finger domain-containing protein 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure