Psyllid ID: psy13521

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360------
MPDTDELTFQKGDIFFVHNELGDGWLWVTAHRTGEQGMIFRDLVEDLDETIDPNTVFDWFHPECTKNDAVDMLVKAGPGSFLVRPSDNSPGDYSLFFHINNQIQRFRIEKKAVRYLMGGRTFECLDAVINRYRKEQIVEGHTLGFPVTRMSRQWKIATKGSCHKSFLVRPSDNSPGDYSLFFHINNQIQRFRIEKKAVRYLMGGRTFECLDAVINRYRKEQIVEGHTLGFPVTRTEDWFSLAGVTPIGEWGSLRLKFRYSHDLVMPSEEYSPLQQLLLESDLAVVKALADVCHGDRNRLASSLLRIFSLDVKETLPCSIFYAILFQTVTEVDAKIKPVQHAEKIYATLRECREQVGLKKIKGTYSI
cccccccccccccEEEEEEcccccEEEEEEcccccccEEEcccccccccccccccccccccccccHHHHHHHHccccccEEEEEEcccccccEEEEEEEccEEEEEEEEEcccEEEEcccccccHHHHHHHHHcccccccEEcccccccccccccccccccccccEEEcccccccccEEEEEEEccEEEEEEEEEcccEEccccEEEccHHHHHHHHHcccEEccccccccccccccccccccccccccccccHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccccccccHHHHcEEccccccccccccHHHHHHHHHHHHHHHccccccccccc
cccccccccccccEEEEEEcccccEEEEEEcccccccccccccEEEccccccHccHHHHHHccccHHHHHHHHHcccccEEEEEEcccccccEEEEEEcccEEEEEEEEccccEEEccccccccHHHHHHHHHHcccccEEEccccccccccccHcccccccccEEEEcccccccccEEEEEEccccEEEEEEcccccEEEEcHHHHHHHHHHHHHHcccHHHHHHEccccHHHHHHHHHcccHHHHHcccccccccccHHcHHccHHHHHHHHHHHcccccHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHcccHHHHEEEHcEcEcccccccHHHHHHHHHHHHHHHHHHcccEEccEccc
mpdtdeltfqkgdIFFVHnelgdgwlWVTAHRTGEQGMIFRDLVEdldetidpntvfdwfhpectkndAVDMLvkagpgsflvrpsdnspgdyslFFHINNQIQRFRIEKKAVRYLMGGRTFECLDAVINRYRKEQiveghtlgfpvtrmsrqwkiatkgschksflvrpsdnspgdyslFFHINNQIQRFRIEKKAVRYLMGGRTFECLDAVINRYRKEQIveghtlgfpvtrtedwfslagvtpigewgslrlkfryshdlvmpseeyspLQQLLLESDLAVVKALADVCHGDRNRLASSLLRIFSldvketlpcSIFYAILFQTVTEvdakikpvQHAEKIYATLRECREQvglkkikgtysi
mpdtdeltfqKGDIFFVHNELGDGWLWVTAHRTGEQGMIFRDLVEDLDETIDPNTVFDWFHPECTKNDAVDMLVKAGPGSFLVRPSDNSPGDYSLFFHINNQIQRFRIEKKAVRYLMGGRTFECLDAVINRYRKEQiveghtlgfpvtRMSRQWKIATKGSCHKSFLVRPSDNSPGDYSLFFHINNQIQRFRIEKKAVRYLMGGRTFECLDAVINRYRKEQIVEGHTLGFPVTRTEDWFSLAGVTPIGEWGSLRLKFRYSHDLVMPSEEYSPLQQLLLESDLAVVKALADVCHGDRNRLASSLLRIFSLDVKETLPCSIFYAILFQTVTEVDAKIKPVQHAEKIYATLRecreqvglkkikgtysi
MPDTDELTFQKGDIFFVHNELGDGWLWVTAHRTGEQGMIFRDLVEDLDETIDPNTVFDWFHPECTKNDAVDMLVKAGPGSFLVRPSDNSPGDYSLFFHINNQIQRFRIEKKAVRYLMGGRTFECLDAVINRYRKEQIVEGHTLGFPVTRMSRQWKIATKGSCHKSFLVRPSDNSPGDYSLFFHINNQIQRFRIEKKAVRYLMGGRTFECLDAVINRYRKEQIVEGHTLGFPVTRTEDWFSLAGVTPIGEWGSLRLKFRYSHDLVMPSEEYSPLQQLLLESDLAVVKALADVCHGDRNRLASSLLRIFSLDVKETLPCSIFYAILFQTVTEVDAKIKPVQHAEKIYATLRECREQVGLKKIKGTYSI
*******TFQKGDIFFVHNELGDGWLWVTAHRTGEQGMIFRDLVEDLDETIDPNTVFDWFHPECTKNDAVDMLVKAGPGSFLVRP****PGDYSLFFHINNQIQRFRIEKKAVRYLMGGRTFECLDAVINRYRKEQIVEGHTLGFPVTRMSRQWKIATKGSCHKSFLVRPSDNSPGDYSLFFHINNQIQRFRIEKKAVRYLMGGRTFECLDAVINRYRKEQIVEGHTLGFPVTRTEDWFSLAGVTPIGEWGSLRLKFRYSHDLVMPSEEYSPLQQLLLESDLAVVKALADVCHGDRNRLASSLLRIFSLDVKETLPCSIFYAILFQTVTEVDAKIKPVQHAEKIYATLRECREQVGLKKI******
*PDTDELTFQKGDIFFVHNELGDGWLWVTAHRTGEQGMIFRDLVEDLDETIDPNTVFDWFHPECTKNDAVDMLVKAGPGSFLVRPSDNSPGDYSLFFHINNQIQRFRIEKKAVRYLMGGRTFECLDAVINRYRKEQIVEGHTLGFPVTRMSRQWKIATKGSCHKSFLV*P******DYSLFFHINNQIQRFRIEKKAVRYLMGGRTFECLDAVINRYRKEQIVEGHTLGFPVTRTEDWFSLAG*********************MPSEEYSPLQQLLLESD***************NRLASSLLRIFSLDVKETLPCSIFYAILF*****************KIYATLREC***************
MPDTDELTFQKGDIFFVHNELGDGWLWVTAHRTGEQGMIFRDLVEDLDETIDPNTVFDWFHPECTKNDAVDMLVKAGPGSFLVRPSDNSPGDYSLFFHINNQIQRFRIEKKAVRYLMGGRTFECLDAVINRYRKEQIVEGHTLGFPVTRMSRQWKIATKGSCHKSFLVRPSDNSPGDYSLFFHINNQIQRFRIEKKAVRYLMGGRTFECLDAVINRYRKEQIVEGHTLGFPVTRTEDWFSLAGVTPIGEWGSLRLKFRYSHDLVMPSEEYSPLQQLLLESDLAVVKALADVCHGDRNRLASSLLRIFSLDVKETLPCSIFYAILFQTVTEVDAKIKPVQHAEKIYATLRECREQVGLKKIKGTYSI
*****ELTFQKGDIFFVHNELGDGWLWVTAHRTGEQGMIFRDLVEDLDETIDPNTVFDWFHPECTKNDAVDMLVKAGPGSFLVRPSDNSPGDYSLFFHINNQIQRFRIEKKAVRYLMGGRTFECLDAVINRYRKEQIVEGHTLGFPVTRMSRQWKIATKGSCHKSFLVRPSDNSPGDYSLFFHINNQIQRFRIEKKAVRYLMGGRTFECLDAVINRYRKEQIVEGHTLGFPVTRTEDWFSLAGVTPIGEWGSLRLKFRYSHDLVMPSEEYSPLQQLLLESDLAVVKALADVCHGDRNRLASSLLRIFSLDVKETLPCSIFYAILFQTVTEVDAKIKPVQHAEKIYATLRECREQVGLKKIKGTYSI
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPDTDELTFQKGDIFFVHNELGDGWLWVTAHRTGEQGMIFRDLVEDLDETIDPNTVFDWFHPECTKNDAVDMLVKAGPGSFLVRPSDNSPGDYSLFFHINNQIQRFRIEKKAVRYLMGGRTFECLDAVINRYRKEQIVEGHTLGFPVTRMSRQWKIATKGSCHKSFLVRPSDNSPGDYSLFFHINNQIQRFRIEKKAVRYLMGGRTFECLDAVINRYRKEQIVEGHTLGFPVTRTEDWFSLAGVTPIGEWGSLRLKFRYSHDLVMPSEEYSPLQQLLLESDLAVVKALADVCHGDRNRLASSLLRIFSLDVKETLPCSIFYAILFQTVTEVDAKIKPVQHAEKIYATLRECREQVGLKKIKGTYSI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query366 2.2.26 [Sep-21-2011]
P20936 1047 Ras GTPase-activating pro yes N/A 0.401 0.140 0.530 1e-39
P50904 1038 Ras GTPase-activating pro yes N/A 0.401 0.141 0.530 1e-39
P09851 1044 Ras GTPase-activating pro yes N/A 0.401 0.140 0.523 3e-39
P41499 597 Tyrosine-protein phosphat no N/A 0.461 0.283 0.299 2e-13
Q06124 597 Tyrosine-protein phosphat no N/A 0.461 0.283 0.299 3e-13
P35235 597 Tyrosine-protein phosphat no N/A 0.461 0.283 0.299 3e-13
Q90687 593 Tyrosine-protein phosphat no N/A 0.461 0.284 0.294 1e-12
P29351 595 Tyrosine-protein phosphat no N/A 0.450 0.277 0.288 3e-10
Q07883217 Growth factor receptor-bo no N/A 0.355 0.599 0.304 2e-09
P81718 613 Tyrosine-protein phosphat no N/A 0.450 0.269 0.283 2e-09
>sp|P20936|RASA1_HUMAN Ras GTPase-activating protein 1 OS=Homo sapiens GN=RASA1 PE=1 SV=1 Back     alignment and function desciption
 Score =  164 bits (414), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 105/149 (70%), Gaps = 2/149 (1%)

Query: 1   MPDTDELTFQKGDIFFVHNELGDGWLWVTAHRTGEQGMIFRDLVEDLDETIDPNTVFDWF 60
           +PDTDE++F KGD+F VHNEL DGW+WVT  RT EQG+I  DLVE++    DP+    WF
Sbjct: 293 VPDTDEISFLKGDMFIVHNELEDGWMWVTNLRTDEQGLIVEDLVEEVGREEDPHEGKIWF 352

Query: 61  HPECTKNDAVDMLVKAGP-GSFLVRPSDNSPGDYSLFFHINNQIQRFRI-EKKAVRYLMG 118
           H + +K +A ++L+  G   SFLVRPSDN+PGDYSL+F  N  IQRF+I      +++MG
Sbjct: 353 HGKISKQEAYNLLMTVGQVCSFLVRPSDNTPGDYSLYFRTNENIQRFKICPTPNNQFMMG 412

Query: 119 GRTFECLDAVINRYRKEQIVEGHTLGFPV 147
           GR +  +  +I+ YRKEQIVEG+ L  PV
Sbjct: 413 GRYYNSIGDIIDHYRKEQIVEGYYLKEPV 441
Inhibitory regulator of the Ras-cyclic AMP pathway. Stimulates the GTPase of normal but not oncogenic Ras p21; this stimulation may be further increased in the presence of NCK1.
Homo sapiens (taxid: 9606)
>sp|P50904|RASA1_RAT Ras GTPase-activating protein 1 OS=Rattus norvegicus GN=Rasa1 PE=3 SV=1 Back     alignment and function description
>sp|P09851|RASA1_BOVIN Ras GTPase-activating protein 1 OS=Bos taurus GN=RASA1 PE=1 SV=1 Back     alignment and function description
>sp|P41499|PTN11_RAT Tyrosine-protein phosphatase non-receptor type 11 OS=Rattus norvegicus GN=Ptpn11 PE=1 SV=4 Back     alignment and function description
>sp|Q06124|PTN11_HUMAN Tyrosine-protein phosphatase non-receptor type 11 OS=Homo sapiens GN=PTPN11 PE=1 SV=2 Back     alignment and function description
>sp|P35235|PTN11_MOUSE Tyrosine-protein phosphatase non-receptor type 11 OS=Mus musculus GN=Ptpn11 PE=1 SV=2 Back     alignment and function description
>sp|Q90687|PTN11_CHICK Tyrosine-protein phosphatase non-receptor type 11 OS=Gallus gallus GN=PTPN11 PE=2 SV=1 Back     alignment and function description
>sp|P29351|PTN6_MOUSE Tyrosine-protein phosphatase non-receptor type 6 OS=Mus musculus GN=Ptpn6 PE=1 SV=2 Back     alignment and function description
>sp|Q07883|GRB2_CHICK Growth factor receptor-bound protein 2 OS=Gallus gallus GN=GRB2 PE=1 SV=1 Back     alignment and function description
>sp|P81718|PTN6_RAT Tyrosine-protein phosphatase non-receptor type 6 OS=Rattus norvegicus GN=Ptpn6 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query366
312371316 955 hypothetical protein AND_22269 [Anophele 0.502 0.192 0.709 6e-79
158290606 948 AGAP002729-PA [Anopheles gambiae str. PE 0.502 0.194 0.709 8e-79
170033038 944 ras GTPase-activating protein 1 [Culex q 0.502 0.194 0.7 9e-79
357611680 946 ras gtpase activating protein [Danaus pl 0.398 0.154 0.918 1e-78
193606011 927 PREDICTED: ras GTPase-activating protein 0.412 0.162 0.888 3e-78
157134793 944 ras gtpase activating protein [Aedes aeg 0.502 0.194 0.695 5e-78
17863028 760 SD09318p [Drosophila melanogaster] 0.401 0.193 0.897 2e-77
195133728 954 GI16079 [Drosophila mojavensis] gi|19390 0.412 0.158 0.875 3e-77
195175107 903 GL15969 [Drosophila persimilis] gi|19411 0.743 0.301 0.524 3e-77
195432679 956 GK20115 [Drosophila willistoni] gi|19416 0.398 0.152 0.897 3e-77
>gi|312371316|gb|EFR19538.1| hypothetical protein AND_22269 [Anopheles darlingi] Back     alignment and taxonomy information
 Score =  300 bits (769), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 149/210 (70%), Positives = 159/210 (75%), Gaps = 26/210 (12%)

Query: 1   MPDTDELTFQKGDIFFVHNELGDGWLWVTAHRTGEQGMIFRDLVEDLDETIDPNTVFDWF 60
           MPDTDELTFQKGDIFFVHN++GDGWLWVTAHRTGEQGMIFR+LVEDLD  IDPNTVF WF
Sbjct: 191 MPDTDELTFQKGDIFFVHNDMGDGWLWVTAHRTGEQGMIFRELVEDLDPAIDPNTVFPWF 250

Query: 61  HPECTKNDAVDMLVKAGPGSFLVRPSDNSPGDYSLFFHINNQIQRFRIEKKAVRYLMGGR 120
           HP CTKN+AVDMLVKAGPGSFLVRPSDNSPGDYSLFFHINNQIQRFRIEKK VRYLMGGR
Sbjct: 251 HPTCTKNEAVDMLVKAGPGSFLVRPSDNSPGDYSLFFHINNQIQRFRIEKKGVRYLMGGR 310

Query: 121 TFECLDAVINRYRKEQIVEGHTLGFPVTRMSR------------QWKI------------ 156
           TFECLDAVINRYRKEQIVEGHTL  PV   S+              KI            
Sbjct: 311 TFECLDAVINRYRKEQIVEGHTLMHPVINGSQPEYHPPTNLASAAEKIYATLRECRDQNM 370

Query: 157 --ATKGSCHKSFLVRPSDNSPGDYSLFFHI 184
              TKG  H  +L++ SD +     LFF +
Sbjct: 371 LKKTKGIKHHGYLLKKSDKTAKWKQLFFAL 400

Source: Anopheles darlingi

Species: Anopheles darlingi

Genus: Anopheles

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|158290606|ref|XP_312197.3| AGAP002729-PA [Anopheles gambiae str. PEST] gi|157017976|gb|EAA08188.3| AGAP002729-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|170033038|ref|XP_001844386.1| ras GTPase-activating protein 1 [Culex quinquefasciatus] gi|167873500|gb|EDS36883.1| ras GTPase-activating protein 1 [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|357611680|gb|EHJ67606.1| ras gtpase activating protein [Danaus plexippus] Back     alignment and taxonomy information
>gi|193606011|ref|XP_001942745.1| PREDICTED: ras GTPase-activating protein 1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|157134793|ref|XP_001656445.1| ras gtpase activating protein [Aedes aegypti] gi|108884322|gb|EAT48547.1| AAEL000450-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|17863028|gb|AAL39991.1| SD09318p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195133728|ref|XP_002011291.1| GI16079 [Drosophila mojavensis] gi|193907266|gb|EDW06133.1| GI16079 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|195175107|ref|XP_002028303.1| GL15969 [Drosophila persimilis] gi|194117453|gb|EDW39496.1| GL15969 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|195432679|ref|XP_002064344.1| GK20115 [Drosophila willistoni] gi|194160429|gb|EDW75330.1| GK20115 [Drosophila willistoni] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query366
FB|FBgn0003969 954 vap "vacuolar peduncle" [Droso 0.401 0.154 0.897 2e-100
ZFIN|ZDB-GENE-030131-4694 995 rasa1a "RAS p21 protein activa 0.401 0.147 0.550 7.4e-54
UNIPROTKB|B4DTL2 880 RASA1 "Ras GTPase-activating p 0.418 0.173 0.509 3.1e-53
UNIPROTKB|E9PGC0 881 RASA1 "Ras GTPase-activating p 0.418 0.173 0.509 3.1e-53
UNIPROTKB|F1RP01 1043 RASA1 "Uncharacterized protein 0.418 0.146 0.509 4.3e-53
UNIPROTKB|P20936 1047 RASA1 "Ras GTPase-activating p 0.418 0.146 0.509 7.1e-53
UNIPROTKB|Q5RCK2 1047 DKFZp469B2218 "Putative unchar 0.418 0.146 0.509 7.1e-53
UNIPROTKB|F1PGT1 1024 RASA1 "Uncharacterized protein 0.418 0.149 0.509 8.2e-53
RGD|3537 1038 Rasa1 "RAS p21 protein activat 0.401 0.141 0.530 1.8e-52
UNIPROTKB|P50904 1038 Rasa1 "Ras GTPase-activating p 0.401 0.141 0.530 1.8e-52
FB|FBgn0003969 vap "vacuolar peduncle" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 734 (263.4 bits), Expect = 2.0e-100, Sum P(2) = 2.0e-100
 Identities = 132/147 (89%), Positives = 141/147 (95%)

Query:     1 MPDTDELTFQKGDIFFVHNELGDGWLWVTAHRTGEQGMIFRDLVEDLDETIDPNTVFDWF 60
             MP+TDEL+FQKGDIFFVHN++GDGWLWVTAHRTGEQGMIFR+LV+DLD +IDPNTVF WF
Sbjct:   195 MPETDELSFQKGDIFFVHNDMGDGWLWVTAHRTGEQGMIFRELVDDLDVSIDPNTVFPWF 254

Query:    61 HPECTKNDAVDMLVKAGPGSFLVRPSDNSPGDYSLFFHINNQIQRFRIEKKAVRYLMGGR 120
             HP CTKN+AVDMLVKAGPGSFLVRPSDNSPGDYSLFFHINNQIQRFRIEKK VRYLMGGR
Sbjct:   255 HPNCTKNEAVDMLVKAGPGSFLVRPSDNSPGDYSLFFHINNQIQRFRIEKKGVRYLMGGR 314

Query:   121 TFECLDAVINRYRKEQIVEGHTLGFPV 147
             TFECLDAVINRYRKEQIVEGH+L  PV
Sbjct:   315 TFECLDAVINRYRKEQIVEGHSLNHPV 341
GO:0016319 "mushroom body development" evidence=IMP
GO:0005099 "Ras GTPase activator activity" evidence=ISS;IBA;IDA
GO:0005737 "cytoplasm" evidence=IBA;IDA
GO:0010741 "negative regulation of intracellular protein kinase cascade" evidence=IGI
GO:0040008 "regulation of growth" evidence=IMP
GO:0032320 "positive regulation of Ras GTPase activity" evidence=IBA;IDA
GO:0048149 "behavioral response to ethanol" evidence=IMP
GO:0005543 "phospholipid binding" evidence=IEA
GO:0046580 "negative regulation of Ras protein signal transduction" evidence=IBA
GO:0031235 "intrinsic to internal side of plasma membrane" evidence=IBA
ZFIN|ZDB-GENE-030131-4694 rasa1a "RAS p21 protein activator 1a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|B4DTL2 RASA1 "Ras GTPase-activating protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E9PGC0 RASA1 "Ras GTPase-activating protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RP01 RASA1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P20936 RASA1 "Ras GTPase-activating protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5RCK2 DKFZp469B2218 "Putative uncharacterized protein DKFZp469B2218" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
UNIPROTKB|F1PGT1 RASA1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|3537 Rasa1 "RAS p21 protein activator (GTPase activating protein) 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P50904 Rasa1 "Ras GTPase-activating protein 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P20936RASA1_HUMANNo assigned EC number0.53020.40160.1404yesN/A
P50904RASA1_RATNo assigned EC number0.53020.40160.1416yesN/A
P09851RASA1_BOVINNo assigned EC number0.52340.40160.1408yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query366
cd1035477 cd10354, SH2_Cterm_RasGAP, C-terminal Src homology 1e-36
cd1035477 cd10354, SH2_Cterm_RasGAP, C-terminal Src homology 4e-25
cd1178859 cd11788, SH3_RasGAP, Src Homology 3 domain of Ras 2e-24
smart0025284 smart00252, SH2, Src homology 2 domains 8e-22
cd05391 328 cd05391, RasGAP_p120GAP, Ras-GTPase Activating Dom 2e-16
cd09932104 cd09932, SH2_C-SH2_PLC_gamma_like, C-terminal Src 3e-15
pfam0001777 pfam00017, SH2, SH2 domain 5e-15
cd0017379 cd00173, SH2, Src homology 2 (SH2) domain 2e-14
smart0025284 smart00252, SH2, Src homology 2 domains 4e-13
smart00323 344 smart00323, RasGAP, GTPase-activator protein for R 1e-11
cd0993199 cd09931, SH2_C-SH2_SHP_like, C-terminal Src homolo 6e-11
cd1034199 cd10341, SH2_N-SH2_PLC_gamma_like, N-terminal Src 7e-10
cd1034099 cd10340, SH2_N-SH2_SHP_like, N-terminal Src homolo 1e-09
cd0994195 cd09941, SH2_Grb2_like, Src homology 2 domain foun 5e-09
pfam0001777 pfam00017, SH2, SH2 domain 7e-09
cd1034886 cd10348, SH2_Cterm_shark_like, C-terminal Src homo 1e-08
cd0994393 cd09943, SH2_Nck_family, Src homology 2 (SH2) doma 1e-08
cd0993798 cd09937, SH2_csk_like, Src homology 2 (SH2) domain 1e-08
cd09932104 cd09932, SH2_C-SH2_PLC_gamma_like, C-terminal Src 2e-08
cd10353103 cd10353, SH2_Nterm_RasGAP, N-terminal Src homology 3e-08
cd1178955 cd11789, SH3_Nebulin_family_C, C-terminal Src Homo 1e-07
cd09933101 cd09933, SH2_Src_family, Src homology 2 (SH2) doma 1e-07
cd1040897 cd10408, SH2_Nck1, Src homology 2 (SH2) domain fou 2e-07
cd10343103 cd10343, SH2_SHIP, Src homology 2 (SH2) domain fou 3e-07
cd1040998 cd10409, SH2_Nck2, Src homology 2 (SH2) domain fou 4e-07
cd1036079 cd10360, SH2_Srm, Src homology 2 (SH2) domain foun 6e-07
cd0993199 cd09931, SH2_C-SH2_SHP_like, C-terminal Src homolo 9e-07
cd1034781 cd10347, SH2_Nterm_shark_like, N-terminal Src homo 9e-07
cd0017379 cd00173, SH2, Src homology 2 (SH2) domain 1e-06
cd1034199 cd10341, SH2_N-SH2_PLC_gamma_like, N-terminal Src 1e-06
cd0994393 cd09943, SH2_Nck_family, Src homology 2 (SH2) doma 2e-06
smart0032656 smart00326, SH3, Src homology 3 domains 2e-06
cd1193459 cd11934, SH3_Lasp1_C, C-terminal Src Homology 3 do 2e-06
pfam0001847 pfam00018, SH3_1, SH3 domain 3e-06
cd08400126 cd08400, C2_Ras_p21A1, C2 domain present in RAS p2 4e-06
cd1034099 cd10340, SH2_N-SH2_SHP_like, N-terminal Src homolo 5e-06
cd1040897 cd10408, SH2_Nck1, Src homology 2 (SH2) domain fou 1e-05
cd0017451 cd00174, SH3, Src Homology 3 domain superfamily 1e-05
cd1036079 cd10360, SH2_Srm, Src homology 2 (SH2) domain foun 2e-05
cd1038997 cd10389, SH2_SHB, Src homology 2 domain found in S 2e-05
cd10353103 cd10353, SH2_Nterm_RasGAP, N-terminal Src homology 4e-05
cd10364101 cd10364, SH2_Src_Lyn, Src homology 2 (SH2) domain 4e-05
cd0994598 cd09945, SH2_SHB_SHD_SHE_SHF_like, Src homology 2 5e-05
cd1040998 cd10409, SH2_Nck2, Src homology 2 (SH2) domain fou 7e-05
cd1193358 cd11933, SH3_Nebulin_C, C-terminal Src Homology 3 7e-05
cd09927116 cd09927, SH2_Tensin_like, Src homology 2 domain fo 9e-05
cd09926106 cd09926, SH2_CRK_like, Src homology 2 domain found 1e-04
cd1193558 cd11935, SH3_Nebulette_C, C-terminal Src Homology 1e-04
cd1178555 cd11785, SH3_SH3RF_C, C-terminal (Fourth) Src Homo 2e-04
cd1035592 cd10355, SH2_DAPP1_BAM32_like, Src homology 2 doma 2e-04
cd1184552 cd11845, SH3_Src_like, Src homology 3 domain of Sr 3e-04
cd0993594 cd09935, SH2_ABL, Src homology 2 (SH2) domain foun 3e-04
cd1034697 cd10346, SH2_SH2B_family, Src homology 2 (SH2) dom 8e-04
cd09930104 cd09930, SH2_cSH2_p85_like, C-terminal Src homolog 8e-04
cd1035291 cd10352, SH2_a2chimerin_b2chimerin, Src homology 2 9e-04
cd1194055 cd11940, SH3_ARHGEF5_19, Src homology 3 domain of 0.001
cd1177054 cd11770, SH3_Nephrocystin, Src Homology 3 domain o 0.001
cd1179064 cd11790, SH3_Amphiphysin, Src Homology 3 domain of 0.001
cd1034886 cd10348, SH2_Cterm_shark_like, C-terminal Src homo 0.002
cd09926106 cd09926, SH2_CRK_like, Src homology 2 domain found 0.002
cd10344104 cd10344, SH2_SLAP, Src homology 2 domain found in 0.002
cd1041197 cd10411, SH2_SH2B2, Src homology 2 (SH2) domain fo 0.002
cd10350103 cd10350, SH2_SH2D4A, Src homology 2 domain found i 0.004
cd1039298 cd10392, SH2_SHF, Src homology 2 domain found in S 0.004
cd1187854 cd11878, SH3_Bem1p_1, First Src Homology 3 domain 0.004
cd05137 356 cd05137, RasGAP_CLA2_BUD2, Ras-GTPase Activating D 0.004
cd10417102 cd10417, SH2_SH2D7, Src homology 2 domain found in 0.004
>gnl|CDD|198217 cd10354, SH2_Cterm_RasGAP, C-terminal Src homology 2 (SH2) domain found in Ras GTPase-activating protein 1 (GAP) Back     alignment and domain information 
 Score =  126 bits (319), Expect = 1e-36
 Identities = 41/76 (53%), Positives = 54/76 (71%), Gaps = 2/76 (2%)

Query: 59  WFHPECTKNDAVDMLVK-AGPGSFLVRPSDNSPGDYSLFFHINNQIQRFRIEKKAV-RYL 116
           WFH + ++ +A +MLVK  GPGSFLVR SDN+PGDYSL F +N  I+ F+I      +++
Sbjct: 2   WFHGKISREEAYNMLVKVGGPGSFLVRESDNTPGDYSLSFRVNEGIKHFKIIPTGNNQFM 61

Query: 117 MGGRTFECLDAVINRY 132
           MGGR F  LD VI+RY
Sbjct: 62  MGGRYFSSLDDVIDRY 77

RasGAP is part of the GAP1 family of GTPase-activating proteins. The protein is located in the cytoplasm and stimulates the GTPase activity of normal RAS p21, but not its oncogenic counterpart. Acting as a suppressor of RAS function, the protein enhances the weak intrinsic GTPase activity of RAS proteins resulting in RAS inactivation, thereby allowing control of cellular proliferation and differentiation. Mutations leading to changes in the binding sites of either protein are associated with basal cell carcinomas. Alternative splicing results in two isoforms. The shorter isoform which lacks the N-terminal hydrophobic region, has the same activity, and is expressed in placental tissues. In general longer isoform contains 2 SH2 domains, a SH3 domain, a pleckstrin homology (PH) domain, and a calcium-dependent phospholipid-binding C2 domain. The C-terminus contains the catalytic domain of RasGap which catalyzes the activation of Ras by hydrolyzing GTP-bound active Ras into an inactive GDP-bound form of Ras. This model contains the C-terminal SH2 domain. In general SH2 domains are involved in signal transduction. They typically bind pTyr-containing ligands via two surface pockets, a pTyr and hydrophobic binding pocket, allowing proteins with SH2 domains to localize to tyrosine phosphorylated sites. Length = 77
>gnl|CDD|198217 cd10354, SH2_Cterm_RasGAP, C-terminal Src homology 2 (SH2) domain found in Ras GTPase-activating protein 1 (GAP) Back     alignment and domain information
>gnl|CDD|212722 cd11788, SH3_RasGAP, Src Homology 3 domain of Ras GTPase-Activating Protein 1 Back     alignment and domain information
>gnl|CDD|214585 smart00252, SH2, Src homology 2 domains Back     alignment and domain information
>gnl|CDD|213340 cd05391, RasGAP_p120GAP, Ras-GTPase Activating Domain of p120 Back     alignment and domain information
>gnl|CDD|198186 cd09932, SH2_C-SH2_PLC_gamma_like, C-terminal Src homology 2 (C-SH2) domain in Phospholipase C gamma Back     alignment and domain information
>gnl|CDD|215658 pfam00017, SH2, SH2 domain Back     alignment and domain information
>gnl|CDD|198173 cd00173, SH2, Src homology 2 (SH2) domain Back     alignment and domain information
>gnl|CDD|214585 smart00252, SH2, Src homology 2 domains Back     alignment and domain information
>gnl|CDD|214617 smart00323, RasGAP, GTPase-activator protein for Ras-like GTPases Back     alignment and domain information
>gnl|CDD|198185 cd09931, SH2_C-SH2_SHP_like, C-terminal Src homology 2 (C-SH2) domain found in SH2 domain Phosphatases (SHP) proteins Back     alignment and domain information
>gnl|CDD|199829 cd10341, SH2_N-SH2_PLC_gamma_like, N-terminal Src homology 2 (N-SH2) domain in Phospholipase C gamma Back     alignment and domain information
>gnl|CDD|198203 cd10340, SH2_N-SH2_SHP_like, N-terminal Src homology 2 (N-SH2) domain found in SH2 domain Phosphatases (SHP) proteins Back     alignment and domain information
>gnl|CDD|199828 cd09941, SH2_Grb2_like, Src homology 2 domain found in Growth factor receptor-bound protein 2 (Grb2) and similar proteins Back     alignment and domain information
>gnl|CDD|215658 pfam00017, SH2, SH2 domain Back     alignment and domain information
>gnl|CDD|198211 cd10348, SH2_Cterm_shark_like, C-terminal Src homology 2 (SH2) domain found in SH2 domains, ANK, and kinase domain (shark) proteins Back     alignment and domain information
>gnl|CDD|198196 cd09943, SH2_Nck_family, Src homology 2 (SH2) domain found in the Nck family Back     alignment and domain information
>gnl|CDD|198190 cd09937, SH2_csk_like, Src homology 2 (SH2) domain found in Carboxyl-Terminal Src Kinase (Csk) Back     alignment and domain information
>gnl|CDD|198186 cd09932, SH2_C-SH2_PLC_gamma_like, C-terminal Src homology 2 (C-SH2) domain in Phospholipase C gamma Back     alignment and domain information
>gnl|CDD|198216 cd10353, SH2_Nterm_RasGAP, N-terminal Src homology 2 (SH2) domain found in Ras GTPase-activating protein 1 (GAP) Back     alignment and domain information
>gnl|CDD|212723 cd11789, SH3_Nebulin_family_C, C-terminal Src Homology 3 domain of the Nebulin family of proteins Back     alignment and domain information
>gnl|CDD|199827 cd09933, SH2_Src_family, Src homology 2 (SH2) domain found in the Src family of non-receptor tyrosine kinases Back     alignment and domain information
>gnl|CDD|198271 cd10408, SH2_Nck1, Src homology 2 (SH2) domain found in Nck Back     alignment and domain information
>gnl|CDD|198206 cd10343, SH2_SHIP, Src homology 2 (SH2) domain found in SH2-containing inositol-5'-phosphatase (SHIP) and SLAM-associated protein (SAP) Back     alignment and domain information
>gnl|CDD|198272 cd10409, SH2_Nck2, Src homology 2 (SH2) domain found in Nck Back     alignment and domain information
>gnl|CDD|198223 cd10360, SH2_Srm, Src homology 2 (SH2) domain found in Src-related kinase lacking C-terminal regulatory tyrosine and N-terminal myristoylation sites (srm) Back     alignment and domain information
>gnl|CDD|198185 cd09931, SH2_C-SH2_SHP_like, C-terminal Src homology 2 (C-SH2) domain found in SH2 domain Phosphatases (SHP) proteins Back     alignment and domain information
>gnl|CDD|198210 cd10347, SH2_Nterm_shark_like, N-terminal Src homology 2 (SH2) domain found in SH2 domains, ANK, and kinase domain (shark) proteins Back     alignment and domain information
>gnl|CDD|198173 cd00173, SH2, Src homology 2 (SH2) domain Back     alignment and domain information
>gnl|CDD|199829 cd10341, SH2_N-SH2_PLC_gamma_like, N-terminal Src homology 2 (N-SH2) domain in Phospholipase C gamma Back     alignment and domain information
>gnl|CDD|198196 cd09943, SH2_Nck_family, Src homology 2 (SH2) domain found in the Nck family Back     alignment and domain information
>gnl|CDD|214620 smart00326, SH3, Src homology 3 domains Back     alignment and domain information
>gnl|CDD|212867 cd11934, SH3_Lasp1_C, C-terminal Src Homology 3 domain of LIM and SH3 domain protein 1 Back     alignment and domain information
>gnl|CDD|215659 pfam00018, SH3_1, SH3 domain Back     alignment and domain information
>gnl|CDD|176045 cd08400, C2_Ras_p21A1, C2 domain present in RAS p21 protein activator 1 (RasA1) Back     alignment and domain information
>gnl|CDD|198203 cd10340, SH2_N-SH2_SHP_like, N-terminal Src homology 2 (N-SH2) domain found in SH2 domain Phosphatases (SHP) proteins Back     alignment and domain information
>gnl|CDD|198271 cd10408, SH2_Nck1, Src homology 2 (SH2) domain found in Nck Back     alignment and domain information
>gnl|CDD|212690 cd00174, SH3, Src Homology 3 domain superfamily Back     alignment and domain information
>gnl|CDD|198223 cd10360, SH2_Srm, Src homology 2 (SH2) domain found in Src-related kinase lacking C-terminal regulatory tyrosine and N-terminal myristoylation sites (srm) Back     alignment and domain information
>gnl|CDD|198252 cd10389, SH2_SHB, Src homology 2 domain found in SH2 domain-containing adapter protein B (SHB) Back     alignment and domain information
>gnl|CDD|198216 cd10353, SH2_Nterm_RasGAP, N-terminal Src homology 2 (SH2) domain found in Ras GTPase-activating protein 1 (GAP) Back     alignment and domain information
>gnl|CDD|198227 cd10364, SH2_Src_Lyn, Src homology 2 (SH2) domain found in Lyn Back     alignment and domain information
>gnl|CDD|198198 cd09945, SH2_SHB_SHD_SHE_SHF_like, Src homology 2 domain found in SH2 domain-containing adapter proteins B, D, E, and F (SHB, SHD, SHE, SHF) Back     alignment and domain information
>gnl|CDD|198272 cd10409, SH2_Nck2, Src homology 2 (SH2) domain found in Nck Back     alignment and domain information
>gnl|CDD|212866 cd11933, SH3_Nebulin_C, C-terminal Src Homology 3 domain of Nebulin Back     alignment and domain information
>gnl|CDD|198181 cd09927, SH2_Tensin_like, Src homology 2 domain found in Tensin-like proteins Back     alignment and domain information
>gnl|CDD|198180 cd09926, SH2_CRK_like, Src homology 2 domain found in cancer-related signaling adaptor protein CRK Back     alignment and domain information
>gnl|CDD|212868 cd11935, SH3_Nebulette_C, C-terminal Src Homology 3 domain of Nebulette and LIM-nebulette (or Lasp2) Back     alignment and domain information
>gnl|CDD|212719 cd11785, SH3_SH3RF_C, C-terminal (Fourth) Src Homology 3 domain of SH3 domain containing ring finger 1 (SH3RF1), SH3RF3, and similar domains Back     alignment and domain information
>gnl|CDD|198218 cd10355, SH2_DAPP1_BAM32_like, Src homology 2 domain found in dual adaptor for phosphotyrosine and 3-phosphoinositides ( DAPP1)/B lymphocyte adaptor molecule of 32 kDa (Bam32)-like proteins Back     alignment and domain information
>gnl|CDD|212779 cd11845, SH3_Src_like, Src homology 3 domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|198189 cd09935, SH2_ABL, Src homology 2 (SH2) domain found in Abelson murine lymphosarcoma virus (ABL) proteins Back     alignment and domain information
>gnl|CDD|198209 cd10346, SH2_SH2B_family, Src homology 2 (SH2) domain found in SH2B adapter protein family Back     alignment and domain information
>gnl|CDD|198184 cd09930, SH2_cSH2_p85_like, C-terminal Src homology 2 (cSH2) domain found in p85 Back     alignment and domain information
>gnl|CDD|198215 cd10352, SH2_a2chimerin_b2chimerin, Src homology 2 (SH2) domain found in alpha2-chimerin and beta2-chimerin proteins Back     alignment and domain information
>gnl|CDD|212873 cd11940, SH3_ARHGEF5_19, Src homology 3 domain of the Rho guanine nucleotide exchange factors ARHGEF5 and ARHGEF19 Back     alignment and domain information
>gnl|CDD|212704 cd11770, SH3_Nephrocystin, Src Homology 3 domain of Nephrocystin (or Nephrocystin-1) Back     alignment and domain information
>gnl|CDD|212724 cd11790, SH3_Amphiphysin, Src Homology 3 domain of Amphiphysin and related domains Back     alignment and domain information
>gnl|CDD|198211 cd10348, SH2_Cterm_shark_like, C-terminal Src homology 2 (SH2) domain found in SH2 domains, ANK, and kinase domain (shark) proteins Back     alignment and domain information
>gnl|CDD|198180 cd09926, SH2_CRK_like, Src homology 2 domain found in cancer-related signaling adaptor protein CRK Back     alignment and domain information
>gnl|CDD|198207 cd10344, SH2_SLAP, Src homology 2 domain found in Src-like adaptor proteins Back     alignment and domain information
>gnl|CDD|198274 cd10411, SH2_SH2B2, Src homology 2 (SH2) domain found in SH2B adapter proteins (SH2B1, SH2B2, SH2B3) Back     alignment and domain information
>gnl|CDD|198213 cd10350, SH2_SH2D4A, Src homology 2 domain found in the SH2 domain containing protein 4A (SH2D4A) Back     alignment and domain information
>gnl|CDD|198255 cd10392, SH2_SHF, Src homology 2 domain found in SH2 domain-containing adapter protein F (SHF) Back     alignment and domain information
>gnl|CDD|212811 cd11878, SH3_Bem1p_1, First Src Homology 3 domain of Bud emergence protein 1 and similar domains Back     alignment and domain information
>gnl|CDD|213339 cd05137, RasGAP_CLA2_BUD2, Ras-GTPase Activating Domain of CLA2/BUD2 Back     alignment and domain information
>gnl|CDD|199832 cd10417, SH2_SH2D7, Src homology 2 domain found in the SH2 domain containing protein 7 (SH2D7) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 366
KOG1264|consensus 1267 99.97
KOG4226|consensus379 99.95
KOG0790|consensus 600 99.93
KOG4278|consensus 1157 99.9
KOG0197|consensus468 99.9
KOG4637|consensus 464 99.88
cd0017394 SH2 Src homology 2 domains; Signal transduction, i 99.84
smart0025284 SH2 Src homology 2 domains. Src homology 2 domains 99.81
PF0001777 SH2: SH2 domain; InterPro: IPR000980 The Src homol 99.79
KOG2996|consensus865 99.75
KOG3508|consensus 932 99.73
KOG1264|consensus 1267 99.69
KOG4226|consensus379 99.69
KOG3601|consensus222 99.66
KOG0790|consensus 600 99.64
KOG4792|consensus293 99.56
KOG4637|consensus464 99.22
cd0017394 SH2 Src homology 2 domains; Signal transduction, i 99.21
KOG0194|consensus 474 99.1
smart0025284 SH2 Src homology 2 domains. Src homology 2 domains 99.1
PF0001777 SH2: SH2 domain; InterPro: IPR000980 The Src homol 99.07
KOG4278|consensus 1157 99.05
KOG0197|consensus 468 99.0
PF1460449 SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3 98.98
KOG1930|consensus483 98.96
cd05137 395 RasGAP_CLA2_BUD2 CLA2/BUD2 functions as a GTPase-a 98.84
PF14633220 SH2_2: SH2 domain; PDB: 3GXX_A 3GXW_B 3PJP_B 2XP1_ 98.83
PF0001848 SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Ho 98.76
PF0765355 SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 98.71
KOG3751|consensus622 98.53
cd05391 315 RasGAP_p120GAP p120GAP is a negative regulator of 98.46
smart0032658 SH3 Src homology 3 domains. Src homology 3 (SH3) d 98.39
cd0017454 SH3 Src homology 3 domains; SH3 domains bind to pr 98.37
KOG2199|consensus462 98.19
KOG2996|consensus865 98.15
KOG2070|consensus 661 98.06
KOG4792|consensus293 98.06
KOG1856|consensus1299 98.05
KOG3697|consensus345 97.69
KOG3601|consensus222 97.69
cd05134 310 RasGAP_RASA3 RASA3 (or GAP1_IP4BP) is a member of 97.52
smart00323 344 RasGAP GTPase-activator protein for Ras-like GTPas 97.41
cd05394 313 RasGAP_RASA2 RASA2 (or GAP1(m)) is a member of the 97.23
KOG4225|consensus489 97.09
KOG4348|consensus 627 96.91
KOG0194|consensus 474 96.85
KOG3875|consensus362 96.79
KOG2059|consensus 800 96.64
KOG1029|consensus1118 96.59
KOG4348|consensus627 96.02
cd05128 315 RasGAP_GAP1_like The GAP1 family of Ras GTPase-act 96.01
KOG4566|consensus258 95.79
cd04013146 C2_SynGAP_like C2 domain present in Ras GTPase act 95.74
KOG3523|consensus695 95.47
KOG1930|consensus483 95.23
KOG0609|consensus542 94.68
KOG3557|consensus721 94.66
KOG3632|consensus1335 94.43
KOG4575|consensus 874 94.17
KOG1029|consensus1118 94.07
PF14633220 SH2_2: SH2 domain; PDB: 3GXX_A 3GXW_B 3PJP_B 2XP1_ 94.02
PF1460389 hSH3: Helically-extended SH3 domain; PDB: 1RI9_A. 93.07
KOG3775|consensus482 91.79
cd05130 329 RasGAP_Neurofibromin Neurofibromin is the product 91.38
KOG4225|consensus489 90.23
KOG3508|consensus 932 89.93
KOG4773|consensus386 89.0
PF0823955 SH3_3: Bacterial SH3 domain; InterPro: IPR013247 S 88.98
cd05395 337 RasGAP_RASA4 Ras GTPase activating-like 4 protein 88.92
KOG2222|consensus848 88.53
cd08400126 C2_Ras_p21A1 C2 domain present in RAS p21 protein 87.48
smart0028763 SH3b Bacterial SH3 domain homologues. 87.09
KOG1856|consensus1299 86.61
KOG3751|consensus622 85.95
KOG0199|consensus 1039 84.31
KOG3812|consensus475 81.31
>KOG1264|consensus Back     alignment and domain information 
Probab=99.97  E-value=1.2e-30  Score=270.27  Aligned_cols=224  Identities=24%  Similarity=0.485  Sum_probs=180.4

Q ss_pred             CCCCCCCCCCEEEEEecCCCCeeEEEeCCCC---------------cccceeccccccccCCCCCCCcccCcCCccc-HH
Q psy13521          4 TDELTFQKGDIFFVHNELGDGWLWVTAHRTG---------------EQGMIFRDLVEDLDETIDPNTVFDWFHPECT-KN   67 (366)
Q Consensus         4 ~dELSF~kGD~l~Il~~~d~dWw~~~~~~tg---------------~~GlVPsnyV~~~~~~~~p~e~~~WyhG~Is-R~   67 (366)
                      +.+.++++| ++++-+..+..|-...=..+.               +.--+|..    ..++..-|-.+.||||++- |.
T Consensus       471 d~~nsvk~G-iLy~kd~vdheWt~h~fvlt~~kl~ys~e~~~~~n~ndee~~kd----~s~s~ElH~~E~WFHgkle~R~  545 (1267)
T KOG1264|consen  471 DHKNSVKQG-ILYMKDPVDHEWTRHYFVLTDAKLSYSDEIEQTENPNDEEVPKD----ISPSTELHFGEKWFHGKLEGRT  545 (1267)
T ss_pred             cchhhhhcc-eEEEecCCCCceeeeEEEEecceeEeehhccCcCCCCccccccc----CCcchhhccchhhhhcccccch
Confidence            345567777 567778778788543211121               11111111    0012233678899999998 99


Q ss_pred             HHHHHHhcC----C--CCcEEEecCCCCCCceEEEEeecCeeEEEEEEe--CC---eEEecCCcccCCHHHHHHHhhhcC
Q psy13521         68 DAVDMLVKA----G--PGSFLVRPSDNSPGDYSLFFHINNQIQRFRIEK--KA---VRYLMGGRTFECLDAVINRYRKEQ  136 (366)
Q Consensus        68 eAE~lL~~~----~--~GsFLVR~S~s~pg~y~LSv~~~~~V~H~rI~~--~g---~~y~~~~~~F~SL~eLV~~Y~~~~  136 (366)
                      +|+++|...    |  +|+||||+|++..|+|+||++.+|+|+|+||+.  .+   .+|+.++..|+||.+||.||+++.
T Consensus       546 eAekll~eycke~G~~dGtFlVReS~tFvgDytLSfwr~grv~HcRIrsk~e~gt~Kyyl~dN~vfdslY~LI~~Y~~~~  625 (1267)
T KOG1264|consen  546 EAEKLLQEYCKETGGKDGTFLVRESETFVGDYTLSFWRSGRVQHCRIRSKMEGGTLKYYLTDNLVFDSLYALIQHYRETH  625 (1267)
T ss_pred             HHHHHHHHHHHHhCCCCccEEEeeccccccceeeeeeECCceeeEEEEeeecCCceeEEEecchhHHHHHHHHHHHHhcc
Confidence            999999753    4  999999999999999999999999999999986  22   478999999999999999999998


Q ss_pred             Ccc---ceeecCCccCCCcc----h-----------hhhhcCCCcceeEeecCCCCCCceEEEEEeCCeEEEEEEeecCe
Q psy13521        137 IVE---GHTLGFPVTRMSRQ----W-----------KIATKGSCHKSFLVRPSDNSPGDYSLFFHINNQIQRFRIEKKAV  198 (366)
Q Consensus       137 l~l---~~~L~~Pv~~~~~~----~-----------~i~~~g~~~G~FLVR~S~~~~g~y~LSfv~~~~V~HykI~~~~~  198 (366)
                      +..   ..+|+.|||.|.|+    |           .+++.--.+|+||||.+ ..++.|++||..+++++||+|.+.|.
T Consensus       626 Lr~aeF~m~LtePvPqp~~He~k~W~~as~treqAE~mL~rvp~DGaFLiR~~-~~~nsy~iSfr~~gkikHcRi~rdGr  704 (1267)
T KOG1264|consen  626 LRCAEFEMRLTEPVPQPNPHESKPWYHASLTREQAEDMLMRVPRDGAFLIRKR-EGSNSYAISFRARGKIKHCRINRDGR  704 (1267)
T ss_pred             ccccceEEEecCCCCCCCcccCCccccccccHHHHHHHHhhCccCcceEEEec-cCCceEEEEEEEcCcEeEEEEccCce
Confidence            864   56999999999876    4           11344446899999955 55889999999999999999999999


Q ss_pred             EEEcCCCccCCHHHHHHHHHhcccccccccCCCCC
Q psy13521        199 RYLMGGRTFECLDAVINRYRKEQIVEGHTLGFPVT  233 (366)
Q Consensus       199 ~yi~~~~~F~sL~eLV~~Y~~~~i~~~~~L~~pv~  233 (366)
                      .|+.+.+.|+||++||+||.++++..+.+|.+||.
T Consensus       705 ~fvl~t~~FesLv~lv~yY~k~~lyR~mkLr~PVn  739 (1267)
T KOG1264|consen  705 HFVLGTSAFESLVELVSYYEKHPLYRKMKLRYPVN  739 (1267)
T ss_pred             EEEeccHHHHHHHHHHHHHhcChhhhcccccCcCC
Confidence            99999999999999999999999999999999987

>KOG4226|consensus Back     alignment and domain information
>KOG0790|consensus Back     alignment and domain information
>KOG4278|consensus Back     alignment and domain information
>KOG0197|consensus Back     alignment and domain information
>KOG4637|consensus Back     alignment and domain information
>cd00173 SH2 Src homology 2 domains; Signal transduction, involved in recognition of phosphorylated tyrosine (pTyr) Back     alignment and domain information
>smart00252 SH2 Src homology 2 domains Back     alignment and domain information
>PF00017 SH2: SH2 domain; InterPro: IPR000980 The Src homology 2 (SH2) domain is a protein domain of about 100 amino-acid residues first identified as a conserved sequence region between the oncoproteins Src and Fps [] Back     alignment and domain information
>KOG2996|consensus Back     alignment and domain information
>KOG3508|consensus Back     alignment and domain information
>KOG1264|consensus Back     alignment and domain information
>KOG4226|consensus Back     alignment and domain information
>KOG3601|consensus Back     alignment and domain information
>KOG0790|consensus Back     alignment and domain information
>KOG4792|consensus Back     alignment and domain information
>KOG4637|consensus Back     alignment and domain information
>cd00173 SH2 Src homology 2 domains; Signal transduction, involved in recognition of phosphorylated tyrosine (pTyr) Back     alignment and domain information
>KOG0194|consensus Back     alignment and domain information
>smart00252 SH2 Src homology 2 domains Back     alignment and domain information
>PF00017 SH2: SH2 domain; InterPro: IPR000980 The Src homology 2 (SH2) domain is a protein domain of about 100 amino-acid residues first identified as a conserved sequence region between the oncoproteins Src and Fps [] Back     alignment and domain information
>KOG4278|consensus Back     alignment and domain information
>KOG0197|consensus Back     alignment and domain information
>PF14604 SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3_A 2DE0_X 2D8H_A 2DA9_A 2X3X_E 2X3W_D 2KRN_A 2ED0_A Back     alignment and domain information
>KOG1930|consensus Back     alignment and domain information
>cd05137 RasGAP_CLA2_BUD2 CLA2/BUD2 functions as a GTPase-activating protein (GAP) for BUD1/RSR1 and is necessary for proper bud-site selection in yeast Back     alignment and domain information
>PF14633 SH2_2: SH2 domain; PDB: 3GXX_A 3GXW_B 3PJP_B 2XP1_A Back     alignment and domain information
>PF00018 SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>PF07653 SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>KOG3751|consensus Back     alignment and domain information
>cd05391 RasGAP_p120GAP p120GAP is a negative regulator of Ras that stimulates hydrolysis of bound GTP to GDP Back     alignment and domain information
>smart00326 SH3 Src homology 3 domains Back     alignment and domain information
>cd00174 SH3 Src homology 3 domains; SH3 domains bind to proline-rich ligands with moderate affinity and selectivity, preferentially to PxxP motifs; they play a role in the regulation of enzymes by intramolecular interactions, changing the subcellular localization of signal pathway components and mediate multiprotein complex assemblies Back     alignment and domain information
>KOG2199|consensus Back     alignment and domain information
>KOG2996|consensus Back     alignment and domain information
>KOG2070|consensus Back     alignment and domain information
>KOG4792|consensus Back     alignment and domain information
>KOG1856|consensus Back     alignment and domain information
>KOG3697|consensus Back     alignment and domain information
>KOG3601|consensus Back     alignment and domain information
>cd05134 RasGAP_RASA3 RASA3 (or GAP1_IP4BP) is a member of the GAP1 family and has been shown to specifically bind 1,3,4,5-tetrakisphosphate (IP4) Back     alignment and domain information
>smart00323 RasGAP GTPase-activator protein for Ras-like GTPases Back     alignment and domain information
>cd05394 RasGAP_RASA2 RASA2 (or GAP1(m)) is a member of the GAP1 family of Ras GTPase-activating proteins that includes GAP1_IP4BP (or RASA3), CAPRI, and RASAL Back     alignment and domain information
>KOG4225|consensus Back     alignment and domain information
>KOG4348|consensus Back     alignment and domain information
>KOG0194|consensus Back     alignment and domain information
>KOG3875|consensus Back     alignment and domain information
>KOG2059|consensus Back     alignment and domain information
>KOG1029|consensus Back     alignment and domain information
>KOG4348|consensus Back     alignment and domain information
>cd05128 RasGAP_GAP1_like The GAP1 family of Ras GTPase-activating proteins includes GAP1(m) (or RASA2), GAP1_IP4BP (or RASA3), Ca2+ -promoted Ras inactivator (CAPRI, or RASAL4), and Ras GTPase activating-like proteins (RASAL) or RASAL1 Back     alignment and domain information
>KOG4566|consensus Back     alignment and domain information
>cd04013 C2_SynGAP_like C2 domain present in Ras GTPase activating protein (GAP) family Back     alignment and domain information
>KOG3523|consensus Back     alignment and domain information
>KOG1930|consensus Back     alignment and domain information
>KOG0609|consensus Back     alignment and domain information
>KOG3557|consensus Back     alignment and domain information
>KOG3632|consensus Back     alignment and domain information
>KOG4575|consensus Back     alignment and domain information
>KOG1029|consensus Back     alignment and domain information
>PF14633 SH2_2: SH2 domain; PDB: 3GXX_A 3GXW_B 3PJP_B 2XP1_A Back     alignment and domain information
>PF14603 hSH3: Helically-extended SH3 domain; PDB: 1RI9_A Back     alignment and domain information
>KOG3775|consensus Back     alignment and domain information
>cd05130 RasGAP_Neurofibromin Neurofibromin is the product of the neurofibromatosis type 1 gene (NF1) and shares a region of similarity with catalytic domain of the mammalian p120RasGAP protein and an extended similarity with the Saccharomyces cerevisiae RasGAP proteins Ira1 and Ira2 Back     alignment and domain information
>KOG4225|consensus Back     alignment and domain information
>KOG3508|consensus Back     alignment and domain information
>KOG4773|consensus Back     alignment and domain information
>PF08239 SH3_3: Bacterial SH3 domain; InterPro: IPR013247 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>cd05395 RasGAP_RASA4 Ras GTPase activating-like 4 protein (RASAL4), also known as Ca2+ -promoted Ras inactivator (CAPRI), is a member of the GAP1 family Back     alignment and domain information
>KOG2222|consensus Back     alignment and domain information
>cd08400 C2_Ras_p21A1 C2 domain present in RAS p21 protein activator 1 (RasA1) Back     alignment and domain information
>smart00287 SH3b Bacterial SH3 domain homologues Back     alignment and domain information
>KOG1856|consensus Back     alignment and domain information
>KOG3751|consensus Back     alignment and domain information
>KOG0199|consensus Back     alignment and domain information
>KOG3812|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query366
2gsb_A119 Solution Structure Of The Second Sh2 Domain Of Huma 1e-20
2gsb_A119 Solution Structure Of The Second Sh2 Domain Of Huma 1e-16
2shp_A 525 Tyrosine Phosphatase Shp-2 Length = 525 5e-14
2gqi_A71 Solution Structure Of The Sh3 Domain Of Human Ras G 3e-13
2j05_A65 Crystal Structure Of The Rasgap Sh3 Domain At 1.5 A 2e-12
4fss_A62 Crystal Structure Of A Ras P21 Protein Activator (R 2e-12
1gri_A217 Grb2 Length = 217 3e-10
2b3o_A 532 Crystal Structure Of Human Tyrosine Phosphatase Shp 2e-09
3ps5_A 595 Crystal Structure Of The Full-Length Human Protein 2e-09
1aya_A101 Crystal Structures Of Peptide Complexes Of The Amin 8e-08
3tl0_A109 Structure Of Shp2 N-Sh2 Domain In Complex With Rlnp 1e-07
1k9a_A450 Crystal Structure Analysis Of Full-Length Carboxyl- 1e-07
3gqi_B226 Crystal Structure Of Activated Receptor Tyrosine Ki 2e-07
4ey0_A246 Structure Of Tandem Sh2 Domains From Plcgamma1 Leng 3e-07
4fbn_A246 Insights Into Structural Integration Of The Plcgamm 3e-07
1wq1_G 334 Ras-Rasgap Complex Length = 334 6e-07
2ci8_A99 Sh2 Domain Of Human Nck1 Adaptor Protein - Uncomple 2e-06
2ci8_A99 Sh2 Domain Of Human Nck1 Adaptor Protein - Uncomple 2e-04
2ci9_A102 Nck1 Sh2-Domain In Complex With A Dodecaphosphopept 2e-06
2ci9_A102 Nck1 Sh2-Domain In Complex With A Dodecaphosphopept 1e-04
3nhn_A193 Crystal Structure Of The Src-Family Kinase Hck Sh3- 3e-06
2fci_A105 Structural Basis For The Requirement Of Two Phospho 3e-06
1r1p_A100 Structural Basis For Differential Recognition Of Ty 4e-06
1qcf_A454 Crystal Structure Of Hck In Complex With A Src Fami 4e-06
1ad5_A438 Src Family Kinase Hck-Amp-Pnp Complex Length = 438 4e-06
1z3k_A98 Structural Insight Into The Binding Diversity Betwe 1e-05
2cia_A102 Human Nck2 Sh2-Domain In Complex With A Decaphospho 1e-05
2cia_A102 Human Nck2 Sh2-Domain In Complex With A Decaphospho 8e-04
1g83_A165 Crystal Structure Of Fyn Sh3-Sh2 Length = 165 1e-05
3eac_A106 Crystal Structure Of Sh2 Domain Of Human Csk (Carbo 2e-05
3uf4_A164 Crystal Structure Of A Sh3 And Sh2 Domains Of Fyn P 2e-05
3eaz_A106 Crystal Structure Of Sh2 Domain Of Human Csk (Carbo 2e-05
1jyq_A96 Xray Structure Of Grb2 Sh2 Domain Complexed With A 3e-05
1ghu_A107 Nmr Solution Structure Of Growth Factor Receptor-Bo 3e-05
3mxc_A101 Structures Of Grb2-Sh2 Domain And Aicd Peptide Comp 3e-05
1tze_E98 Signal Transduction Adaptor Growth Factor, Grb2 Sh2 3e-05
2aoa_A99 Crystal Structures Of A High-affinity Macrocyclic P 3e-05
1cj1_A96 Growth Factor Receptor Binding Protein Sh2 Domain ( 3e-05
1x0n_A104 Nmr Structure Of Growth Factor Receptor Binding Pro 3e-05
1zfp_E98 Growth Factor Receptor Binding Protein Sh2 Domain C 3e-05
1fhs_A112 The Three-Dimensional Solution Structure Of The Src 4e-05
3n84_A112 Crystal Structure Of The Grb2 Sh2 Domain In Complex 4e-05
2h46_E116 Native Domain-Swapped Dimer Crystal Structure Of Th 4e-05
1fyr_A114 Dimer Formation Through Domain Swapping In The Crys 4e-05
3ove_A117 Crystal Structure Of The Grb2 Sh2 Domain In Complex 4e-05
3imd_A117 Crystal Structure Of The Grb2 Sh2 Domain In Complex 4e-05
1bmb_A123 Grb2-Sh2 Domain In Complex With KpfyVnvef (Pkf270-9 4e-05
1bm2_A117 Grb2-Sh2 Domain In Complex With Cyclo-[n-Alpha-Acet 5e-05
3i35_A60 Human Sh3 Domain Of Protein Lasp1 Length = 60 2e-04
2fo0_A495 Organization Of The Sh3-Sh2 Unit In Active And Inac 4e-04
2dx0_A138 Crystal Structure Of The N-Terminal Sh2 Domain Of M 4e-04
1opk_A495 Structural Basis For The Auto-Inhibition Of C-Abl T 4e-04
2eob_A124 Solution Structure Of The Second Sh2 Domain From Ra 4e-04
1opl_A537 Structural Basis For The Auto-Inhibition Of C-Abl T 5e-04
2abl_A163 Sh3-Sh2 Domain Fragment Of Human Bcr-Abl Tyrosine K 6e-04
1fmk_A452 Crystal Structure Of Human Tyrosine-Protein Kinase 6e-04
1y57_A452 Structure Of Unphosphorylated C-Src In Complex With 6e-04
1ksw_A452 Structure Of Human C-Src Tyrosine Kinase (Thr338gly 6e-04
2h8h_A535 Src Kinase In Complex With A Quinazoline Inhibitor 7e-04
1x27_A167 Crystal Structure Of Lck Sh2-Sh3 With Sh2 Binding S 7e-04
1lck_A175 Sh3-Sh2 Domain Fragment Of Human P56-Lck Tyrosine K 7e-04
4d8k_A175 Crystal Structure Of A Sh3-Sh2 Domains Of A Lymphoc 8e-04
>pdb|2GSB|A Chain A, Solution Structure Of The Second Sh2 Domain Of Human Ras Gtpase-Activating Protein 1 Length = 119 Back     alignment and structure 
Iteration: 1

 Score = 97.4 bits (241), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 48/98 (48%), Positives = 66/98 (67%), Gaps = 2/98 (2%)
Query: 52  DPNTVFDWFHPECTKNDAVDMLVKAGP-GSFLVRPSDNSPGDYSLFFHINNQIQRFRI-E 109
           DP+    WFH + +K +A ++L+  G   SFLVRPSDN+PGDYSL+F  N  IQRF+I  
Sbjct: 11  DPHEGKIWFHGKISKQEAYNLLMTVGQVCSFLVRPSDNTPGDYSLYFRTNENIQRFKICP 70
Query: 110 KKAVRYLMGGRTFECLDAVINRYRKEQIVEGHTLGFPV 147
               +++MGGR +  +  +I+ YRKEQIVEG+ L  PV
Sbjct: 71  TPNNQFMMGGRYYNSIGDIIDHYRKEQIVEGYYLKEPV 108
>pdb|2GSB|A Chain A, Solution Structure Of The Second Sh2 Domain Of Human Ras Gtpase-Activating Protein 1 Length = 119 Back     alignment and structure
>pdb|2SHP|A Chain A, Tyrosine Phosphatase Shp-2 Length = 525 Back     alignment and structure
>pdb|2GQI|A Chain A, Solution Structure Of The Sh3 Domain Of Human Ras Gtpase- Activating Protein 1 Length = 71 Back     alignment and structure
>pdb|2J05|A Chain A, Crystal Structure Of The Rasgap Sh3 Domain At 1.5 Angstrom Resolution Length = 65 Back     alignment and structure
>pdb|4FSS|A Chain A, Crystal Structure Of A Ras P21 Protein Activator (Rasa1) From Homo Sapiens At 2.25 A Resolution Length = 62 Back     alignment and structure
>pdb|1GRI|A Chain A, Grb2 Length = 217 Back     alignment and structure
>pdb|2B3O|A Chain A, Crystal Structure Of Human Tyrosine Phosphatase Shp-1 Length = 532 Back     alignment and structure
>pdb|3PS5|A Chain A, Crystal Structure Of The Full-Length Human Protein Tyrosine Phosphatase Shp-1 Length = 595 Back     alignment and structure
>pdb|1AYA|A Chain A, Crystal Structures Of Peptide Complexes Of The Amino- Terminal Sh2 Domain Of The Syp Tyrosine Phosphatase Length = 101 Back     alignment and structure
>pdb|3TL0|A Chain A, Structure Of Shp2 N-Sh2 Domain In Complex With Rlnpyaqlwhr Peptide Length = 109 Back     alignment and structure
>pdb|1K9A|A Chain A, Crystal Structure Analysis Of Full-Length Carboxyl-Terminal Src Kinase At 2.5 A Resolution Length = 450 Back     alignment and structure
>pdb|3GQI|B Chain B, Crystal Structure Of Activated Receptor Tyrosine Kinase In Complex With Substrates Length = 226 Back     alignment and structure
>pdb|4EY0|A Chain A, Structure Of Tandem Sh2 Domains From Plcgamma1 Length = 246 Back     alignment and structure
>pdb|4FBN|A Chain A, Insights Into Structural Integration Of The Plcgamma Regulatory Region And Mechanism Of Autoinhibition And Activation Based On Key Roles Of Sh2 Domains Length = 246 Back     alignment and structure
>pdb|1WQ1|G Chain G, Ras-Rasgap Complex Length = 334 Back     alignment and structure
>pdb|2CI8|A Chain A, Sh2 Domain Of Human Nck1 Adaptor Protein - Uncomplexed Length = 99 Back     alignment and structure
>pdb|2CI8|A Chain A, Sh2 Domain Of Human Nck1 Adaptor Protein - Uncomplexed Length = 99 Back     alignment and structure
>pdb|2CI9|A Chain A, Nck1 Sh2-Domain In Complex With A Dodecaphosphopeptide From Epec Protein Tir Length = 102 Back     alignment and structure
>pdb|2CI9|A Chain A, Nck1 Sh2-Domain In Complex With A Dodecaphosphopeptide From Epec Protein Tir Length = 102 Back     alignment and structure
>pdb|3NHN|A Chain A, Crystal Structure Of The Src-Family Kinase Hck Sh3-Sh2-Linker Regulatory Region Length = 193 Back     alignment and structure
>pdb|2FCI|A Chain A, Structural Basis For The Requirement Of Two Phosphotyrosines In Signaling Mediated By Syk Tyrosine Kinase Length = 105 Back     alignment and structure
>pdb|1R1P|A Chain A, Structural Basis For Differential Recognition Of Tyrosine Phosphorylated Sites In The Linker For Activation Of T Cells (lat) By The Adaptor Protein Gads Length = 100 Back     alignment and structure
>pdb|1QCF|A Chain A, Crystal Structure Of Hck In Complex With A Src Family- Selective Tyrosine Kinase Inhibitor Length = 454 Back     alignment and structure
>pdb|1AD5|A Chain A, Src Family Kinase Hck-Amp-Pnp Complex Length = 438 Back     alignment and structure
>pdb|1Z3K|A Chain A, Structural Insight Into The Binding Diversity Between The Tyr-Phosphorylated Human Ephrinbs And Nck2 Sh2 Domain Length = 98 Back     alignment and structure
>pdb|2CIA|A Chain A, Human Nck2 Sh2-Domain In Complex With A Decaphosphopeptide From Translocated Intimin Receptor (Tir) Of Epec Length = 102 Back     alignment and structure
>pdb|2CIA|A Chain A, Human Nck2 Sh2-Domain In Complex With A Decaphosphopeptide From Translocated Intimin Receptor (Tir) Of Epec Length = 102 Back     alignment and structure
>pdb|1G83|A Chain A, Crystal Structure Of Fyn Sh3-Sh2 Length = 165 Back     alignment and structure
>pdb|3EAC|A Chain A, Crystal Structure Of Sh2 Domain Of Human Csk (Carboxyl- Terminal Src Kinase), Oxidized Form Length = 106 Back     alignment and structure
>pdb|3UF4|A Chain A, Crystal Structure Of A Sh3 And Sh2 Domains Of Fyn Protein (Proto- Concogene Tyrosine-Protein Kinase Fyn) From Mus Musculus At 1.98 A Resolution Length = 164 Back     alignment and structure
>pdb|3EAZ|A Chain A, Crystal Structure Of Sh2 Domain Of Human Csk (Carboxyl- Terminal Src Kinase), C122s Mutant Length = 106 Back     alignment and structure
>pdb|1JYQ|A Chain A, Xray Structure Of Grb2 Sh2 Domain Complexed With A Highly Affine Phospho Peptide Length = 96 Back     alignment and structure
>pdb|1GHU|A Chain A, Nmr Solution Structure Of Growth Factor Receptor-Bound Protein 2 (Grb2) Sh2 Domain, 24 Structures Length = 107 Back     alignment and structure
>pdb|3MXC|A Chain A, Structures Of Grb2-Sh2 Domain And Aicd Peptide Complexes Reveal A Conformational Switch And Their Functional Implications. Length = 101 Back     alignment and structure
>pdb|1TZE|E Chain E, Signal Transduction Adaptor Growth Factor, Grb2 Sh2 Domain Complexed With Phosphotyrosyl Heptapeptide Lys-Pro-Phe-Ptyr-Val-Asn-Val-Nh2 (Kfppyvnc-Nh2) Length = 98 Back     alignment and structure
>pdb|2AOA|A Chain A, Crystal Structures Of A High-affinity Macrocyclic Peptide Mimetic In Complex With The Grb2 Sh2 Domain Length = 99 Back     alignment and structure
>pdb|1CJ1|A Chain A, Growth Factor Receptor Binding Protein Sh2 Domain (Human) Complexed With A Phosphotyrosyl Derivative Length = 96 Back     alignment and structure
>pdb|1X0N|A Chain A, Nmr Structure Of Growth Factor Receptor Binding Protein Sh2 Domain Complexed With The Inhibitor Length = 104 Back     alignment and structure
>pdb|1ZFP|E Chain E, Growth Factor Receptor Binding Protein Sh2 Domain Complexed With A Phosphotyrosyl Pentapeptide Length = 98 Back     alignment and structure
>pdb|1FHS|A Chain A, The Three-Dimensional Solution Structure Of The Src Homology Domain-2 Of The Growth Factor Receptor Bound Protein-2, Nmr, 18 Structures Length = 112 Back     alignment and structure
>pdb|3N84|A Chain A, Crystal Structure Of The Grb2 Sh2 Domain In Complex With A 23-Membered Macrocyclic Ligand Having The Sequence Pyvnvp Length = 112 Back     alignment and structure
>pdb|2H46|E Chain E, Native Domain-Swapped Dimer Crystal Structure Of The Grb2 Sh2 Domain Length = 116 Back     alignment and structure
>pdb|1FYR|A Chain A, Dimer Formation Through Domain Swapping In The Crystal Structure Of The Grb2-Sh2 Ac-Pyvnv Complex Length = 114 Back     alignment and structure
>pdb|3OVE|A Chain A, Crystal Structure Of The Grb2 Sh2 Domain In Complex With A Pyxn- Derived Tripeptide Length = 117 Back     alignment and structure
>pdb|3IMD|A Chain A, Crystal Structure Of The Grb2 Sh2 Domain In Complex With A Flexible Ac-Py-Q-N-Nh2 Tripeptide Mimic Length = 117 Back     alignment and structure
>pdb|1BMB|A Chain A, Grb2-Sh2 Domain In Complex With KpfyVnvef (Pkf270-974) Length = 123 Back     alignment and structure
>pdb|1BM2|A Chain A, Grb2-Sh2 Domain In Complex With Cyclo-[n-Alpha-Acetyl-L-Thi Alysyl-O-Phosphotyrosyl-Valyl-Asparagyl-Valyl-Prolyl] (Pkf273-791) Length = 117 Back     alignment and structure
>pdb|3I35|A Chain A, Human Sh3 Domain Of Protein Lasp1 Length = 60 Back     alignment and structure
>pdb|2DX0|A Chain A, Crystal Structure Of The N-Terminal Sh2 Domain Of Mouse Phospholipase C-Gamma 2 Length = 138 Back     alignment and structure
>pdb|1OPK|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 495 Back     alignment and structure
>pdb|2EOB|A Chain A, Solution Structure Of The Second Sh2 Domain From Rat Plc Gamma-2 Length = 124 Back     alignment and structure
>pdb|1OPL|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 537 Back     alignment and structure
>pdb|2ABL|A Chain A, Sh3-Sh2 Domain Fragment Of Human Bcr-Abl Tyrosine Kinase Length = 163 Back     alignment and structure
>pdb|1FMK|A Chain A, Crystal Structure Of Human Tyrosine-Protein Kinase C-Src Length = 452 Back     alignment and structure
>pdb|1Y57|A Chain A, Structure Of Unphosphorylated C-Src In Complex With An Inhibitor Length = 452 Back     alignment and structure
>pdb|1KSW|A Chain A, Structure Of Human C-Src Tyrosine Kinase (Thr338gly Mutant) In Complex With N6-Benzyl Adp Length = 452 Back     alignment and structure
>pdb|2H8H|A Chain A, Src Kinase In Complex With A Quinazoline Inhibitor Length = 535 Back     alignment and structure
>pdb|1X27|A Chain A, Crystal Structure Of Lck Sh2-Sh3 With Sh2 Binding Site Of P130cas Length = 167 Back     alignment and structure
>pdb|1LCK|A Chain A, Sh3-Sh2 Domain Fragment Of Human P56-Lck Tyrosine Kinase Complexed With The 10 Residue Synthetic Phosphotyrosyl Peptide Tegqpyqpqpa Length = 175 Back     alignment and structure
>pdb|4D8K|A Chain A, Crystal Structure Of A Sh3-Sh2 Domains Of A Lymphocyte-Specific Protein Tyrosine Kinase (Lck) From Homo Sapiens At 2.36 A Resolution Length = 175 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query366
3gqi_B226 Phospholipase C-gamma-1; phosphorylated kinase, PY 3e-31
3gqi_B226 Phospholipase C-gamma-1; phosphorylated kinase, PY 1e-20
3gqi_B226 Phospholipase C-gamma-1; phosphorylated kinase, PY 1e-07
2gsb_A119 RAS GTPase-activating protein 1; GAP, RAS P21 prot 6e-29
2gsb_A119 RAS GTPase-activating protein 1; GAP, RAS P21 prot 4e-19
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 2e-24
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 8e-07
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 5e-06
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 6e-23
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 7e-08
1ju5_A109 CRK; CRK, SH2, SH3, adaptor protein, phosphopeptid 1e-21
1ju5_A109 CRK; CRK, SH2, SH3, adaptor protein, phosphopeptid 6e-14
4d8k_A175 Tyrosine-protein kinase LCK; protein kinases, SH2 2e-21
4d8k_A175 Tyrosine-protein kinase LCK; protein kinases, SH2 2e-08
1r1p_A100 GRB2-related adaptor protein 2; SH2, GADS, phospho 3e-21
1r1p_A100 GRB2-related adaptor protein 2; SH2, GADS, phospho 2e-13
2oq1_A254 Tyrosine-protein kinase ZAP-70; tandem SH2 domains 6e-21
2oq1_A254 Tyrosine-protein kinase ZAP-70; tandem SH2 domains 1e-15
2oq1_A254 Tyrosine-protein kinase ZAP-70; tandem SH2 domains 1e-11
2oq1_A254 Tyrosine-protein kinase ZAP-70; tandem SH2 domains 3e-08
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 6e-21
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 2e-04
1a81_A254 SYK kinase; complex (transferase-peptide), SYK, ki 2e-20
1a81_A254 SYK kinase; complex (transferase-peptide), SYK, ki 7e-15
1a81_A254 SYK kinase; complex (transferase-peptide), SYK, ki 3e-11
1a81_A254 SYK kinase; complex (transferase-peptide), SYK, ki 2e-08
2dlz_A118 Protein VAV-2; RHO family guanine nucleotide excha 3e-20
2dlz_A118 Protein VAV-2; RHO family guanine nucleotide excha 5e-13
2eob_A124 1-phosphatidylinositol-4,5-bisphosphate phosphodie 3e-20
2eob_A124 1-phosphatidylinositol-4,5-bisphosphate phosphodie 1e-13
1jyr_A96 Growth factor receptor-bound protein 2; receptor b 9e-20
1jyr_A96 Growth factor receptor-bound protein 2; receptor b 8e-13
2eo3_A111 CRK-like protein; phosphorylation, repeat, SH2 dom 2e-19
2eo3_A111 CRK-like protein; phosphorylation, repeat, SH2 dom 5e-12
2cia_A102 Cytoplasmic protein NCK2; SH2-domain, SH3 domain, 3e-19
2cia_A102 Cytoplasmic protein NCK2; SH2-domain, SH3 domain, 3e-12
2hdv_A111 SH2-B PH domain containing signaling mediator 1 ga 7e-19
2hdv_A111 SH2-B PH domain containing signaling mediator 1 ga 9e-13
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 8e-19
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 1e-06
2shp_A 525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 9e-19
2kk6_A116 Proto-oncogene tyrosine-protein kinase FER; method 1e-18
2kk6_A116 Proto-oncogene tyrosine-protein kinase FER; method 1e-14
3eaz_A106 Tyrosine-protein kinase CSK; SH2, disulfide, oxidi 1e-18
3eaz_A106 Tyrosine-protein kinase CSK; SH2, disulfide, oxidi 4e-11
3ov1_A117 Growth factor receptor-bound protein 2; GRB2 SH2 d 2e-18
3ov1_A117 Growth factor receptor-bound protein 2; GRB2 SH2 d 6e-12
2ecd_A119 Tyrosine-protein kinase ABL2; SH2 domain, phosphot 3e-18
2ecd_A119 Tyrosine-protein kinase ABL2; SH2 domain, phosphot 5e-11
2dly_A121 FYN-related kinase; BRK family kinase, structural 4e-18
2dly_A121 FYN-related kinase; BRK family kinase, structural 9e-12
3tkz_A109 Tyrosine-protein phosphatase non-receptor type 11; 6e-18
3tkz_A109 Tyrosine-protein phosphatase non-receptor type 11; 2e-11
2aug_A126 Growth factor receptor-bound protein 14; phosphory 2e-17
2aug_A126 Growth factor receptor-bound protein 14; phosphory 3e-11
2ysx_A119 Signaling inositol polyphosphate phosphatase SHIP 2e-17
2ysx_A119 Signaling inositol polyphosphate phosphatase SHIP 7e-11
2crh_A138 VAV proto-oncogene; oncoprotein, structural genomi 2e-17
2crh_A138 VAV proto-oncogene; oncoprotein, structural genomi 4e-10
3us4_A98 Megakaryocyte-associated tyrosine-protein kinase; 3e-17
3us4_A98 Megakaryocyte-associated tyrosine-protein kinase; 3e-10
3pqz_A117 Growth factor receptor-bound protein 7; SH2, binds 3e-17
3pqz_A117 Growth factor receptor-bound protein 7; SH2, binds 4e-11
2j05_A65 RAS GTPase-activating protein 1; GTPase activation 8e-17
1rja_A100 Tyrosine-protein kinase 6; human protein tyrosine 9e-17
1rja_A100 Tyrosine-protein kinase 6; human protein tyrosine 1e-10
1mil_A104 SHC adaptor protein; SH2 domain, phosphorylation, 9e-17
1mil_A104 SHC adaptor protein; SH2 domain, phosphorylation, 2e-11
1nrv_A105 Growth factor receptor-bound protein 10; dimer, si 1e-16
1nrv_A105 Growth factor receptor-bound protein 10; dimer, si 1e-10
2cs0_A119 Hematopoietic SH2 domain containing; ALX, FLJ14886 3e-16
2cs0_A119 Hematopoietic SH2 domain containing; ALX, FLJ14886 2e-08
2gqi_A71 RAS GTPase-activating protein 1; GAP, RAS P21 prot 5e-16
3k2m_A112 Proto-oncogene tyrosine-protein kinase ABL1; engin 1e-15
3k2m_A112 Proto-oncogene tyrosine-protein kinase ABL1; engin 1e-09
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 1e-15
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 5e-04
1h9o_A112 Phosphatidylinositol 3-kinase; transferase/recepto 2e-15
1h9o_A112 Phosphatidylinositol 3-kinase; transferase/recepto 1e-07
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 2e-15
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 1e-04
1d4t_A104 T cell signal transduction molecule SAP; SH2 domai 3e-15
1d4t_A104 T cell signal transduction molecule SAP; SH2 domai 6e-09
1ka6_A128 SH2 domain protein 1A; SH2 domain, protein-peptide 8e-15
1ka6_A128 SH2 domain protein 1A; SH2 domain, protein-peptide 1e-08
1blj_A114 P55 BLK protein tyrosine kinase; signal transducti 9e-15
1blj_A114 P55 BLK protein tyrosine kinase; signal transducti 4e-08
2lqn_A303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 1e-14
2lqn_A303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 3e-08
2lqn_A303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 2e-07
2y3a_B302 Phosphatidylinositol 3-kinase regulatory subunit; 2e-14
2y3a_B302 Phosphatidylinositol 3-kinase regulatory subunit; 4e-06
1wqu_A114 C-FES, proto-oncogene tyrosine-protein kinase FES/ 3e-14
1wqu_A114 C-FES, proto-oncogene tyrosine-protein kinase FES/ 1e-08
2dm0_A125 Tyrosine-protein kinase TXK; TEC family kinase, st 4e-14
2dm0_A125 Tyrosine-protein kinase TXK; TEC family kinase, st 6e-07
2dx0_A138 Phospholipase C, gamma 2; phosphoric diester hydro 5e-14
2dx0_A138 Phospholipase C, gamma 2; phosphoric diester hydro 8e-11
1aot_F106 FYN protein-tyrosine kinase; SH2 domain, signal tr 5e-14
1aot_F106 FYN protein-tyrosine kinase; SH2 domain, signal tr 4e-08
2iug_A120 Phosphatidylinositol 3-kinase regulatory alpha sub 1e-13
2iug_A120 Phosphatidylinositol 3-kinase regulatory alpha sub 6e-08
1i3z_A103 EWS/FLI1 activated transcript 2; SH2 domain phosph 1e-13
1i3z_A103 EWS/FLI1 activated transcript 2; SH2 domain phosph 2e-07
2bbu_A164 Suppressor of cytokine signaling 3; SH2 domain, ex 1e-13
2bbu_A164 Suppressor of cytokine signaling 3; SH2 domain, ex 6e-07
2vif_A141 Suppressor of cytokine signalling 6; growth regula 3e-13
2vif_A141 Suppressor of cytokine signalling 6; growth regula 2e-07
2c9w_A169 Suppressor of cytokine signaling 2; growth regulat 3e-13
2c9w_A169 Suppressor of cytokine signaling 2; growth regulat 7e-08
2ge9_A125 Tyrosine-protein kinase BTK; SH2 domain, structure 3e-13
2ge9_A125 Tyrosine-protein kinase BTK; SH2 domain, structure 5e-06
2ozo_A 613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 3e-13
2ozo_A 613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 2e-11
2ozo_A 613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 1e-07
2ozo_A 613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 1e-04
2hmh_A152 Suppressor of cytokine signaling 3; SOCS3, GP130, 5e-13
2hmh_A152 Suppressor of cytokine signaling 3; SOCS3, GP130, 2e-06
2izv_A187 Suppressor of cytokine signaling 4; signal transdu 5e-13
2izv_A187 Suppressor of cytokine signaling 4; signal transdu 1e-07
3hhm_B373 NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil 5e-13
3hhm_B373 NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil 3e-10
2b3o_A 532 Tyrosine-protein phosphatase, non-receptor type 6; 1e-12
2ekx_A110 Cytoplasmic tyrosine-protein kinase BMX; SH2 domai 2e-12
2ekx_A110 Cytoplasmic tyrosine-protein kinase BMX; SH2 domai 9e-06
3s9k_A118 Tyrosine-protein kinase ITK/TSK; proline isomeriza 2e-12
3s9k_A118 Tyrosine-protein kinase ITK/TSK; proline isomeriza 3e-05
1lkk_A105 Human P56 tyrosine kinase; complex (tyrosine kinas 3e-12
1lkk_A105 Human P56 tyrosine kinase; complex (tyrosine kinas 4e-06
2kno_A131 Tensin-like C1 domain-containing phosphatase; SH2 3e-12
2kno_A131 Tensin-like C1 domain-containing phosphatase; SH2 9e-04
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 4e-12
3cbl_A 377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 3e-05
3ps5_A 595 Tyrosine-protein phosphatase non-receptor type 6; 6e-12
3ps5_A 595 Tyrosine-protein phosphatase non-receptor type 6; 2e-05
2eyz_A304 V-CRK sarcoma virus CT10 oncogene homolog isoform 1e-11
2eyz_A304 V-CRK sarcoma virus CT10 oncogene homolog isoform 3e-08
2eyz_A304 V-CRK sarcoma virus CT10 oncogene homolog isoform 1e-05
2dvj_A230 V-CRK sarcoma virus CT10 oncogene homolog, isoform 2e-11
2dvj_A230 V-CRK sarcoma virus CT10 oncogene homolog, isoform 1e-10
2dvj_A230 V-CRK sarcoma virus CT10 oncogene homolog, isoform 2e-04
2eo6_A141 B-cell linker protein; SH2, cytoplasmic adapter pr 3e-11
2eo6_A141 B-cell linker protein; SH2, cytoplasmic adapter pr 2e-04
1spk_A72 RSGI RUH-010, riken cDNA 1300006M19; structural ge 2e-10
2ct3_A70 Vinexin; SH3 domian, structural genomics, NPPSFA, 4e-10
2cuc_A70 SH3 domain containing ring finger 2; structural ge 3e-09
3maz_A125 Signal-transducing adaptor protein 1; modular doma 3e-09
2yt6_A109 Adult MALE urinary bladder cDNA, riken FULL- lengt 1e-08
1wer_A 334 P120GAP; GTPase activation, RAS, signal transducti 2e-08
3or8_A197 Transcription elongation factor SPT6; SH2, CTD bin 2e-08
3cqt_A79 P59-FYN, proto-oncogene tyrosine-protein kinase FY 2e-08
1ruw_A69 Myosin-3 isoform, MYO3; SH3 domain, yeast, high-th 7e-08
3h0h_A73 Proto-oncogene tyrosine-protein kinase FYN; beta b 1e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
2fpf_A71 C-JUN-amino-terminal kinase interacting protein 1; 1e-07
1zuy_A58 Myosin-5 isoform; SH3 domain, contractIle protein; 2e-07
2fpe_A62 C-JUN-amino-terminal kinase interacting protein 1; 2e-07
2lcs_A73 NAP1-binding protein 2; adaptor, transferase, sign 3e-07
1yn8_A59 NBP2, NAP1-binding protein 2; SH3 domain, unknown 4e-07
2el8_A118 Signal-transducing adaptor protein 2; SH2 domain, 6e-07
3qwy_A308 Cell death abnormality protein 2; cell engulfment, 6e-07
3qwy_A308 Cell death abnormality protein 2; cell engulfment, 1e-04
4f14_A64 Nebulette; SH3 domain, heart muscle, actin-binding 8e-07
2e5k_A94 Suppressor of T-cell receptor signaling 1; SH3 dom 9e-07
3eg3_A63 Proto-oncogene tyrosine-protein kinase ABL1; beta, 1e-06
1x6b_A79 RHO guanine exchange factor (GEF) 16; SH3 domain, 1e-06
4ag1_C84 Fynomer; hydrolase-de novo protein complex, inhibi 2e-06
2eqi_A69 Phospholipase C, gamma 2; SH3 domain, PLCG2, struc 2e-06
3qwx_X174 Cell death abnormality protein 2; cell engulfment, 2e-06
3qwx_X174 Cell death abnormality protein 2; cell engulfment, 2e-05
1s1n_A68 Nephrocystin 1; beta barrel, cell adhesion; NMR {H 3e-06
3rnj_A67 Brain-specific angiogenesis inhibitor 1-associate 3e-06
1zuu_A58 BZZ1 protein; SH3 domain, unknown function; 0.97A 4e-06
1x2p_A68 Protein arginine N-methyltransferase 2; SH3 domain 4e-06
2cud_A79 SRC-like-adapter; SH3 domain, negative mitogenesis 6e-06
1wie_A96 RIM binding protein 2; beta barrel, KIAA0318 prote 7e-06
2kxc_A67 Brain-specific angiogenesis inhibitor 1-associate 8e-06
2jmc_A77 Spectrin alpha chain, brain and P41 peptide chimer 1e-05
2dmo_A68 Neutrophil cytosol factor 2; SH3 domain, structura 1e-05
1aww_A67 ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linke 2e-05
2xp1_A178 SPT6; transcription, IWS1, histone chaperone, mRNA 2e-05
1x6g_A81 Megakaryocyte-associated tyrosine-protein kinase; 2e-05
1b07_A65 Protein (proto-oncogene CRK (CRK)); SH3 domain, in 2e-05
2oi3_A86 Tyrosine-protein kinase HCK; human HCK, SH3, SRC-t 2e-05
2kgt_A72 Tyrosine-protein kinase 6; SH3 domain, SRC kinase, 2e-05
1gl5_A67 Tyrosine-protein kinase TEC; transferase, ATP-bind 3e-05
1csk_A71 C-SRC SH3 domain; phosphotransferase; 2.50A {Homo 4e-05
4esr_A69 Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domai 4e-05
1w1f_A65 Tyrosine-protein kinase LYN; SH3-domain, SH3 domai 4e-05
3reb_B90 Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain 4e-05
2dil_A69 Proline-serine-threonine phosphatase-interacting p 4e-05
1cka_A57 C-CRK N-terminal SH3 domain; complex (oncogene pro 4e-05
2rqv_A108 BUD emergence protein 1; BEM1P, SH3, CDC42P, cytop 6e-05
2csq_A97 RIM-BP2, RIM binding protein 2; SH3 domain, struct 9e-05
1jo8_A58 ABP1P, actin binding protein; SH3 domain actin-bin 9e-05
2yuq_A85 Tyrosine-protein kinase ITK/TSK; T-cell-specific k 1e-04
2iim_A62 Proto-oncogene tyrosine-protein kinase LCK; beta-b 1e-04
1wxb_A68 Epidermal growth factor receptor pathway substrate 1e-04
2jt4_A71 Cytoskeleton assembly control protein SLA1; endocy 1e-04
2ecz_A70 Sorbin and SH3 domain-containing protein 1; glycop 1e-04
1wxt_A68 Hypothetical protein FLJ21522; SH3 domain, EPS8-re 2e-04
2ega_A70 SH3 and PX domain-containing protein 2A; SH3 domai 2e-04
2ct4_A70 CDC42-interacting protein 4; thyroid receptor inte 2e-04
2kym_A120 BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI 2e-04
2v1q_A60 SLA1, cytoskeleton assembly control protein SLA1; 2e-04
1ue9_A80 Intersectin 2; beta barrel, SH3 domain, riken stru 2e-04
2dnu_A71 RUH-061, SH3 multiple domains 1; RSGI, structural 2e-04
2dbk_A88 CRK-like protein; structural genomics, NPPSFA, nat 3e-04
1awj_A77 ITK; transferase, regulatory intramolecular comple 3e-04
2drm_A58 Acanthamoeba myosin IB; SH3 domain, contractIle pr 3e-04
2ak5_A64 RHO guanine nucleotide exchange factor 7; adaptor 3e-04
2g6f_X59 RHO guanine nucleotide exchange factor 7; SH3 doma 4e-04
2dl5_A78 KIAA0769 protein; SH3 domain, FCHSD2, structural g 4e-04
1ujy_A76 RHO guanine nucleotide exchange factor 6; structur 4e-04
2egc_A75 SH3 and PX domain-containing protein 2A; SH3 domai 4e-04
2csi_A76 RIM-BP2, RIM binding protein 2; SH3 domain, struct 4e-04
2o2o_A92 SH3-domain kinase-binding protein 1; CIN85, protei 4e-04
1tuc_A63 Alpha-spectrin; capping protein, calcium-binding, 4e-04
2yun_A79 Nostrin; nitric oxide synthase trafficker, structu 4e-04
2pqh_A80 Spectrin alpha chain, brain; SH3 domain, chimera, 4e-04
1wi7_A68 SH3-domain kinase binding protein 1; beta barrel, 5e-04
1ng2_A193 Neutrophil cytosolic factor 1; P47PHOX, autoinhibi 6e-04
3o5z_A90 Phosphatidylinositol 3-kinase regulatory subunit; 6e-04
2de0_X526 Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltran 6e-04
2bzy_A67 CRK-like protein, CRKL SH3C; SH3 domain, dimer, nu 6e-04
3ngp_A62 Spectrin alpha chain, brain; beta barrel, structur 6e-04
3u23_A65 CD2-associated protein; structural genomics, struc 6e-04
2cr4_A126 3BP-2, SH3 domain-binding protein 2; structural ge 6e-04
1neg_A83 Spectrin alpha chain, brain; SH3-domain fold, five 6e-04
1uur_A473 Stata protein, STAT protein; transcription activat 7e-04
2cub_A88 Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor 7e-04
2ekh_A80 SH3 and PX domain-containing protein 2A; SH3 domai 7e-04
2ed0_A78 ABL interactor 2; coiled coil, cytoskeleton, nucle 9e-04
2dl3_A68 Sorbin and SH3 domain-containing protein 1; ponsin 9e-04
>3gqi_B Phospholipase C-gamma-1; phosphorylated kinase, PY-recognition, tandem SH2 domains, A analog, ATP-binding, craniosynostosis, disease mutation; HET: PTR DVT ACP; 2.50A {Rattus norvegicus} PDB: 2fci_A* 2pld_A* 2ple_A* Length = 226 Back     alignment and structure
 Score =  117 bits (294), Expect = 3e-31
 Identities = 46/212 (21%), Positives = 81/212 (38%), Gaps = 35/212 (16%)

Query: 58  DWFH-----PECTKNDAVDMLVKAG------PGSFLVRPSDNSPGDYSLFFHINNQIQRF 106
            WFH         ++ A  +L +         GSFLVR S+   GDY+L F  N ++Q  
Sbjct: 5   KWFHGKLGAGRDGRHIAERLLTEYCIETGAPDGSFLVRESETFVGDYTLSFWRNGKVQHC 64

Query: 107 RIEKKAVR-----YLMGGRTFECLDAVINRYRKEQIVEGHTLGFPVTRMSRQWKIATKGS 161
           RI  +        +L     F+ L  +I  Y++  +            + +     +K  
Sbjct: 65  RIHSRQDAGTPKFFLTDNLVFDSLYDLITHYQQVPLRCNEFEMRLSEPVPQTNAHESKEW 124

Query: 162 CHK------------------SFLVRPSDNSPGDYSLFFHINNQIQRFRIEKKAVRYLMG 203
            H                   +FLVR   N P  Y++ F    +I+  R++++    ++G
Sbjct: 125 YHASLTRAQAEHMLMRVPRDGAFLVRKR-NEPNSYAISFRAEGKIKHCRVQQEGQTVMLG 183

Query: 204 GRTFECLDAVINRYRKEQIVEGHTLGFPVTRT 235
              F+ L  +I+ Y K  +     L +P+   
Sbjct: 184 NSEFDSLVDLISYYEKHPLYRKMKLRYPINEE 215
>3gqi_B Phospholipase C-gamma-1; phosphorylated kinase, PY-recognition, tandem SH2 domains, A analog, ATP-binding, craniosynostosis, disease mutation; HET: PTR DVT ACP; 2.50A {Rattus norvegicus} PDB: 2fci_A* 2pld_A* 2ple_A* Length = 226 Back     alignment and structure
>3gqi_B Phospholipase C-gamma-1; phosphorylated kinase, PY-recognition, tandem SH2 domains, A analog, ATP-binding, craniosynostosis, disease mutation; HET: PTR DVT ACP; 2.50A {Rattus norvegicus} PDB: 2fci_A* 2pld_A* 2ple_A* Length = 226 Back     alignment and structure
>2gsb_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2gsb_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Length = 217 Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Length = 217 Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Length = 217 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 Back     alignment and structure
>1ju5_A CRK; CRK, SH2, SH3, adaptor protein, phosphopeptide, protein binding/transferase complex; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 Length = 109 Back     alignment and structure
>1ju5_A CRK; CRK, SH2, SH3, adaptor protein, phosphopeptide, protein binding/transferase complex; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 Length = 109 Back     alignment and structure
>4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* Length = 175 Back     alignment and structure
>4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* Length = 175 Back     alignment and structure
>1r1p_A GRB2-related adaptor protein 2; SH2, GADS, phosphopeptide, peptide binding protein; HET: PTR; 1.80A {Mus musculus} SCOP: d.93.1.1 PDB: 1r1q_A* 1r1s_A* Length = 100 Back     alignment and structure
>1r1p_A GRB2-related adaptor protein 2; SH2, GADS, phosphopeptide, peptide binding protein; HET: PTR; 1.80A {Mus musculus} SCOP: d.93.1.1 PDB: 1r1q_A* 1r1s_A* Length = 100 Back     alignment and structure
>2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A Length = 254 Back     alignment and structure
>2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A Length = 254 Back     alignment and structure
>2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A Length = 254 Back     alignment and structure
>2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A Length = 254 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 Back     alignment and structure
>1a81_A SYK kinase; complex (transferase-peptide), SYK, kinase, SH2 domain; HET: PTR; 3.00A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1csy_A* 1csz_A* Length = 254 Back     alignment and structure
>1a81_A SYK kinase; complex (transferase-peptide), SYK, kinase, SH2 domain; HET: PTR; 3.00A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1csy_A* 1csz_A* Length = 254 Back     alignment and structure
>1a81_A SYK kinase; complex (transferase-peptide), SYK, kinase, SH2 domain; HET: PTR; 3.00A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1csy_A* 1csz_A* Length = 254 Back     alignment and structure
>1a81_A SYK kinase; complex (transferase-peptide), SYK, kinase, SH2 domain; HET: PTR; 3.00A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1csy_A* 1csz_A* Length = 254 Back     alignment and structure
>2dlz_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2dlz_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2eob_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 2; SH2, phosphoinositide phospholipase C, PLC-gamma-2, phospholipase C-gamma-2; NMR {Rattus norvegicus} Length = 124 Back     alignment and structure
>2eob_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 2; SH2, phosphoinositide phospholipase C, PLC-gamma-2, phospholipase C-gamma-2; NMR {Rattus norvegicus} Length = 124 Back     alignment and structure
>1jyr_A Growth factor receptor-bound protein 2; receptor binding, regulatory, inhibitor, signaling protein-I complex; HET: PTR; 1.55A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jyq_A* 1jyu_A 1qg1_E* 1x0n_A* 2aob_A* 2aoa_A* 3n7y_A* 1tze_E* 1zfp_E* 3mxc_A* 3mxy_A* 1cj1_A* Length = 96 Back     alignment and structure
>1jyr_A Growth factor receptor-bound protein 2; receptor binding, regulatory, inhibitor, signaling protein-I complex; HET: PTR; 1.55A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jyq_A* 1jyu_A 1qg1_E* 1x0n_A* 2aob_A* 2aoa_A* 3n7y_A* 1tze_E* 1zfp_E* 3mxc_A* 3mxy_A* 1cj1_A* Length = 96 Back     alignment and structure
>2eo3_A CRK-like protein; phosphorylation, repeat, SH2 domain, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2eo3_A CRK-like protein; phosphorylation, repeat, SH2 domain, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2cia_A Cytoplasmic protein NCK2; SH2-domain, SH3 domain, phosphorylation, binding specificity; HET: PTR MPD; 1.45A {Homo sapiens} PDB: 1z3k_A 2ci9_A* 2ci8_A* Length = 102 Back     alignment and structure
>2cia_A Cytoplasmic protein NCK2; SH2-domain, SH3 domain, phosphorylation, binding specificity; HET: PTR MPD; 1.45A {Homo sapiens} PDB: 1z3k_A 2ci9_A* 2ci8_A* Length = 102 Back     alignment and structure
>2hdv_A SH2-B PH domain containing signaling mediator 1 gamma isoform; adapter protein, signaling protein; 2.00A {Mus musculus} PDB: 2hdx_A* 1rpy_A 1rqq_C* Length = 111 Back     alignment and structure
>2hdv_A SH2-B PH domain containing signaling mediator 1 gamma isoform; adapter protein, signaling protein; 2.00A {Mus musculus} PDB: 2hdx_A* 1rpy_A 1rqq_C* Length = 111 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Length = 525 Back     alignment and structure
>2kk6_A Proto-oncogene tyrosine-protein kinase FER; methods development, SH2, NESG, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2kk6_A Proto-oncogene tyrosine-protein kinase FER; methods development, SH2, NESG, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>3eaz_A Tyrosine-protein kinase CSK; SH2, disulfide, oxidized reduced, ATP-binding, cell membrane, cytoplasm, membrane, nucleotide-binding, phosphoprotein; 1.31A {Homo sapiens} PDB: 3eac_A Length = 106 Back     alignment and structure
>3eaz_A Tyrosine-protein kinase CSK; SH2, disulfide, oxidized reduced, ATP-binding, cell membrane, cytoplasm, membrane, nucleotide-binding, phosphoprotein; 1.31A {Homo sapiens} PDB: 3eac_A Length = 106 Back     alignment and structure
>3ov1_A Growth factor receptor-bound protein 2; GRB2 SH2 domain, phosphotyrosine binding, signaling protein, signaling protein-antagonist complex; HET: PTR; 1.60A {Homo sapiens} PDB: 3imj_A* 3in7_A* 3imd_A* 3kfj_A* 3n8m_A* 3in8_A* 3s8l_A* 3s8n_A* 3s8o_A* 2huy_A* 2h5k_A* 2huw_A* 2h46_E* 3c7i_A* 3n84_A* 1fhs_A 1bm2_A* 1bmb_A* 3ove_A* 1fyr_A* ... Length = 117 Back     alignment and structure
>3ov1_A Growth factor receptor-bound protein 2; GRB2 SH2 domain, phosphotyrosine binding, signaling protein, signaling protein-antagonist complex; HET: PTR; 1.60A {Homo sapiens} PDB: 3imj_A* 3in7_A* 3imd_A* 3kfj_A* 3n8m_A* 3in8_A* 3s8l_A* 3s8n_A* 3s8o_A* 2huy_A* 2h5k_A* 2huw_A* 2h46_E* 3c7i_A* 3n84_A* 1fhs_A 1bm2_A* 1bmb_A* 3ove_A* 1fyr_A* ... Length = 117 Back     alignment and structure
>2ecd_A Tyrosine-protein kinase ABL2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2ecd_A Tyrosine-protein kinase ABL2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2dly_A FYN-related kinase; BRK family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 121 Back     alignment and structure
>2dly_A FYN-related kinase; BRK family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 121 Back     alignment and structure
>3tkz_A Tyrosine-protein phosphatase non-receptor type 11; SH2 domain, protein protein interactions, PTR residues, HYDR peptide complex; HET: PTR; 1.80A {Homo sapiens} PDB: 3tl0_A* 1aya_A* 1ayb_A* 1ayc_A* 1ayd_A Length = 109 Back     alignment and structure
>3tkz_A Tyrosine-protein phosphatase non-receptor type 11; SH2 domain, protein protein interactions, PTR residues, HYDR peptide complex; HET: PTR; 1.80A {Homo sapiens} PDB: 3tl0_A* 1aya_A* 1ayb_A* 1ayc_A* 1ayd_A Length = 109 Back     alignment and structure
>2aug_A Growth factor receptor-bound protein 14; phosphorylation, SH2 domain, signaling protein; 2.30A {Homo sapiens} Length = 126 Back     alignment and structure
>2aug_A Growth factor receptor-bound protein 14; phosphorylation, SH2 domain, signaling protein; 2.30A {Homo sapiens} Length = 126 Back     alignment and structure
>2ysx_A Signaling inositol polyphosphate phosphatase SHIP II; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2ysx_A Signaling inositol polyphosphate phosphatase SHIP II; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2crh_A VAV proto-oncogene; oncoprotein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2ror_A* 2lct_A* Length = 138 Back     alignment and structure
>2crh_A VAV proto-oncogene; oncoprotein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2ror_A* 2lct_A* Length = 138 Back     alignment and structure
>3us4_A Megakaryocyte-associated tyrosine-protein kinase; SH2 domain, signaling protein, structural genomics, joint CE structural genomics, JCSG; 1.50A {Homo sapiens} PDB: 1jwo_A Length = 98 Back     alignment and structure
>3us4_A Megakaryocyte-associated tyrosine-protein kinase; SH2 domain, signaling protein, structural genomics, joint CE structural genomics, JCSG; 1.50A {Homo sapiens} PDB: 1jwo_A Length = 98 Back     alignment and structure
>3pqz_A Growth factor receptor-bound protein 7; SH2, binds phosphotyrosine, tyrosine kinases, cytoplasmic, P binding; 2.41A {Homo sapiens} PDB: 1mw4_A* 2l4k_A* 2qms_A Length = 117 Back     alignment and structure
>3pqz_A Growth factor receptor-bound protein 7; SH2, binds phosphotyrosine, tyrosine kinases, cytoplasmic, P binding; 2.41A {Homo sapiens} PDB: 1mw4_A* 2l4k_A* 2qms_A Length = 117 Back     alignment and structure
>2j05_A RAS GTPase-activating protein 1; GTPase activation, SH3 domain, SH2 domain, SRC homology 3, RAS signaling pathway, proto- oncogene, phosphorylation; 1.5A {Homo sapiens} PDB: 2j06_A Length = 65 Back     alignment and structure
>1rja_A Tyrosine-protein kinase 6; human protein tyrosine kinase-6 (PTK6/BRK), SRC homology 2(S domain, solution structure, backbone dynamics, transferase; NMR {Homo sapiens} SCOP: d.93.1.1 Length = 100 Back     alignment and structure
>1rja_A Tyrosine-protein kinase 6; human protein tyrosine kinase-6 (PTK6/BRK), SRC homology 2(S domain, solution structure, backbone dynamics, transferase; NMR {Homo sapiens} SCOP: d.93.1.1 Length = 100 Back     alignment and structure
>1mil_A SHC adaptor protein; SH2 domain, phosphorylation, collagen, growth regulation, transforming protein, alternative initiation; 2.70A {Homo sapiens} SCOP: d.93.1.1 PDB: 1tce_A* Length = 104 Back     alignment and structure
>1mil_A SHC adaptor protein; SH2 domain, phosphorylation, collagen, growth regulation, transforming protein, alternative initiation; 2.70A {Homo sapiens} SCOP: d.93.1.1 PDB: 1tce_A* Length = 104 Back     alignment and structure
>1nrv_A Growth factor receptor-bound protein 10; dimer, signaling protein; 1.65A {Homo sapiens} SCOP: d.93.1.1 PDB: 3m7f_A Length = 105 Back     alignment and structure
>1nrv_A Growth factor receptor-bound protein 10; dimer, signaling protein; 1.65A {Homo sapiens} SCOP: d.93.1.1 PDB: 3m7f_A Length = 105 Back     alignment and structure
>2cs0_A Hematopoietic SH2 domain containing; ALX, FLJ14886, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.93.1.1 Length = 119 Back     alignment and structure
>2cs0_A Hematopoietic SH2 domain containing; ALX, FLJ14886, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.93.1.1 Length = 119 Back     alignment and structure
>2gqi_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>3k2m_A Proto-oncogene tyrosine-protein kinase ABL1; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_A 3t04_A 1ab2_A Length = 112 Back     alignment and structure
>3k2m_A Proto-oncogene tyrosine-protein kinase ABL1; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_A 3t04_A 1ab2_A Length = 112 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 Back     alignment and structure
>1h9o_A Phosphatidylinositol 3-kinase; transferase/receptor, complex (phosphotransferase/receptor), phosphotransferase, SH2 domain; HET: PTR; 1.79A {Homo sapiens} SCOP: d.93.1.1 PDB: 1pic_A* 1bfi_A 1bfj_A 1qad_A Length = 112 Back     alignment and structure
>1h9o_A Phosphatidylinositol 3-kinase; transferase/receptor, complex (phosphotransferase/receptor), phosphotransferase, SH2 domain; HET: PTR; 1.79A {Homo sapiens} SCOP: d.93.1.1 PDB: 1pic_A* 1bfi_A 1bfj_A 1qad_A Length = 112 Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 Back     alignment and structure
>1d4t_A T cell signal transduction molecule SAP; SH2 domain, tyrosine kinase, signal transduction, peptide recognition, signaling protein; 1.10A {Homo sapiens} SCOP: d.93.1.1 PDB: 1d1z_A 1d4w_A* 1m27_A* Length = 104 Back     alignment and structure
>1d4t_A T cell signal transduction molecule SAP; SH2 domain, tyrosine kinase, signal transduction, peptide recognition, signaling protein; 1.10A {Homo sapiens} SCOP: d.93.1.1 PDB: 1d1z_A 1d4w_A* 1m27_A* Length = 104 Back     alignment and structure
>1ka6_A SH2 domain protein 1A; SH2 domain, protein-peptide complex, immune system; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1ka7_A Length = 128 Back     alignment and structure
>1ka6_A SH2 domain protein 1A; SH2 domain, protein-peptide complex, immune system; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1ka7_A Length = 128 Back     alignment and structure
>1blj_A P55 BLK protein tyrosine kinase; signal transduction, transferase, phosphotransferase, phosphorylation; NMR {Mus musculus} SCOP: d.93.1.1 PDB: 1blk_A Length = 114 Back     alignment and structure
>1blj_A P55 BLK protein tyrosine kinase; signal transduction, transferase, phosphotransferase, phosphorylation; NMR {Mus musculus} SCOP: d.93.1.1 PDB: 1blk_A Length = 114 Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Length = 303 Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Length = 303 Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Length = 303 Back     alignment and structure
>2y3a_B Phosphatidylinositol 3-kinase regulatory subunit; transferase, phosphoinositide 3-kinase, RTK; HET: GD9; 3.30A {Mus musculus} Length = 302 Back     alignment and structure
>2y3a_B Phosphatidylinositol 3-kinase regulatory subunit; transferase, phosphoinositide 3-kinase, RTK; HET: GD9; 3.30A {Mus musculus} Length = 302 Back     alignment and structure
>1wqu_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; SH2 domain, feline sarcoma oncogene, structural genomics; NMR {Homo sapiens} PDB: 2dcr_A Length = 114 Back     alignment and structure
>1wqu_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; SH2 domain, feline sarcoma oncogene, structural genomics; NMR {Homo sapiens} PDB: 2dcr_A Length = 114 Back     alignment and structure
>2dm0_A Tyrosine-protein kinase TXK; TEC family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 125 Back     alignment and structure
>2dm0_A Tyrosine-protein kinase TXK; TEC family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 125 Back     alignment and structure
>2dx0_A Phospholipase C, gamma 2; phosphoric diester hydrolase, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.50A {Mus musculus} Length = 138 Back     alignment and structure
>2dx0_A Phospholipase C, gamma 2; phosphoric diester hydrolase, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.50A {Mus musculus} Length = 138 Back     alignment and structure
>1aot_F FYN protein-tyrosine kinase; SH2 domain, signal transduction, peptide complex, complex (proto-oncogene/early protein); HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1aou_F* Length = 106 Back     alignment and structure
>1aot_F FYN protein-tyrosine kinase; SH2 domain, signal transduction, peptide complex, complex (proto-oncogene/early protein); HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1aou_F* Length = 106 Back     alignment and structure
>2iug_A Phosphatidylinositol 3-kinase regulatory alpha subunit; transferase, polymorphism, UBL conjugation, phosphorylation, SH2, PI3K, SH2 domain; 1.89A {Homo sapiens} PDB: 2iuh_A* 2iui_A* 1fu5_A* 1fu6_A 1oo3_A 1oo4_A* 2pna_A 2pnb_A Length = 120 Back     alignment and structure
>2iug_A Phosphatidylinositol 3-kinase regulatory alpha subunit; transferase, polymorphism, UBL conjugation, phosphorylation, SH2, PI3K, SH2 domain; 1.89A {Homo sapiens} PDB: 2iuh_A* 2iui_A* 1fu5_A* 1fu6_A 1oo3_A 1oo4_A* 2pna_A 2pnb_A Length = 120 Back     alignment and structure
>1i3z_A EWS/FLI1 activated transcript 2; SH2 domain phosphotyrosine signal transduction lymphocyte, signaling protein; HET: PTR; 2.15A {Mus musculus} SCOP: d.93.1.1 Length = 103 Back     alignment and structure
>1i3z_A EWS/FLI1 activated transcript 2; SH2 domain phosphotyrosine signal transduction lymphocyte, signaling protein; HET: PTR; 2.15A {Mus musculus} SCOP: d.93.1.1 Length = 103 Back     alignment and structure
>2bbu_A Suppressor of cytokine signaling 3; SH2 domain, extended SH2 subdomain, PEST motif, protein complex, cytokine regulator; HET: PTR; NMR {Mus musculus} Length = 164 Back     alignment and structure
>2bbu_A Suppressor of cytokine signaling 3; SH2 domain, extended SH2 subdomain, PEST motif, protein complex, cytokine regulator; HET: PTR; NMR {Mus musculus} Length = 164 Back     alignment and structure
>2vif_A Suppressor of cytokine signalling 6; growth regulation, signal transduction inhibitor, KIT regula phosphotyrosine, signaling protein; HET: PTR; 1.45A {Homo sapiens} Length = 141 Back     alignment and structure
>2vif_A Suppressor of cytokine signalling 6; growth regulation, signal transduction inhibitor, KIT regula phosphotyrosine, signaling protein; HET: PTR; 1.45A {Homo sapiens} Length = 141 Back     alignment and structure
>2c9w_A Suppressor of cytokine signaling 2; growth regulation, SH2 domain, signal transduction inhibitor nuclear protein; 1.9A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 Length = 169 Back     alignment and structure
>2c9w_A Suppressor of cytokine signaling 2; growth regulation, SH2 domain, signal transduction inhibitor nuclear protein; 1.9A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 Length = 169 Back     alignment and structure
>2ge9_A Tyrosine-protein kinase BTK; SH2 domain, structure, transferase; NMR {Homo sapiens} Length = 125 Back     alignment and structure
>2ge9_A Tyrosine-protein kinase BTK; SH2 domain, structure, transferase; NMR {Homo sapiens} Length = 125 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 Back     alignment and structure
>2hmh_A Suppressor of cytokine signaling 3; SOCS3, GP130, PTyr, peptide complex, cytokine regulator; HET: PTR; 2.00A {Mus musculus} Length = 152 Back     alignment and structure
>2hmh_A Suppressor of cytokine signaling 3; SOCS3, GP130, PTyr, peptide complex, cytokine regulator; HET: PTR; 2.00A {Mus musculus} Length = 152 Back     alignment and structure
>2izv_A Suppressor of cytokine signaling 4; signal transduction inhibitor, growth regulation, signal transduction, SH2 domain, nuclear protein; 2.55A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 Length = 187 Back     alignment and structure
>2izv_A Suppressor of cytokine signaling 4; signal transduction inhibitor, growth regulation, signal transduction, SH2 domain, nuclear protein; 2.55A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 Length = 187 Back     alignment and structure
>3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A Length = 373 Back     alignment and structure
>3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A Length = 373 Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Length = 532 Back     alignment and structure
>2ekx_A Cytoplasmic tyrosine-protein kinase BMX; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2ekx_A Cytoplasmic tyrosine-protein kinase BMX; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>3s9k_A Tyrosine-protein kinase ITK/TSK; proline isomerization, CIS proline, domain swapped dimer, SH transferase; HET: CIT; 2.35A {Mus musculus} PDB: 2etz_A* 2eu0_A* 1lui_A 1luk_A 1lum_A 1lun_A 2k79_B 2k7a_B Length = 118 Back     alignment and structure
>3s9k_A Tyrosine-protein kinase ITK/TSK; proline isomerization, CIS proline, domain swapped dimer, SH transferase; HET: CIT; 2.35A {Mus musculus} PDB: 2etz_A* 2eu0_A* 1lui_A 1luk_A 1lum_A 1lun_A 2k79_B 2k7a_B Length = 118 Back     alignment and structure
>1lkk_A Human P56 tyrosine kinase; complex (tyrosine kinase/peptide); HET: PTR; 1.00A {Homo sapiens} SCOP: d.93.1.1 PDB: 1lcj_A* 1bhf_A* 1bhh_A 1lkl_A* 1bhh_B 1fbz_A* 1ijr_A* 1cwd_L* 1cwe_A* Length = 105 Back     alignment and structure
>1lkk_A Human P56 tyrosine kinase; complex (tyrosine kinase/peptide); HET: PTR; 1.00A {Homo sapiens} SCOP: d.93.1.1 PDB: 1lcj_A* 1bhf_A* 1bhh_A 1lkl_A* 1bhh_B 1fbz_A* 1ijr_A* 1cwd_L* 1cwe_A* Length = 105 Back     alignment and structure
>2kno_A Tensin-like C1 domain-containing phosphatase; SH2 domain, TENC1, solution structure, cell junctio membrane, hydrolase, membrane, metal-binding; NMR {Homo sapiens} PDB: 2l6k_A Length = 131 Back     alignment and structure
>2kno_A Tensin-like C1 domain-containing phosphatase; SH2 domain, TENC1, solution structure, cell junctio membrane, hydrolase, membrane, metal-binding; NMR {Homo sapiens} PDB: 2l6k_A Length = 131 Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Length = 595 Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Length = 595 Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Length = 304 Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Length = 304 Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Length = 304 Back     alignment and structure
>2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Length = 230 Back     alignment and structure
>2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Length = 230 Back     alignment and structure
>2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Length = 230 Back     alignment and structure
>2eo6_A B-cell linker protein; SH2, cytoplasmic adapter protein, B-cell adapter containing SH2 domain protein; NMR {Mus musculus} Length = 141 Back     alignment and structure
>2eo6_A B-cell linker protein; SH2, cytoplasmic adapter protein, B-cell adapter containing SH2 domain protein; NMR {Mus musculus} Length = 141 Back     alignment and structure
>1spk_A RSGI RUH-010, riken cDNA 1300006M19; structural genomics, SH3 domain, five-stranded barrel, mouse cDNA; NMR {Mus musculus} SCOP: b.34.2.1 Length = 72 Back     alignment and structure
>2ct3_A Vinexin; SH3 domian, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2cuc_A SH3 domain containing ring finger 2; structural genomics, ring finger 2 containing protein, NPPSFA; NMR {Mus musculus} Length = 70 Back     alignment and structure
>3maz_A Signal-transducing adaptor protein 1; modular domain, phosphotyrosine, specificity, cytoplasm, phosphoprotein, SH2 domain, signaling protein; HET: PTR; 1.90A {Homo sapiens} Length = 125 Back     alignment and structure
>2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} Length = 109 Back     alignment and structure
>1wer_A P120GAP; GTPase activation, RAS, signal transduction, growth regulation, cancer; 1.60A {Homo sapiens} SCOP: a.116.1.2 PDB: 1wq1_G* Length = 334 Back     alignment and structure
>3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A Length = 79 Back     alignment and structure
>1ruw_A Myosin-3 isoform, MYO3; SH3 domain, yeast, high-throughput, structural genomics, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2btt_A 1va7_A Length = 69 Back     alignment and structure
>3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} PDB: 3h0i_A 3h0f_A* Length = 73 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} Length = 71 Back     alignment and structure
>1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A Length = 58 Back     alignment and structure
>2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* Length = 62 Back     alignment and structure
>2lcs_A NAP1-binding protein 2; adaptor, transferase, signaling protein; NMR {Saccharomyces cerevisiae} Length = 73 Back     alignment and structure
>1yn8_A NBP2, NAP1-binding protein 2; SH3 domain, unknown function; 1.70A {Saccharomyces cerevisiae} Length = 59 Back     alignment and structure
>2el8_A Signal-transducing adaptor protein 2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Length = 308 Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Length = 308 Back     alignment and structure
>4f14_A Nebulette; SH3 domain, heart muscle, actin-binding protein-peptide COMP; 1.20A {Homo sapiens} PDB: 1ark_A 1neb_A 3i35_A Length = 64 Back     alignment and structure
>2e5k_A Suppressor of T-cell receptor signaling 1; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>3eg3_A Proto-oncogene tyrosine-protein kinase ABL1; beta, ATP-binding, cell adhesion, cytoskeleton, LIPO magnesium, manganese, metal-binding, myristate; 1.40A {Homo sapiens} PDB: 3egu_A 3eg0_A 3eg2_A 3eg1_A 1abo_A 1abq_A 1ju5_C* 2o88_A 1bbz_A 1awo_A Length = 63 Back     alignment and structure
>1x6b_A RHO guanine exchange factor (GEF) 16; SH3 domain, neuroblastoma, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>4ag1_C Fynomer; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Synthetic construct} PDB: 4afz_C 4ag2_C* 4afq_C* 4afs_C 4afu_C 1azg_B 1nyf_A 1nyg_A 1a0n_B 1fyn_A 1m27_C* 1shf_A 1zbj_A 1efn_A 1avz_C 1nlo_C* 1nlp_C* 1qwe_A 1qwf_A 1prl_C ... Length = 84 Back     alignment and structure
>2eqi_A Phospholipase C, gamma 2; SH3 domain, PLCG2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 69 Back     alignment and structure
>3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Length = 174 Back     alignment and structure
>3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Length = 174 Back     alignment and structure
>1s1n_A Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>3rnj_A Brain-specific angiogenesis inhibitor 1-associate 2; structural genomics, structural genomics consortium, SGC, BE barrel; HET: EDT; 1.50A {Homo sapiens} Length = 67 Back     alignment and structure
>1zuu_A BZZ1 protein; SH3 domain, unknown function; 0.97A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 58 Back     alignment and structure
>1x2p_A Protein arginine N-methyltransferase 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2cud_A SRC-like-adapter; SH3 domain, negative mitogenesis regulator, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>1wie_A RIM binding protein 2; beta barrel, KIAA0318 protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 96 Back     alignment and structure
>2kxc_A Brain-specific angiogenesis inhibitor 1-associate 2-like protein 1; IRTKS-SH3, espfu, complex structure, protein binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>2jmc_A Spectrin alpha chain, brain and P41 peptide chimera; SPC-SH3, signaling protein; NMR {Gallus gallus} Length = 77 Back     alignment and structure
>2dmo_A Neutrophil cytosol factor 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>1aww_A ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linked agammaglobulinemia, XLA, BTK, SH3 domain, transferase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 1awx_A 1qly_A Length = 67 Back     alignment and structure
>2xp1_A SPT6; transcription, IWS1, histone chaperone, mRNA export; 2.20A {Antonospora locustae} Length = 178 Back     alignment and structure
>1x6g_A Megakaryocyte-associated tyrosine-protein kinase; MATK, CTK, HYL, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 Length = 65 Back     alignment and structure
>2oi3_A Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type tyrosine kinase, transferase; NMR {Homo sapiens} PDB: 2oj2_A 4hck_A 5hck_A Length = 86 Back     alignment and structure
>2kgt_A Tyrosine-protein kinase 6; SH3 domain, SRC kinase, PTK6, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 Length = 67 Back     alignment and structure
>1csk_A C-SRC SH3 domain; phosphotransferase; 2.50A {Homo sapiens} SCOP: b.34.2.1 Length = 71 Back     alignment and structure
>4esr_A Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domain, dynamin-2, protei binding, chronic myeloid leukemia; 1.53A {Homo sapiens} Length = 69 Back     alignment and structure
>3reb_B Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain binding, signaling, HCK SH3 domain, PR binding; 3.45A {Homo sapiens} Length = 90 Back     alignment and structure
>2dil_A Proline-serine-threonine phosphatase-interacting protein 1; SH3 domain, PEST phosphatase-interacting protein 1, CD2- binding protein 1; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A Length = 57 Back     alignment and structure
>2rqv_A BUD emergence protein 1; BEM1P, SH3, CDC42P, cytoplasm, cytoskeleton, SH3 domain, SIG protein; NMR {Saccharomyces cerevisiae} PDB: 2rqw_A Length = 108 Back     alignment and structure
>2csq_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>1jo8_A ABP1P, actin binding protein; SH3 domain actin-binding-protein, structural protein; 1.30A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 2k3b_A 2rpn_A Length = 58 Back     alignment and structure
>2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2iim_A Proto-oncogene tyrosine-protein kinase LCK; beta-barrels, signaling protein; HET: PG4; 1.00A {Homo sapiens} SCOP: b.34.2.1 PDB: 1h92_A 1kik_A Length = 62 Back     alignment and structure
>1wxb_A Epidermal growth factor receptor pathway substrate 8-like protein; SH3, EPS8, EPS8L2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2jt4_A Cytoskeleton assembly control protein SLA1; endocytosis, SH3, actin-binding, cytoplasm, cytoskeleton, phosphorylation, SH3 domain, DNA damage, DNA repair, nucleus; NMR {Saccharomyces cerevisiae} Length = 71 Back     alignment and structure
>2ecz_A Sorbin and SH3 domain-containing protein 1; glycoprotein, membrane, nuclear protein, phosphorylation, polymorphism, transport, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1wxt_A Hypothetical protein FLJ21522; SH3 domain, EPS8-related protein 3, protein-protein interaction, structural genomics; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2ega_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2ct4_A CDC42-interacting protein 4; thyroid receptor interacting protein 10, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2kym_A BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE20P PRR, CDC42P-interacting, S signaling protein; NMR {Lodderomyces elongisporus} Length = 120 Back     alignment and structure
>2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A Length = 60 Back     alignment and structure
>1ue9_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 80 Back     alignment and structure
>2dnu_A RUH-061, SH3 multiple domains 1; RSGI, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2dbk_A CRK-like protein; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A Length = 77 Back     alignment and structure
>2drm_A Acanthamoeba myosin IB; SH3 domain, contractIle protein; 1.35A {Acanthamoeba} PDB: 2drk_A Length = 58 Back     alignment and structure
>2ak5_A RHO guanine nucleotide exchange factor 7; adaptor proteins, CIN85, PIX/COOL, protein-protein interaction, X-RAY, endocytosis; 1.85A {Rattus norvegicus} PDB: 1zsg_A Length = 64 Back     alignment and structure
>2g6f_X RHO guanine nucleotide exchange factor 7; SH3 domain, peptide interaction, signaling protein; HET: NCO; 0.92A {Rattus norvegicus} PDB: 2df6_A* 2p4r_A 2esw_A Length = 59 Back     alignment and structure
>2dl5_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>1ujy_A RHO guanine nucleotide exchange factor 6; structural genomics, SH3 domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 76 Back     alignment and structure
>2egc_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2csi_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>2o2o_A SH3-domain kinase-binding protein 1; CIN85, protein binding; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>1tuc_A Alpha-spectrin; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton; 2.02A {Gallus gallus} SCOP: b.34.2.1 Length = 63 Back     alignment and structure
>2yun_A Nostrin; nitric oxide synthase trafficker, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>1wi7_A SH3-domain kinase binding protein 1; beta barrel, SH3KBP1, RUK, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Length = 68 Back     alignment and structure
>1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Length = 193 Back     alignment and structure
>3o5z_A Phosphatidylinositol 3-kinase regulatory subunit; SRC homology 3 domain, protein binding; 2.01A {Homo sapiens} PDB: 2kt1_A Length = 90 Back     alignment and structure
>2de0_X Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltransferase, N-glycan, COR SH3 domain; 2.61A {Homo sapiens} Length = 526 Back     alignment and structure
>2bzy_A CRK-like protein, CRKL SH3C; SH3 domain, dimer, nuclear export; 2.5A {Homo sapiens} PDB: 2bzx_A Length = 67 Back     alignment and structure
>3ngp_A Spectrin alpha chain, brain; beta barrel, structural protein; 1.08A {Gallus gallus} PDB: 1e7o_A 1e6g_A 1e6h_A 1uue_A 1h8k_A 2lj3_A 1aey_A 1m8m_A 1shg_A 1u06_A 2nuz_A 2cdt_A 1hd3_A 2f2v_A 2f2w_A 2jm8_A 2jm9_A 2jma_A 3m0r_A 3m0p_A ... Length = 62 Back     alignment and structure
>3u23_A CD2-associated protein; structural genomics, structural genomics consortium, SGC, BE barrel, adaptor protein, protein binding; 1.11A {Homo sapiens} PDB: 2krn_A Length = 65 Back     alignment and structure
>2cr4_A 3BP-2, SH3 domain-binding protein 2; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 126 Back     alignment and structure
>1neg_A Spectrin alpha chain, brain; SH3-domain fold, five antiparallel beta sheets, structural protein; 2.30A {Gallus gallus} SCOP: b.34.2.1 Length = 83 Back     alignment and structure
>1uur_A Stata protein, STAT protein; transcription activator, SH2, signal transduction, transducer, transcription factor; HET: PTR; 2.7A {Dictyostelium discoideum} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 1uus_A* Length = 473 Back     alignment and structure
>2cub_A Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor, tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2ekh_A SH3 and PX domain-containing protein 2A; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2ed0_A ABL interactor 2; coiled coil, cytoskeleton, nuclear protein, phosphorylation, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2dl3_A Sorbin and SH3 domain-containing protein 1; ponsin, C-CBL-associated protein, CAP, SH3 domain protein 5 SH3P12, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dlm_A Length = 68 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query366
2oq1_A254 Tyrosine-protein kinase ZAP-70; tandem SH2 domains 100.0
4fbn_A246 1-phosphatidylinositol 4,5-bisphosphate phosphodi 100.0
1a81_A254 SYK kinase; complex (transferase-peptide), SYK, ki 100.0
2ozo_A 613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 100.0
4fl3_A 635 Tyrosine-protein kinase SYK; transferase; HET: ANP 100.0
4d8k_A175 Tyrosine-protein kinase LCK; protein kinases, SH2 100.0
3ps5_A 595 Tyrosine-protein phosphatase non-receptor type 6; 99.97
2shp_A 525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 99.97
2b3o_A 532 Tyrosine-protein phosphatase, non-receptor type 6; 99.97
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 99.95
2eo3_A111 CRK-like protein; phosphorylation, repeat, SH2 dom 99.95
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 99.95
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 99.95
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 99.94
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 99.94
2dly_A121 FYN-related kinase; BRK family kinase, structural 99.94
3hhm_B373 NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil 99.93
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 99.93
3us4_A98 Megakaryocyte-associated tyrosine-protein kinase; 99.93
2crh_A138 VAV proto-oncogene; oncoprotein, structural genomi 99.92
2y3a_B302 Phosphatidylinositol 3-kinase regulatory subunit; 99.92
1blj_A114 P55 BLK protein tyrosine kinase; signal transducti 99.92
3eaz_A106 Tyrosine-protein kinase CSK; SH2, disulfide, oxidi 99.92
1lkk_A105 Human P56 tyrosine kinase; complex (tyrosine kinas 99.92
1d4t_A104 T cell signal transduction molecule SAP; SH2 domai 99.91
2ecd_A119 Tyrosine-protein kinase ABL2; SH2 domain, phosphot 99.91
1rja_A100 Tyrosine-protein kinase 6; human protein tyrosine 99.91
2gsb_A119 RAS GTPase-activating protein 1; GAP, RAS P21 prot 99.91
1nrv_A105 Growth factor receptor-bound protein 10; dimer, si 99.91
2dlz_A118 Protein VAV-2; RHO family guanine nucleotide excha 99.91
2eob_A124 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.91
3k2m_A112 Proto-oncogene tyrosine-protein kinase ABL1; engin 99.91
3s9k_A118 Tyrosine-protein kinase ITK/TSK; proline isomeriza 99.91
3pqz_A117 Growth factor receptor-bound protein 7; SH2, binds 99.9
3tkz_A109 Tyrosine-protein phosphatase non-receptor type 11; 99.9
1aot_F106 FYN protein-tyrosine kinase; SH2 domain, signal tr 99.9
1wqu_A114 C-FES, proto-oncogene tyrosine-protein kinase FES/ 99.9
1i3z_A103 EWS/FLI1 activated transcript 2; SH2 domain phosph 99.9
1h9o_A112 Phosphatidylinositol 3-kinase; transferase/recepto 99.9
2ysx_A119 Signaling inositol polyphosphate phosphatase SHIP 99.9
1ka6_A128 SH2 domain protein 1A; SH2 domain, protein-peptide 99.9
1mil_A104 SHC adaptor protein; SH2 domain, phosphorylation, 99.9
2lnw_A122 VAV-2, guanine nucleotide exchange factor VAV2; si 99.9
2dx0_A138 Phospholipase C, gamma 2; phosphoric diester hydro 99.9
2aug_A126 Growth factor receptor-bound protein 14; phosphory 99.9
2ekx_A110 Cytoplasmic tyrosine-protein kinase BMX; SH2 domai 99.9
2kk6_A116 Proto-oncogene tyrosine-protein kinase FER; method 99.89
3maz_A125 Signal-transducing adaptor protein 1; modular doma 99.89
2cs0_A119 Hematopoietic SH2 domain containing; ALX, FLJ14886 99.89
2ge9_A125 Tyrosine-protein kinase BTK; SH2 domain, structure 99.89
2iug_A120 Phosphatidylinositol 3-kinase regulatory alpha sub 99.89
2cia_A102 Cytoplasmic protein NCK2; SH2-domain, SH3 domain, 99.89
1ju5_A109 CRK; CRK, SH2, SH3, adaptor protein, phosphopeptid 99.89
2dm0_A125 Tyrosine-protein kinase TXK; TEC family kinase, st 99.89
3ov1_A117 Growth factor receptor-bound protein 2; GRB2 SH2 d 99.88
2el8_A118 Signal-transducing adaptor protein 2; SH2 domain, 99.88
2vif_A141 Suppressor of cytokine signalling 6; growth regula 99.88
2eo6_A141 B-cell linker protein; SH2, cytoplasmic adapter pr 99.88
1r1p_A100 GRB2-related adaptor protein 2; SH2, GADS, phospho 99.88
2dvj_A230 V-CRK sarcoma virus CT10 oncogene homolog, isoform 99.87
1jyr_A96 Growth factor receptor-bound protein 2; receptor b 99.87
2hdv_A111 SH2-B PH domain containing signaling mediator 1 ga 99.87
2kno_A131 Tensin-like C1 domain-containing phosphatase; SH2 99.87
2c9w_A169 Suppressor of cytokine signaling 2; growth regulat 99.86
4fbn_A246 1-phosphatidylinositol 4,5-bisphosphate phosphodi 99.85
3cxl_A 463 N-chimerin; SH2, RHO-GAP, structural genomics cons 99.85
2bbu_A164 Suppressor of cytokine signaling 3; SH2 domain, ex 99.85
2cr4_A126 3BP-2, SH3 domain-binding protein 2; structural ge 99.84
2izv_A187 Suppressor of cytokine signaling 4; signal transdu 99.84
2oq1_A254 Tyrosine-protein kinase ZAP-70; tandem SH2 domains 99.84
1a81_A254 SYK kinase; complex (transferase-peptide), SYK, ki 99.84
2hmh_A152 Suppressor of cytokine signaling 3; SOCS3, GP130, 99.83
3qwx_X174 Cell death abnormality protein 2; cell engulfment, 99.83
2eyz_A304 V-CRK sarcoma virus CT10 oncogene homolog isoform 99.82
3qwy_A308 Cell death abnormality protein 2; cell engulfment, 99.8
2lqn_A303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 99.68
4fl3_A 635 Tyrosine-protein kinase SYK; transferase; HET: ANP 99.79
2ozo_A 613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 99.75
2xp1_A178 SPT6; transcription, IWS1, histone chaperone, mRNA 99.74
3ps5_A 595 Tyrosine-protein phosphatase non-receptor type 6; 99.67
2shp_A525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 99.65
2b3o_A532 Tyrosine-protein phosphatase, non-receptor type 6; 99.63
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 99.56
3maz_A125 Signal-transducing adaptor protein 1; modular doma 99.53
1lkk_A105 Human P56 tyrosine kinase; complex (tyrosine kinas 99.53
3us4_A98 Megakaryocyte-associated tyrosine-protein kinase; 99.52
1rja_A100 Tyrosine-protein kinase 6; human protein tyrosine 99.51
3hhm_B373 NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil 99.5
2kk6_A116 Proto-oncogene tyrosine-protein kinase FER; method 99.48
2eob_A124 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.48
2yt6_A109 Adult MALE urinary bladder cDNA, riken FULL- lengt 99.48
3eaz_A106 Tyrosine-protein kinase CSK; SH2, disulfide, oxidi 99.48
1blj_A114 P55 BLK protein tyrosine kinase; signal transducti 99.47
2dly_A121 FYN-related kinase; BRK family kinase, structural 99.47
1aot_F106 FYN protein-tyrosine kinase; SH2 domain, signal tr 99.47
3k2m_A112 Proto-oncogene tyrosine-protein kinase ABL1; engin 99.46
1nrv_A105 Growth factor receptor-bound protein 10; dimer, si 99.45
3pqz_A117 Growth factor receptor-bound protein 7; SH2, binds 99.45
2eo3_A111 CRK-like protein; phosphorylation, repeat, SH2 dom 99.45
2aug_A126 Growth factor receptor-bound protein 14; phosphory 99.44
1d4t_A104 T cell signal transduction molecule SAP; SH2 domai 99.44
1i3z_A103 EWS/FLI1 activated transcript 2; SH2 domain phosph 99.42
2dx0_A138 Phospholipase C, gamma 2; phosphoric diester hydro 99.41
1ju5_A109 CRK; CRK, SH2, SH3, adaptor protein, phosphopeptid 99.4
2ysx_A119 Signaling inositol polyphosphate phosphatase SHIP 99.4
2ecd_A119 Tyrosine-protein kinase ABL2; SH2 domain, phosphot 99.4
3tkz_A109 Tyrosine-protein phosphatase non-receptor type 11; 99.4
4d8k_A175 Tyrosine-protein kinase LCK; protein kinases, SH2 99.4
2dlz_A118 Protein VAV-2; RHO family guanine nucleotide excha 99.4
3s9k_A118 Tyrosine-protein kinase ITK/TSK; proline isomeriza 99.39
1mil_A104 SHC adaptor protein; SH2 domain, phosphorylation, 99.39
2gsb_A119 RAS GTPase-activating protein 1; GAP, RAS P21 prot 99.38
2ekx_A110 Cytoplasmic tyrosine-protein kinase BMX; SH2 domai 99.38
2iug_A120 Phosphatidylinositol 3-kinase regulatory alpha sub 99.37
2kno_A131 Tensin-like C1 domain-containing phosphatase; SH2 99.36
2lnw_A122 VAV-2, guanine nucleotide exchange factor VAV2; si 99.36
1ka6_A128 SH2 domain protein 1A; SH2 domain, protein-peptide 99.35
1h9o_A112 Phosphatidylinositol 3-kinase; transferase/recepto 99.33
2cs0_A119 Hematopoietic SH2 domain containing; ALX, FLJ14886 99.33
2crh_A138 VAV proto-oncogene; oncoprotein, structural genomi 99.33
2cr4_A126 3BP-2, SH3 domain-binding protein 2; structural ge 99.33
2ge9_A125 Tyrosine-protein kinase BTK; SH2 domain, structure 99.32
2cia_A102 Cytoplasmic protein NCK2; SH2-domain, SH3 domain, 99.32
2el8_A118 Signal-transducing adaptor protein 2; SH2 domain, 99.32
2eo6_A141 B-cell linker protein; SH2, cytoplasmic adapter pr 99.31
2dm0_A125 Tyrosine-protein kinase TXK; TEC family kinase, st 99.3
3reb_B90 Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain 99.3
1wqu_A114 C-FES, proto-oncogene tyrosine-protein kinase FES/ 99.29
3or8_A197 Transcription elongation factor SPT6; SH2, CTD bin 99.26
2hdv_A111 SH2-B PH domain containing signaling mediator 1 ga 99.25
1r1p_A100 GRB2-related adaptor protein 2; SH2, GADS, phospho 99.22
3ov1_A117 Growth factor receptor-bound protein 2; GRB2 SH2 d 99.22
2c9w_A169 Suppressor of cytokine signaling 2; growth regulat 99.2
2vif_A141 Suppressor of cytokine signalling 6; growth regula 99.19
2bbu_A164 Suppressor of cytokine signaling 3; SH2 domain, ex 99.18
1jyr_A96 Growth factor receptor-bound protein 2; receptor b 99.18
2dvj_A230 V-CRK sarcoma virus CT10 oncogene homolog, isoform 99.15
2lj0_A65 Sorbin and SH3 domain-containing protein 1; R85FL, 99.14
2izv_A187 Suppressor of cytokine signaling 4; signal transdu 99.11
2eyz_A304 V-CRK sarcoma virus CT10 oncogene homolog isoform 99.09
2y3a_B302 Phosphatidylinositol 3-kinase regulatory subunit; 99.07
4ag1_C84 Fynomer; hydrolase-de novo protein complex, inhibi 99.04
2hmh_A152 Suppressor of cytokine signaling 3; SOCS3, GP130, 99.04
3qwx_X174 Cell death abnormality protein 2; cell engulfment, 99.03
1jo8_A58 ABP1P, actin binding protein; SH3 domain actin-bin 99.02
2j05_A65 RAS GTPase-activating protein 1; GTPase activation 99.01
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 99.0
2lqn_A303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 98.55
1gbq_A74 GRB2; complex (signal transduction/peptide), SH3 d 98.99
1zuy_A58 Myosin-5 isoform; SH3 domain, contractIle protein; 98.97
2lcs_A73 NAP1-binding protein 2; adaptor, transferase, sign 98.97
1gcq_C70 VAV proto-oncogene; SH3 domain, protein-protein co 98.96
2lx7_A60 GAS-7, growth arrest-specific protein 7; structura 98.96
1ruw_A69 Myosin-3 isoform, MYO3; SH3 domain, yeast, high-th 98.95
3cqt_A79 P59-FYN, proto-oncogene tyrosine-protein kinase FY 98.94
2fpe_A62 C-JUN-amino-terminal kinase interacting protein 1; 98.94
2yuq_A85 Tyrosine-protein kinase ITK/TSK; T-cell-specific k 98.91
1k1z_A78 VAV; SH3, proto-oncogene, signaling protein; NMR { 98.91
1yn8_A59 NBP2, NAP1-binding protein 2; SH3 domain, unknown 98.9
3h0h_A73 Proto-oncogene tyrosine-protein kinase FYN; beta b 98.9
2v1q_A60 SLA1, cytoskeleton assembly control protein SLA1; 98.9
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 98.9
1neg_A83 Spectrin alpha chain, brain; SH3-domain fold, five 98.9
2fpf_A71 C-JUN-amino-terminal kinase interacting protein 1; 98.9
4f14_A64 Nebulette; SH3 domain, heart muscle, actin-binding 98.89
1uti_A58 GRB2-related adaptor protein 2; signaling protein 98.89
2iim_A62 Proto-oncogene tyrosine-protein kinase LCK; beta-b 98.89
2vwf_A58 Growth factor receptor-bound protein 2; polymorphi 98.88
2o9s_A67 Ponsin; SH3 domain, signaling protein; 0.83A {Homo 98.88
2gqi_A71 RAS GTPase-activating protein 1; GAP, RAS P21 prot 98.88
1tuc_A63 Alpha-spectrin; capping protein, calcium-binding, 98.88
2jt4_A71 Cytoskeleton assembly control protein SLA1; endocy 98.88
2fei_A65 CD2-associated protein; CMS SH3 domain, structural 98.88
1tg0_A68 BBC1 protein, myosin tail region-interacting prote 98.88
1cka_A57 C-CRK N-terminal SH3 domain; complex (oncogene pro 98.87
2bz8_A58 SH3-domain kinase binding protein 1; SH3 domain, C 98.87
2kxc_A67 Brain-specific angiogenesis inhibitor 1-associate 98.87
1zx6_A58 YPR154WP; SH3 domain, protein binding; 1.60A {Sacc 98.87
2ew3_A68 SH3-containing GRB2-like protein 3; SH3GL3, soluti 98.86
1sem_A58 SEM-5; SRC-homology 3 (SH3) domain, peptide-bindin 98.86
1b07_A65 Protein (proto-oncogene CRK (CRK)); SH3 domain, in 98.85
1zlm_A58 Osteoclast stimulating factor 1; beta barrel, sign 98.85
2ydl_A69 SH3 domain-containing kinase-binding protein 1; si 98.85
2oaw_A65 Spectrin alpha chain, brain; SH3 domain, chimera, 98.84
2cuc_A70 SH3 domain containing ring finger 2; structural ge 98.84
2g6f_X59 RHO guanine nucleotide exchange factor 7; SH3 doma 98.84
1k4u_S62 Phagocyte NADPH oxidase subunit P67PHOX; SH3-pepti 98.84
1spk_A72 RSGI RUH-010, riken cDNA 1300006M19; structural ge 98.84
2ak5_A64 RHO guanine nucleotide exchange factor 7; adaptor 98.84
2nwm_A65 Vinexin; cell adhesion; NMR {Homo sapiens} 98.84
2drm_A58 Acanthamoeba myosin IB; SH3 domain, contractIle pr 98.84
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 98.83
3qwy_A308 Cell death abnormality protein 2; cell engulfment, 98.83
2xmf_A60 Myosin 1E SH3; motor protein, SH3 domain; HET: DIA 98.83
2ct3_A70 Vinexin; SH3 domian, structural genomics, NPPSFA, 98.83
1zuu_A58 BZZ1 protein; SH3 domain, unknown function; 0.97A 98.83
2e5k_A94 Suppressor of T-cell receptor signaling 1; SH3 dom 98.82
1w1f_A65 Tyrosine-protein kinase LYN; SH3-domain, SH3 domai 98.82
1gl5_A67 Tyrosine-protein kinase TEC; transferase, ATP-bind 98.82
2cud_A79 SRC-like-adapter; SH3 domain, negative mitogenesis 98.82
2kxd_A73 11-MER peptide, SH3 domain of spectrin alpha CHAI; 98.82
1csk_A71 C-SRC SH3 domain; phosphotransferase; 2.50A {Homo 98.82
1oot_A60 Hypothetical 40.4 kDa protein in PES4-His2 interge 98.81
2j6f_A62 CD2-associated protein; metal-binding, immune resp 98.81
2ed1_A76 130 kDa phosphatidylinositol 4,5-biphosphate- depe 98.81
1x6g_A81 Megakaryocyte-associated tyrosine-protein kinase; 98.8
1w70_A60 Neutrophil cytosol factor 4; NADPH oxidase, P40PHO 98.8
2dnu_A71 RUH-061, SH3 multiple domains 1; RSGI, structural 98.8
2a28_A54 BZZ1 protein; SH3 domain, signaling protein; 1.07A 98.79
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 98.79
2ecz_A70 Sorbin and SH3 domain-containing protein 1; glycop 98.79
2b86_A67 Cytoplasmic protein NCK2; NCK SH3 domain, signalin 98.79
2dl4_A68 Protein STAC; SH3 domain, STAC protein, SRC homolo 98.78
1u5s_A71 Cytoplasmic protein NCK2; protein-protein complex, 98.78
1aww_A67 ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linke 98.78
3rnj_A67 Brain-specific angiogenesis inhibitor 1-associate 98.78
2d8j_A77 FYN-related kinase; SH3 domain, structural genomic 98.77
2egc_A75 SH3 and PX domain-containing protein 2A; SH3 domai 98.77
3ngp_A62 Spectrin alpha chain, brain; beta barrel, structur 98.77
2yup_A90 Vinexin; sorbin and SH3 domain-containing protein 98.77
3ulr_B65 SRC substrate cortactin; SH3, protein-protein inte 98.77
1uhc_A79 KIAA1010 protein; beta barrel, SH3, human cDNA, st 98.77
1x2k_A68 OSTF1, osteoclast stimulating factor 1; SH3 domain 98.76
2djq_A68 SH3 domain containing ring finger 2; MUS musculus 98.76
2gnc_A60 SLIT-ROBO RHO GTPase-activating protein 1; beta ba 98.76
1ue9_A80 Intersectin 2; beta barrel, SH3 domain, riken stru 98.75
1i07_A60 Epidermal growth factor receptor kinase substrate 98.75
1uj0_A62 Signal transducing adaptor molecule (SH3 domain an 98.75
2jte_A64 CD2-associated protein; SH3 domain, coiled coil, c 98.75
4esr_A69 Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domai 98.74
2epd_A76 RHO GTPase-activating protein 4; SH3 domain, struc 98.74
2ke9_A83 Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosp 98.74
2kgt_A72 Tyrosine-protein kinase 6; SH3 domain, SRC kinase, 98.74
1nm7_A69 Peroxisomal membrane protein PAS20; yeast, PEX5P, 98.74
2vkn_A70 Protein SSU81; membrane, SH3 domain, transmembrane 98.74
2eyx_A67 V-CRK sarcoma virus CT10 oncogene homolog isoform 98.74
1x2p_A68 Protein arginine N-methyltransferase 2; SH3 domain 98.74
2dl3_A68 Sorbin and SH3 domain-containing protein 1; ponsin 98.74
4e6r_A58 Cytoplasmic protein NCK2; SH3 domain, protein bind 98.73
1wyx_A69 CRK-associated substrate; beta sheets, cell adhesi 98.73
2dil_A69 Proline-serine-threonine phosphatase-interacting p 98.73
2dl8_A72 SLIT-ROBO RHO GTPase-activating protein 2; SH3 dom 98.73
2ed0_A78 ABL interactor 2; coiled coil, cytoskeleton, nucle 98.73
1wxt_A68 Hypothetical protein FLJ21522; SH3 domain, EPS8-re 98.73
2pqh_A80 Spectrin alpha chain, brain; SH3 domain, chimera, 98.73
2bzy_A67 CRK-like protein, CRKL SH3C; SH3 domain, dimer, nu 98.72
2enm_A77 Sorting nexin-9; SH3-like barrel, protein transpor 98.72
2jw4_A72 Cytoplasmic protein NCK1; SH3 domain, phosphorylat 98.72
1s1n_A68 Nephrocystin 1; beta barrel, cell adhesion; NMR {H 98.72
3c0c_A73 Endophilin-A2; endocytosis, SH3, voltage-gated cal 98.72
2yuo_A78 CIP85, RUN and TBC1 domain containing 3; structura 98.72
2x3w_D60 Syndapin I, protein kinase C and casein kinase sub 98.72
1x6b_A79 RHO guanine exchange factor (GEF) 16; SH3 domain, 98.72
2ekh_A80 SH3 and PX domain-containing protein 2A; SH3 domai 98.71
3thk_A73 Spectrin alpha chain, brain; SH3 domain, chimera, 98.71
2dl7_A73 KIAA0769 protein; SH3 domain, FCHSD2, structural g 98.71
2k2m_A68 EPS8-like protein 1; alternative splicing, coiled 98.7
2da9_A70 SH3-domain kinase binding protein 1; structural ge 98.7
3eg3_A63 Proto-oncogene tyrosine-protein kinase ABL1; beta, 98.7
2cre_A71 HEF-like protein; SH3 domain, SRC homology 3 domai 98.7
2oi3_A86 Tyrosine-protein kinase HCK; human HCK, SH3, SRC-t 98.69
2k9g_A73 SH3 domain-containing kinase-binding protein 1; CI 98.69
1y0m_A61 1-phosphatidylinositol-4,5-bisphosphate phosphodie 98.68
2ege_A75 Uncharacterized protein KIAA1666; SH3 domain, KIAA 98.68
2dbm_A73 SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH 98.68
2i0n_A80 Class VII unconventional myosin; beta-sheet loop, 98.68
1wxb_A68 Epidermal growth factor receptor pathway substrate 98.68
2ysq_A81 RHO guanine nucleotide exchange factor 9; SH3 doma 98.68
2ebp_A73 SAM and SH3 domain-containing protein 1; proline-g 98.68
1wie_A96 RIM binding protein 2; beta barrel, KIAA0318 prote 98.68
4glm_A72 Dynamin-binding protein; SH3 domain, DNMBP, struct 98.68
2rf0_A89 Mitogen-activated protein kinase kinase kinase 10; 98.68
2ct4_A70 CDC42-interacting protein 4; thyroid receptor inte 98.67
3u23_A65 CD2-associated protein; structural genomics, struc 98.67
1u3o_A82 Huntingtin-associated protein-interacting protein; 98.67
2yun_A79 Nostrin; nitric oxide synthase trafficker, structu 98.66
1awj_A77 ITK; transferase, regulatory intramolecular comple 98.66
2eqi_A69 Phospholipase C, gamma 2; SH3 domain, PLCG2, struc 98.66
1wx6_A91 Cytoplasmic protein NCK2; SH3 domain, structural g 98.66
2d8h_A80 SH3YL1 protein; SH3 domain, hypothetical protein S 98.66
2jmc_A77 Spectrin alpha chain, brain and P41 peptide chimer 98.66
2csi_A76 RIM-BP2, RIM binding protein 2; SH3 domain, struct 98.65
2dl5_A78 KIAA0769 protein; SH3 domain, FCHSD2, structural g 98.65
1wi7_A68 SH3-domain kinase binding protein 1; beta barrel, 98.65
2ega_A70 SH3 and PX domain-containing protein 2A; SH3 domai 98.65
2dmo_A68 Neutrophil cytosol factor 2; SH3 domain, structura 98.65
2jxb_A86 T-cell surface glycoprotein CD3 epsilon chain, cyt 98.65
2cub_A88 Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor 98.64
1ugv_A72 KIAA0621, olygophrenin-1 like protein; beta barrel 98.64
1x69_A79 Cortactin isoform A; SH3 domain, CTTN, oncogene EM 98.63
1z9q_A79 Neutrophil cytosol factor 4; oxidoreductase activa 98.62
1ujy_A76 RHO guanine nucleotide exchange factor 6; structur 98.61
2rqv_A108 BUD emergence protein 1; BEM1P, SH3, CDC42P, cytop 98.61
1i1j_A108 Melanoma derived growth regulatory protein; SH3 su 98.61
2v1r_A80 Peroxisomal membrane protein PAS20; protein transp 98.61
1v1c_A71 Obscurin; muscle, sarcomere, adapter, myogenesis, 98.61
1x43_A81 Endophilin B1, SH3 domain GRB2-like protein B1; st 98.61
2kym_A120 BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI 98.61
2dm1_A73 Protein VAV-2; RHO family guanine nucleotide excha 98.61
1uff_A93 Intersectin 2; beta barrel, SH3 domain, endocytosi 98.61
2dbk_A88 CRK-like protein; structural genomics, NPPSFA, nat 98.6
2l0a_A72 STAM-1, signal transducing adapter molecule 1; str 98.6
1uhf_A69 Intersectin 2; beta barrel, SH3 domain, riken stru 98.6
1x2q_A88 Signal transducing adapter molecule 2; SH3 domain, 98.6
1j3t_A74 Intersectin 2; beta barrel, SH3 domain, riken stru 98.6
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 98.59
2dlp_A85 KIAA1783 protein; SH3 domain, structural genomics, 98.59
2o2o_A92 SH3-domain kinase-binding protein 1; CIN85, protei 98.59
1udl_A98 Intersectin 2, KIAA1256; beta barrel, SH3 domain, 98.58
1jqq_A92 PEX13P, peroxisomal membrane protein PAS20, PAS20P 98.58
3i5r_A83 Phosphatidylinositol 3-kinase regulatory subunit a 98.57
2csq_A97 RIM-BP2, RIM binding protein 2; SH3 domain, struct 98.56
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 98.56
2m0y_A74 Dedicator of cytokinesis protein 1; apoptosis; NMR 98.55
3o5z_A90 Phosphatidylinositol 3-kinase regulatory subunit; 98.52
3cbl_A 377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 98.47
1bb9_A115 Amphiphysin 2; transferase, SH3 domain; 2.20A {Rat 98.46
1hsq_A71 Phospholipase C-gamma (SH3 domain); phosphoric die 98.45
2rqr_A119 CED-12 homolog, engulfment and cell motility prote 98.45
1ri9_A102 FYN-binding protein; SH3-like, helically extended, 98.45
2kbt_A142 Chimera of proto-oncogene VAV, linker, immunoglobu 98.44
2de0_X526 Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltran 98.43
3cxl_A 463 N-chimerin; SH2, RHO-GAP, structural genomics cons 98.4
3bxj_A 483 RAS GTPase-activating protein syngap; GTPase activ 98.35
1wxu_A93 Peroxisomal biogenesis factor 13; SH3 domain, PEX1 98.35
2gtj_A96 FYN-binding protein; SH3, redox, signaling protein 98.26
3jv3_A283 Intersectin-1; SH3 domain, DH domain, guanine nucl 98.24
1ng2_A193 Neutrophil cytosolic factor 1; P47PHOX, autoinhibi 98.24
1kjw_A295 Postsynaptic density protein 95; protein-protein i 98.21
1ng2_A193 Neutrophil cytosolic factor 1; P47PHOX, autoinhibi 98.21
1wer_A 334 P120GAP; GTPase activation, RAS, signal transducti 98.08
2xp1_A178 SPT6; transcription, IWS1, histone chaperone, mRNA 98.07
3psi_A1219 Transcription elongation factor SPT6; nucleus; 3.3 98.06
1uur_A473 Stata protein, STAT protein; transcription activat 98.01
3a98_A184 DOCK2, dedicator of cytokinesis protein 2; protein 98.0
2pz1_A466 RHO guanine nucleotide exchange factor 4; helical 97.97
2dyb_A341 Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid 97.95
1ug1_A92 KIAA1010 protein; structural genomics, SH3 domain, 97.92
4dey_A337 Voltage-dependent L-type calcium channel subunit; 97.64
3pvl_A655 Myosin VIIA isoform 1; protein complex, novel fold 97.59
3kfv_A308 Tight junction protein ZO-3; structural genomics c 97.45
3tsz_A391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 97.44
1g2b_A62 Spectrin alpha chain; capping protein, calcium-bin 97.41
3shw_A468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 97.33
3pe0_A283 Plectin; cytoskeleton, plakin, spectrin repeat, SH 97.29
2xkx_A721 Disks large homolog 4; structural protein, scaffol 97.21
1y1u_A585 Signal transducer and activator of transcription; 97.14
3tvt_A292 Disks large 1 tumor suppressor protein; DLG, SRC-h 97.12
1yvl_A683 Signal transducer and activator of transcription 1 97.02
3or8_A197 Transcription elongation factor SPT6; SH2, CTD bin 96.87
1bg1_A596 Protein (transcription factor STAT3B); protein-DNA 96.84
1bf5_A575 Signal transducer and activator of transcription 1 96.44
3r6n_A450 Desmoplakin; spectrin repeat, SH3 domain, cell adh 96.1
3bux_B329 E3 ubiquitin-protein ligase CBL; TKB, signal trans 95.24
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 94.79
3op0_A323 Signal transduction protein CBL-C; structural geno 94.54
1nf1_A 333 NF1-333, protein (neurofibromin); type I neurofibr 93.22
2krs_A74 Probable enterotoxin; all beta, SH3, ENTD, CPF_058 89.29
2kt8_A76 Probable surface protein; SH3 family, structural g 86.67
2kq8_A70 Cell WALL hydrolase; GFT protein structure, NESG, 86.5
1uur_A473 Stata protein, STAT protein; transcription activat 85.03
3psi_A1219 Transcription elongation factor SPT6; nucleus; 3.3 80.77
>2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A Back     alignment and structure
Probab=100.00  E-value=1.3e-36  Score=287.36  Aligned_cols=181  Identities=20%  Similarity=0.296  Sum_probs=157.5

Q ss_pred             CCCCcccCcCCcccHHHHHHHHhcC--CCCcEEEecCCCCCCceEEEEeecCeeEEEEEEe-C-CeEEecCCcccCCHHH
Q psy13521         52 DPNTVFDWFHPECTKNDAVDMLVKA--GPGSFLVRPSDNSPGDYSLFFHINNQIQRFRIEK-K-AVRYLMGGRTFECLDA  127 (366)
Q Consensus        52 ~p~e~~~WyhG~IsR~eAE~lL~~~--~~GsFLVR~S~s~pg~y~LSv~~~~~V~H~rI~~-~-g~~y~~~~~~F~SL~e  127 (366)
                      |+.+.++||||.|+|++||++|...  .+|+||||+|++.+|.|+||++.++.|+||+|.. . |.+++.++..|+||.+
T Consensus         1 d~~~~~~Wyhg~isR~~Ae~lL~~~~~~~G~FLVR~S~~~~g~y~LSv~~~~~v~H~~I~~~~~g~~~l~~~~~F~sl~~   80 (254)
T 2oq1_A            1 DPAAHLPFFYGSISRAEAEEHLKLAGMADGLFLLRQCLRSLGGYVLSLVHDVRFHHFPIERQLNGTYAIAGGKAHCGPAE   80 (254)
T ss_dssp             CTTTTCTTBCBSCCHHHHHHHHHHTTCCTTCEEEEECSSSTTCEEEEEEETTEEEEEEEEECTTSCEEETTSCCBSSHHH
T ss_pred             CccccCCccCCCCCHHHHHHHHhccCCCCcEEEEEeCCCCCCCEEEEEEECCeEEEEEEEEeCCCCEEeCCCCccCCHHH
Confidence            3567789999999999999999653  4999999999999999999999999999999987 4 4555667899999999


Q ss_pred             HHHHhhhcCCccceeecCCccCCCcc------------------------------------------------------
Q psy13521        128 VINRYRKEQIVEGHTLGFPVTRMSRQ------------------------------------------------------  153 (366)
Q Consensus       128 LV~~Y~~~~l~l~~~L~~Pv~~~~~~------------------------------------------------------  153 (366)
                      ||+||+.++++++++|+.||+++.+.                                                      
T Consensus        81 LV~~y~~~~~~l~~~L~~p~~~~~~~~~~~~~f~~i~~~~l~~~v~~~w~~~~~~~~~~~~~~~p~~~~~~~~~~l~~~~  160 (254)
T 2oq1_A           81 LCEFYSRDPDGLPCNLRKPCNRPSGLEPQPGVFDCLRDAMVRDYVRQTWKLEGEALEQAIISQAPQVEKLIATTAHERMP  160 (254)
T ss_dssp             HHHHHHHCCTTSSSCCCSBCCCCTTCCCBCCHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHGGGGST
T ss_pred             HHHHHHhCCCCcccccccccCCCCCCCCCcccccchhHHHHHHHHHHHHhhcchhhhhhhccCCccccccccccccCCCc
Confidence            99999999999999999999875421                                                      


Q ss_pred             h---hh-------hh--cCCCcceeEeecCCCCCCceEEEEEeCCeEEEEEEeec--CeEEEcCCCccCCHHHHHHHHHh
Q psy13521        154 W---KI-------AT--KGSCHKSFLVRPSDNSPGDYSLFFHINNQIQRFRIEKK--AVRYLMGGRTFECLDAVINRYRK  219 (366)
Q Consensus       154 ~---~i-------~~--~g~~~G~FLVR~S~~~~g~y~LSfv~~~~V~HykI~~~--~~~yi~~~~~F~sL~eLV~~Y~~  219 (366)
                      |   .|       ++  .|+++|+||||.| +.+|.|+||+..++.|+||+|...  +.+|+.++..|+||.+||+||+.
T Consensus       161 Wyhg~isR~~Ae~lL~~~g~~~G~FLVR~S-~~~g~~~LSv~~~~~v~H~~I~~~~~g~~~~~~~~~F~sl~~LV~~y~~  239 (254)
T 2oq1_A          161 WYHSSLTREEAERKLYSGAQTDGKFLLRPR-KEQGTYALSLIYGKTVYHYLISQDKAGKYCIPEGTKFDTLWQLVEYLKL  239 (254)
T ss_dssp             TBCSSCCHHHHHHHHHSSCCCTTEEEEEEC-SSTTEEEEEEEETTEEEEEEEEECTTSCEESTTSCCBSSHHHHHHHHHH
T ss_pred             ccccCCCHHHHHHHHHhcCCCCceEEEEec-CCCCCEEEEEEECCeEEEEEEEEcCCCCEEECCCceECCHHHHHHHHHh
Confidence            2   01       12  2558999999999 779999999888999999999863  46777778999999999999999


Q ss_pred             cccccccccCCCCC
Q psy13521        220 EQIVEGHTLGFPVT  233 (366)
Q Consensus       220 ~~i~~~~~L~~pv~  233 (366)
                      ++++++++|..||+
T Consensus       240 ~~~~l~~~L~~p~~  253 (254)
T 2oq1_A          240 KADGLIYCLKEACP  253 (254)
T ss_dssp             CCTTSSSCCCSBCC
T ss_pred             CCCCCCeeCCccCc
Confidence            99999999999995
>4fbn_A 1-phosphatidylinositol 4,5-bisphosphate phosphodi gamma-1; SH2 domain, plcgamma specific array, interaction domain, FIB growth factor receptor 1; 2.40A {Homo sapiens} PDB: 4ey0_A* 3gqi_B* 2fci_A* 2pld_A* 2ple_A* Back     alignment and structure
>1a81_A SYK kinase; complex (transferase-peptide), SYK, kinase, SH2 domain; HET: PTR; 3.00A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1csy_A* 1csz_A* Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>2eo3_A CRK-like protein; phosphorylation, repeat, SH2 domain, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>2dly_A FYN-related kinase; BRK family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Back     alignment and structure
>3us4_A Megakaryocyte-associated tyrosine-protein kinase; SH2 domain, signaling protein, structural genomics, joint CE structural genomics, JCSG; 1.50A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jwo_A Back     alignment and structure
>2crh_A VAV proto-oncogene; oncoprotein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2ror_A* 2lct_A* Back     alignment and structure
>2y3a_B Phosphatidylinositol 3-kinase regulatory subunit; transferase, phosphoinositide 3-kinase, RTK; HET: GD9; 3.30A {Mus musculus} Back     alignment and structure
>1blj_A P55 BLK protein tyrosine kinase; signal transduction, transferase, phosphotransferase, phosphorylation; NMR {Mus musculus} SCOP: d.93.1.1 PDB: 1blk_A Back     alignment and structure
>3eaz_A Tyrosine-protein kinase CSK; SH2, disulfide, oxidized reduced, ATP-binding, cell membrane, cytoplasm, membrane, nucleotide-binding, phosphoprotein; 1.31A {Homo sapiens} PDB: 3eac_A Back     alignment and structure
>1lkk_A Human P56 tyrosine kinase; complex (tyrosine kinase/peptide); HET: PTR; 1.00A {Homo sapiens} SCOP: d.93.1.1 PDB: 1lcj_A* 1bhf_A* 1bhh_A 1lkl_A* 1bhh_B 1fbz_A* 1ijr_A* 1cwd_L* 1cwe_A* Back     alignment and structure
>1d4t_A T cell signal transduction molecule SAP; SH2 domain, tyrosine kinase, signal transduction, peptide recognition, signaling protein; 1.10A {Homo sapiens} SCOP: d.93.1.1 PDB: 1d1z_A 1d4w_A* 1m27_A* Back     alignment and structure
>2ecd_A Tyrosine-protein kinase ABL2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1rja_A Tyrosine-protein kinase 6; human protein tyrosine kinase-6 (PTK6/BRK), SRC homology 2(S domain, solution structure, backbone dynamics, transferase; NMR {Homo sapiens} SCOP: d.93.1.1 Back     alignment and structure
>2gsb_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1nrv_A Growth factor receptor-bound protein 10; dimer, signaling protein; 1.65A {Homo sapiens} SCOP: d.93.1.1 PDB: 3m7f_A Back     alignment and structure
>2dlz_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eob_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 2; SH2, phosphoinositide phospholipase C, PLC-gamma-2, phospholipase C-gamma-2; NMR {Rattus norvegicus} Back     alignment and structure
>3k2m_A Proto-oncogene tyrosine-protein kinase ABL1; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_A 3t04_A 1ab2_A Back     alignment and structure
>3s9k_A Tyrosine-protein kinase ITK/TSK; proline isomerization, CIS proline, domain swapped dimer, SH transferase; HET: CIT; 2.35A {Mus musculus} PDB: 2etz_A* 2eu0_A* 1lui_A 1luk_A 1lum_A 1lun_A 2k79_B 2k7a_B Back     alignment and structure
>3pqz_A Growth factor receptor-bound protein 7; SH2, binds phosphotyrosine, tyrosine kinases, cytoplasmic, P binding; 2.41A {Homo sapiens} PDB: 1mw4_A* 2l4k_A* 2qms_A Back     alignment and structure
>3tkz_A Tyrosine-protein phosphatase non-receptor type 11; SH2 domain, protein protein interactions, PTR residues, HYDR peptide complex; HET: PTR; 1.80A {Homo sapiens} PDB: 3tl0_A* 1aya_A* 1ayb_A* 1ayc_A* 1ayd_A Back     alignment and structure
>1aot_F FYN protein-tyrosine kinase; SH2 domain, signal transduction, peptide complex, complex (proto-oncogene/early protein); HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1aou_F* Back     alignment and structure
>1wqu_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; SH2 domain, feline sarcoma oncogene, structural genomics; NMR {Homo sapiens} PDB: 2dcr_A Back     alignment and structure
>1i3z_A EWS/FLI1 activated transcript 2; SH2 domain phosphotyrosine signal transduction lymphocyte, signaling protein; HET: PTR; 2.15A {Mus musculus} SCOP: d.93.1.1 Back     alignment and structure
>1h9o_A Phosphatidylinositol 3-kinase; transferase/receptor, complex (phosphotransferase/receptor), phosphotransferase, SH2 domain; HET: PTR; 1.79A {Homo sapiens} SCOP: d.93.1.1 PDB: 1pic_A* 1bfi_A 1bfj_A 1qad_A Back     alignment and structure
>2ysx_A Signaling inositol polyphosphate phosphatase SHIP II; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} Back     alignment and structure
>1ka6_A SH2 domain protein 1A; SH2 domain, protein-peptide complex, immune system; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1ka7_A Back     alignment and structure
>1mil_A SHC adaptor protein; SH2 domain, phosphorylation, collagen, growth regulation, transforming protein, alternative initiation; 2.70A {Homo sapiens} SCOP: d.93.1.1 PDB: 1tce_A* Back     alignment and structure
>2lnw_A VAV-2, guanine nucleotide exchange factor VAV2; signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2lnx_A Back     alignment and structure
>2dx0_A Phospholipase C, gamma 2; phosphoric diester hydrolase, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.50A {Mus musculus} Back     alignment and structure
>2aug_A Growth factor receptor-bound protein 14; phosphorylation, SH2 domain, signaling protein; 2.30A {Homo sapiens} Back     alignment and structure
>2ekx_A Cytoplasmic tyrosine-protein kinase BMX; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} Back     alignment and structure
>2kk6_A Proto-oncogene tyrosine-protein kinase FER; methods development, SH2, NESG, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>3maz_A Signal-transducing adaptor protein 1; modular domain, phosphotyrosine, specificity, cytoplasm, phosphoprotein, SH2 domain, signaling protein; HET: PTR; 1.90A {Homo sapiens} Back     alignment and structure
>2cs0_A Hematopoietic SH2 domain containing; ALX, FLJ14886, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.93.1.1 Back     alignment and structure
>2ge9_A Tyrosine-protein kinase BTK; SH2 domain, structure, transferase; NMR {Homo sapiens} Back     alignment and structure
>2iug_A Phosphatidylinositol 3-kinase regulatory alpha subunit; transferase, polymorphism, UBL conjugation, phosphorylation, SH2, PI3K, SH2 domain; 1.89A {Homo sapiens} PDB: 2iuh_A* 2iui_A* 1fu5_A* 1fu6_A 1oo3_A 1oo4_A* 2pna_A 2pnb_A Back     alignment and structure
>2cia_A Cytoplasmic protein NCK2; SH2-domain, SH3 domain, phosphorylation, binding specificity; HET: PTR MPD; 1.45A {Homo sapiens} PDB: 1z3k_A 2ci9_A* 2ci8_A* Back     alignment and structure
>1ju5_A CRK; CRK, SH2, SH3, adaptor protein, phosphopeptide, protein binding/transferase complex; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 Back     alignment and structure
>2dm0_A Tyrosine-protein kinase TXK; TEC family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ov1_A Growth factor receptor-bound protein 2; GRB2 SH2 domain, phosphotyrosine binding, signaling protein, signaling protein-antagonist complex; HET: PTR; 1.60A {Homo sapiens} SCOP: d.93.1.1 PDB: 3imj_A* 3in7_A* 3imd_A* 3kfj_A* 3n8m_A* 3in8_A* 3s8l_A* 3s8n_A* 3s8o_A* 2huy_A* 2h5k_A* 2huw_A* 2h46_E* 3c7i_A* 3n84_A* 1fhs_A 1bm2_A* 1bmb_A* 3ove_A* 1fyr_A* ... Back     alignment and structure
>2el8_A Signal-transducing adaptor protein 2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2vif_A Suppressor of cytokine signalling 6; growth regulation, signal transduction inhibitor, KIT regula phosphotyrosine, signaling protein; HET: PTR; 1.45A {Homo sapiens} Back     alignment and structure
>2eo6_A B-cell linker protein; SH2, cytoplasmic adapter protein, B-cell adapter containing SH2 domain protein; NMR {Mus musculus} Back     alignment and structure
>1r1p_A GRB2-related adaptor protein 2; SH2, GADS, phosphopeptide, peptide binding protein; HET: PTR; 1.80A {Mus musculus} SCOP: d.93.1.1 PDB: 1r1q_A* 1r1s_A* Back     alignment and structure
>2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Back     alignment and structure
>1jyr_A Growth factor receptor-bound protein 2; receptor binding, regulatory, inhibitor, signaling protein-I complex; HET: PTR; 1.55A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jyq_A* 1jyu_A 1qg1_E* 1x0n_A* 2aob_A* 2aoa_A* 3n7y_A* 1tze_E* 1zfp_E* 3mxc_A* 3mxy_A* 1cj1_A* Back     alignment and structure
>2hdv_A SH2-B PH domain containing signaling mediator 1 gamma isoform; adapter protein, signaling protein; 2.00A {Mus musculus} PDB: 2hdx_A* 1rpy_A 1rqq_C* Back     alignment and structure
>2kno_A Tensin-like C1 domain-containing phosphatase; SH2 domain, TENC1, solution structure, cell junctio membrane, hydrolase, membrane, metal-binding; NMR {Homo sapiens} PDB: 2l6k_A Back     alignment and structure
>2c9w_A Suppressor of cytokine signaling 2; growth regulation, SH2 domain, signal transduction inhibitor nuclear protein; 1.9A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 Back     alignment and structure
>4fbn_A 1-phosphatidylinositol 4,5-bisphosphate phosphodi gamma-1; SH2 domain, plcgamma specific array, interaction domain, FIB growth factor receptor 1; 2.40A {Homo sapiens} PDB: 4ey0_A* 3gqi_B* 2fci_A* 2pld_A* 2ple_A* Back     alignment and structure
>3cxl_A N-chimerin; SH2, RHO-GAP, structural genomics consortium, SGC, gtpas activation, metal-binding, phorbol-ester binding, SH2 domai finger; 2.60A {Homo sapiens} PDB: 1xa6_A Back     alignment and structure
>2bbu_A Suppressor of cytokine signaling 3; SH2 domain, extended SH2 subdomain, PEST motif, protein complex, cytokine regulator; HET: PTR; NMR {Mus musculus} Back     alignment and structure
>2cr4_A 3BP-2, SH3 domain-binding protein 2; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2izv_A Suppressor of cytokine signaling 4; signal transduction inhibitor, growth regulation, signal transduction, SH2 domain, nuclear protein; 2.55A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 Back     alignment and structure
>2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A Back     alignment and structure
>1a81_A SYK kinase; complex (transferase-peptide), SYK, kinase, SH2 domain; HET: PTR; 3.00A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1csy_A* 1csz_A* Back     alignment and structure
>2hmh_A Suppressor of cytokine signaling 3; SOCS3, GP130, PTyr, peptide complex, cytokine regulator; HET: PTR; 2.00A {Mus musculus} Back     alignment and structure
>3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>2xp1_A SPT6; transcription, IWS1, histone chaperone, mRNA export; 2.20A {Antonospora locustae} Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>3maz_A Signal-transducing adaptor protein 1; modular domain, phosphotyrosine, specificity, cytoplasm, phosphoprotein, SH2 domain, signaling protein; HET: PTR; 1.90A {Homo sapiens} Back     alignment and structure
>1lkk_A Human P56 tyrosine kinase; complex (tyrosine kinase/peptide); HET: PTR; 1.00A {Homo sapiens} SCOP: d.93.1.1 PDB: 1lcj_A* 1bhf_A* 1bhh_A 1lkl_A* 1bhh_B 1fbz_A* 1ijr_A* 1cwd_L* 1cwe_A* Back     alignment and structure
>3us4_A Megakaryocyte-associated tyrosine-protein kinase; SH2 domain, signaling protein, structural genomics, joint CE structural genomics, JCSG; 1.50A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jwo_A Back     alignment and structure
>1rja_A Tyrosine-protein kinase 6; human protein tyrosine kinase-6 (PTK6/BRK), SRC homology 2(S domain, solution structure, backbone dynamics, transferase; NMR {Homo sapiens} SCOP: d.93.1.1 Back     alignment and structure
>3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A Back     alignment and structure
>2kk6_A Proto-oncogene tyrosine-protein kinase FER; methods development, SH2, NESG, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>2eob_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 2; SH2, phosphoinositide phospholipase C, PLC-gamma-2, phospholipase C-gamma-2; NMR {Rattus norvegicus} Back     alignment and structure
>2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} Back     alignment and structure
>3eaz_A Tyrosine-protein kinase CSK; SH2, disulfide, oxidized reduced, ATP-binding, cell membrane, cytoplasm, membrane, nucleotide-binding, phosphoprotein; 1.31A {Homo sapiens} PDB: 3eac_A Back     alignment and structure
>1blj_A P55 BLK protein tyrosine kinase; signal transduction, transferase, phosphotransferase, phosphorylation; NMR {Mus musculus} SCOP: d.93.1.1 PDB: 1blk_A Back     alignment and structure
>2dly_A FYN-related kinase; BRK family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1aot_F FYN protein-tyrosine kinase; SH2 domain, signal transduction, peptide complex, complex (proto-oncogene/early protein); HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1aou_F* Back     alignment and structure
>3k2m_A Proto-oncogene tyrosine-protein kinase ABL1; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_A 3t04_A 1ab2_A Back     alignment and structure
>1nrv_A Growth factor receptor-bound protein 10; dimer, signaling protein; 1.65A {Homo sapiens} SCOP: d.93.1.1 PDB: 3m7f_A Back     alignment and structure
>3pqz_A Growth factor receptor-bound protein 7; SH2, binds phosphotyrosine, tyrosine kinases, cytoplasmic, P binding; 2.41A {Homo sapiens} PDB: 1mw4_A* 2l4k_A* 2qms_A Back     alignment and structure
>2eo3_A CRK-like protein; phosphorylation, repeat, SH2 domain, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2aug_A Growth factor receptor-bound protein 14; phosphorylation, SH2 domain, signaling protein; 2.30A {Homo sapiens} Back     alignment and structure
>1d4t_A T cell signal transduction molecule SAP; SH2 domain, tyrosine kinase, signal transduction, peptide recognition, signaling protein; 1.10A {Homo sapiens} SCOP: d.93.1.1 PDB: 1d1z_A 1d4w_A* 1m27_A* Back     alignment and structure
>1i3z_A EWS/FLI1 activated transcript 2; SH2 domain phosphotyrosine signal transduction lymphocyte, signaling protein; HET: PTR; 2.15A {Mus musculus} SCOP: d.93.1.1 Back     alignment and structure
>2dx0_A Phospholipase C, gamma 2; phosphoric diester hydrolase, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.50A {Mus musculus} Back     alignment and structure
>1ju5_A CRK; CRK, SH2, SH3, adaptor protein, phosphopeptide, protein binding/transferase complex; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 Back     alignment and structure
>2ysx_A Signaling inositol polyphosphate phosphatase SHIP II; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} Back     alignment and structure
>2ecd_A Tyrosine-protein kinase ABL2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3tkz_A Tyrosine-protein phosphatase non-receptor type 11; SH2 domain, protein protein interactions, PTR residues, HYDR peptide complex; HET: PTR; 1.80A {Homo sapiens} PDB: 3tl0_A* 1aya_A* 1ayb_A* 1ayc_A* 1ayd_A Back     alignment and structure
>4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* Back     alignment and structure
>2dlz_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3s9k_A Tyrosine-protein kinase ITK/TSK; proline isomerization, CIS proline, domain swapped dimer, SH transferase; HET: CIT; 2.35A {Mus musculus} PDB: 2etz_A* 2eu0_A* 1lui_A 1luk_A 1lum_A 1lun_A 2k79_B 2k7a_B Back     alignment and structure
>1mil_A SHC adaptor protein; SH2 domain, phosphorylation, collagen, growth regulation, transforming protein, alternative initiation; 2.70A {Homo sapiens} SCOP: d.93.1.1 PDB: 1tce_A* Back     alignment and structure
>2gsb_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ekx_A Cytoplasmic tyrosine-protein kinase BMX; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} Back     alignment and structure
>2iug_A Phosphatidylinositol 3-kinase regulatory alpha subunit; transferase, polymorphism, UBL conjugation, phosphorylation, SH2, PI3K, SH2 domain; 1.89A {Homo sapiens} PDB: 2iuh_A* 2iui_A* 1fu5_A* 1fu6_A 1oo3_A 1oo4_A* 2pna_A 2pnb_A Back     alignment and structure
>2kno_A Tensin-like C1 domain-containing phosphatase; SH2 domain, TENC1, solution structure, cell junctio membrane, hydrolase, membrane, metal-binding; NMR {Homo sapiens} PDB: 2l6k_A Back     alignment and structure
>2lnw_A VAV-2, guanine nucleotide exchange factor VAV2; signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2lnx_A Back     alignment and structure
>1ka6_A SH2 domain protein 1A; SH2 domain, protein-peptide complex, immune system; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1ka7_A Back     alignment and structure
>1h9o_A Phosphatidylinositol 3-kinase; transferase/receptor, complex (phosphotransferase/receptor), phosphotransferase, SH2 domain; HET: PTR; 1.79A {Homo sapiens} SCOP: d.93.1.1 PDB: 1pic_A* 1bfi_A 1bfj_A 1qad_A Back     alignment and structure
>2cs0_A Hematopoietic SH2 domain containing; ALX, FLJ14886, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.93.1.1 Back     alignment and structure
>2crh_A VAV proto-oncogene; oncoprotein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2ror_A* 2lct_A* Back     alignment and structure
>2cr4_A 3BP-2, SH3 domain-binding protein 2; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ge9_A Tyrosine-protein kinase BTK; SH2 domain, structure, transferase; NMR {Homo sapiens} Back     alignment and structure
>2cia_A Cytoplasmic protein NCK2; SH2-domain, SH3 domain, phosphorylation, binding specificity; HET: PTR MPD; 1.45A {Homo sapiens} PDB: 1z3k_A 2ci9_A* 2ci8_A* Back     alignment and structure
>2el8_A Signal-transducing adaptor protein 2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2eo6_A B-cell linker protein; SH2, cytoplasmic adapter protein, B-cell adapter containing SH2 domain protein; NMR {Mus musculus} Back     alignment and structure
>2dm0_A Tyrosine-protein kinase TXK; TEC family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3reb_B Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain binding, signaling, HCK SH3 domain, PR binding; 3.45A {Homo sapiens} Back     alignment and structure
>1wqu_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; SH2 domain, feline sarcoma oncogene, structural genomics; NMR {Homo sapiens} PDB: 2dcr_A Back     alignment and structure
>2hdv_A SH2-B PH domain containing signaling mediator 1 gamma isoform; adapter protein, signaling protein; 2.00A {Mus musculus} PDB: 2hdx_A* 1rpy_A 1rqq_C* Back     alignment and structure
>1r1p_A GRB2-related adaptor protein 2; SH2, GADS, phosphopeptide, peptide binding protein; HET: PTR; 1.80A {Mus musculus} SCOP: d.93.1.1 PDB: 1r1q_A* 1r1s_A* Back     alignment and structure
>3ov1_A Growth factor receptor-bound protein 2; GRB2 SH2 domain, phosphotyrosine binding, signaling protein, signaling protein-antagonist complex; HET: PTR; 1.60A {Homo sapiens} SCOP: d.93.1.1 PDB: 3imj_A* 3in7_A* 3imd_A* 3kfj_A* 3n8m_A* 3in8_A* 3s8l_A* 3s8n_A* 3s8o_A* 2huy_A* 2h5k_A* 2huw_A* 2h46_E* 3c7i_A* 3n84_A* 1fhs_A 1bm2_A* 1bmb_A* 3ove_A* 1fyr_A* ... Back     alignment and structure
>2c9w_A Suppressor of cytokine signaling 2; growth regulation, SH2 domain, signal transduction inhibitor nuclear protein; 1.9A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 Back     alignment and structure
>2vif_A Suppressor of cytokine signalling 6; growth regulation, signal transduction inhibitor, KIT regula phosphotyrosine, signaling protein; HET: PTR; 1.45A {Homo sapiens} Back     alignment and structure
>2bbu_A Suppressor of cytokine signaling 3; SH2 domain, extended SH2 subdomain, PEST motif, protein complex, cytokine regulator; HET: PTR; NMR {Mus musculus} Back     alignment and structure
>1jyr_A Growth factor receptor-bound protein 2; receptor binding, regulatory, inhibitor, signaling protein-I complex; HET: PTR; 1.55A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jyq_A* 1jyu_A 1qg1_E* 1x0n_A* 2aob_A* 2aoa_A* 3n7y_A* 1tze_E* 1zfp_E* 3mxc_A* 3mxy_A* 1cj1_A* Back     alignment and structure
>2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Back     alignment and structure
>2lj0_A Sorbin and SH3 domain-containing protein 1; R85FL, ponsin, CAP, signaling protein; NMR {Homo sapiens} PDB: 2lj1_A Back     alignment and structure
>2izv_A Suppressor of cytokine signaling 4; signal transduction inhibitor, growth regulation, signal transduction, SH2 domain, nuclear protein; 2.55A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Back     alignment and structure
>2y3a_B Phosphatidylinositol 3-kinase regulatory subunit; transferase, phosphoinositide 3-kinase, RTK; HET: GD9; 3.30A {Mus musculus} Back     alignment and structure
>4ag1_C Fynomer; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Synthetic construct} PDB: 4afz_C 4ag2_C* 4afq_C* 4afs_C 4afu_C 1azg_B 1nyf_A 1nyg_A 1a0n_B 3ua7_A 3ua6_A 1fyn_A 1m27_C* 1shf_A 1zbj_A 1efn_A 1avz_C 1nlo_C* 1nlp_C* 1qwe_A ... Back     alignment and structure
>2hmh_A Suppressor of cytokine signaling 3; SOCS3, GP130, PTyr, peptide complex, cytokine regulator; HET: PTR; 2.00A {Mus musculus} Back     alignment and structure
>3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Back     alignment and structure
>1jo8_A ABP1P, actin binding protein; SH3 domain actin-binding-protein, structural protein; 1.30A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 2k3b_A 2rpn_A Back     alignment and structure
>2j05_A RAS GTPase-activating protein 1; GTPase activation, SH3 domain, SH2 domain, SRC homology 3, RAS signaling pathway, proto- oncogene, phosphorylation; 1.5A {Homo sapiens} PDB: 2j06_A Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Back     alignment and structure
>1gbq_A GRB2; complex (signal transduction/peptide), SH3 domain; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 1gbr_A 2gbq_A 3gbq_A 4gbq_A Back     alignment and structure
>1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A Back     alignment and structure
>2lcs_A NAP1-binding protein 2; adaptor, transferase, signaling protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1gcq_C VAV proto-oncogene; SH3 domain, protein-protein complex, GRB2,VAV, signaling protein/signaling protein complex; 1.68A {Mus musculus} SCOP: b.34.2.1 PDB: 1gcp_A Back     alignment and structure
>2lx7_A GAS-7, growth arrest-specific protein 7; structural genomics, northeast structural genomics consortiu target HR8574A, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>1ruw_A Myosin-3 isoform, MYO3; SH3 domain, yeast, high-throughput, structural genomics, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2btt_A 1va7_A Back     alignment and structure
>3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A Back     alignment and structure
>2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* Back     alignment and structure
>2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1k1z_A VAV; SH3, proto-oncogene, signaling protein; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>1yn8_A NBP2, NAP1-binding protein 2; SH3 domain, unknown function; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} SCOP: b.34.2.1 PDB: 3h0i_A 3h0f_A* Back     alignment and structure
>2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>1neg_A Spectrin alpha chain, brain; SH3-domain fold, five antiparallel beta sheets, structural protein; 2.30A {Gallus gallus} SCOP: b.34.2.1 Back     alignment and structure
>2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} Back     alignment and structure
>4f14_A Nebulette; SH3 domain, heart muscle, actin-binding protein-peptide COMP; 1.20A {Homo sapiens} PDB: 1ark_A 1neb_A 3i35_A Back     alignment and structure
>1uti_A GRB2-related adaptor protein 2; signaling protein regulator, SH3 domain/complex, adaptor protein (MONA); 1.5A {Mus musculus} SCOP: b.34.2.1 PDB: 1h3h_A 1oeb_A 2w10_A 2d0n_A Back     alignment and structure
>2iim_A Proto-oncogene tyrosine-protein kinase LCK; beta-barrels, signaling protein; HET: PG4; 1.00A {Homo sapiens} SCOP: b.34.2.1 PDB: 1h92_A 1kik_A Back     alignment and structure
>2vwf_A Growth factor receptor-bound protein 2; polymorphism, phosphoprotein, golgi apparatus, alternative splicing, HOST-virus interaction, SH3C, signaling; 1.58A {Homo sapiens} PDB: 2w0z_A 1gcq_A 1gfc_A 1gfd_A 1io6_A 2vvk_A Back     alignment and structure
>2o9s_A Ponsin; SH3 domain, signaling protein; 0.83A {Homo sapiens} PDB: 2o31_A 2o9v_A 2o2w_A Back     alignment and structure
>2gqi_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1tuc_A Alpha-spectrin; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton; 2.02A {Gallus gallus} SCOP: b.34.2.1 Back     alignment and structure
>2jt4_A Cytoskeleton assembly control protein SLA1; endocytosis, SH3, actin-binding, cytoplasm, cytoskeleton, phosphorylation, SH3 domain, DNA damage, DNA repair, nucleus; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2fei_A CD2-associated protein; CMS SH3 domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>1tg0_A BBC1 protein, myosin tail region-interacting protein MTI1; yeast, SH3 domain, structural genomics, contractIle protein; 0.97A {Saccharomyces cerevisiae} PDB: 1zuk_A 1wdx_A Back     alignment and structure
>1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A Back     alignment and structure
>2bz8_A SH3-domain kinase binding protein 1; SH3 domain, CIN85 adaptor protein, CBL ubiquitin ligase; 2.0A {Homo sapiens} Back     alignment and structure
>2kxc_A Brain-specific angiogenesis inhibitor 1-associate 2-like protein 1; IRTKS-SH3, espfu, complex structure, protein binding; NMR {Homo sapiens} Back     alignment and structure
>1zx6_A YPR154WP; SH3 domain, protein binding; 1.60A {Saccharomyces cerevisiae} PDB: 1ynz_A Back     alignment and structure
>2ew3_A SH3-containing GRB2-like protein 3; SH3GL3, solution structure, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1sem_A SEM-5; SRC-homology 3 (SH3) domain, peptide-binding protein; 2.00A {Caenorhabditis elegans} SCOP: b.34.2.1 PDB: 2sem_A 3sem_A 1k76_A 1kfz_A Back     alignment and structure
>1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>1zlm_A Osteoclast stimulating factor 1; beta barrel, signaling protein; 1.07A {Homo sapiens} Back     alignment and structure
>2ydl_A SH3 domain-containing kinase-binding protein 1; signaling protein; 2.05A {Homo sapiens} PDB: 2k6d_A Back     alignment and structure
>2oaw_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.90A {Gallus gallus} PDB: 2rot_A 2rmo_A 2kr3_A Back     alignment and structure
>2cuc_A SH3 domain containing ring finger 2; structural genomics, ring finger 2 containing protein, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2g6f_X RHO guanine nucleotide exchange factor 7; SH3 domain, peptide interaction, signaling protein; HET: NCO; 0.92A {Rattus norvegicus} PDB: 2df6_A* 2p4r_A 2esw_A Back     alignment and structure
>1k4u_S Phagocyte NADPH oxidase subunit P67PHOX; SH3-peptide complex, helix-turn-helix, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1spk_A RSGI RUH-010, riken cDNA 1300006M19; structural genomics, SH3 domain, five-stranded barrel, mouse cDNA; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2ak5_A RHO guanine nucleotide exchange factor 7; adaptor proteins, CIN85, PIX/COOL, protein-protein interaction, X-RAY, endocytosis; 1.85A {Rattus norvegicus} PDB: 1zsg_A Back     alignment and structure
>2nwm_A Vinexin; cell adhesion; NMR {Homo sapiens} Back     alignment and structure
>2drm_A Acanthamoeba myosin IB; SH3 domain, contractIle protein; 1.35A {Acanthamoeba} PDB: 2drk_A Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Back     alignment and structure
>2xmf_A Myosin 1E SH3; motor protein, SH3 domain; HET: DIA; 1.50A {Mus musculus} Back     alignment and structure
>2ct3_A Vinexin; SH3 domian, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1zuu_A BZZ1 protein; SH3 domain, unknown function; 0.97A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>2e5k_A Suppressor of T-cell receptor signaling 1; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2cud_A SRC-like-adapter; SH3 domain, negative mitogenesis regulator, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kxd_A 11-MER peptide, SH3 domain of spectrin alpha CHAI; alpha spectrin SH3 domain, SPC-S19P20S circular permutant, S protein; NMR {Synthetic} Back     alignment and structure
>1csk_A C-SRC SH3 domain; phosphotransferase; 2.50A {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1oot_A Hypothetical 40.4 kDa protein in PES4-His2 intergenic region; SH3 domain, sturctural genomics, structural genomics; 1.39A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1ssh_A 2a08_A Back     alignment and structure
>2j6f_A CD2-associated protein; metal-binding, immune response, SH3, SH2 domain, SH3 zinc-finger, SH3- binding, UBL conjugation pathway; 1.7A {Homo sapiens} PDB: 2j6k_A 2j6o_A 2j7i_A 2krm_A Back     alignment and structure
>2ed1_A 130 kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; GTPase activation, membrane, metal-binding, SH3 domain; NMR {Homo sapiens} PDB: 2rqt_A 2rqu_A Back     alignment and structure
>1x6g_A Megakaryocyte-associated tyrosine-protein kinase; MATK, CTK, HYL, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1w70_A Neutrophil cytosol factor 4; NADPH oxidase, P40PHOX, P47PHOX, SH3 domain, polyproline; 1.46A {Homo sapiens} PDB: 1w6x_A Back     alignment and structure
>2dnu_A RUH-061, SH3 multiple domains 1; RSGI, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2a28_A BZZ1 protein; SH3 domain, signaling protein; 1.07A {Saccharomyces cerevisiae} Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>2ecz_A Sorbin and SH3 domain-containing protein 1; glycoprotein, membrane, nuclear protein, phosphorylation, polymorphism, transport, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2b86_A Cytoplasmic protein NCK2; NCK SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2js2_A Back     alignment and structure
>2dl4_A Protein STAC; SH3 domain, STAC protein, SRC homology 3, cysteine-rich domain protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1u5s_A Cytoplasmic protein NCK2; protein-protein complex, beta barrel, beta sheet, zinc finger, metal binding protein; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2fry_A Back     alignment and structure
>1aww_A ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linked agammaglobulinemia, XLA, BTK, SH3 domain, transferase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 1awx_A 1qly_A Back     alignment and structure
>3rnj_A Brain-specific angiogenesis inhibitor 1-associate 2; structural genomics, structural genomics consortium, SGC, BE barrel; HET: EDT; 1.50A {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2d8j_A FYN-related kinase; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2egc_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ngp_A Spectrin alpha chain, brain; beta barrel, structural protein; 1.08A {Gallus gallus} PDB: 1e7o_A 1e6g_A 1e6h_A 1uue_A 1h8k_A 2lj3_A 1aey_A 1m8m_A 1shg_A 1u06_A 2nuz_A 2cdt_A 1hd3_A 2f2v_A 2f2w_A 2jm8_A 2jm9_A 2jma_A 3m0r_A 3m0p_A ... Back     alignment and structure
>2yup_A Vinexin; sorbin and SH3 domain-containing protein 3, SH3-containing adapter molecule 1, SCAM-1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ulr_B SRC substrate cortactin; SH3, protein-protein interaction, hydrolase, protein binding; 1.65A {Mus musculus} SCOP: b.34.2.0 PDB: 2d1x_A Back     alignment and structure
>1uhc_A KIAA1010 protein; beta barrel, SH3, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1x2k_A OSTF1, osteoclast stimulating factor 1; SH3 domain, human osteoclast stimulating factor 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djq_A SH3 domain containing ring finger 2; MUS musculus 0 DAY neonate head cDNA, riken FULL-length enriched library, clone:4831401O22, structural genomics; NMR {Mus musculus} Back     alignment and structure
>2gnc_A SLIT-ROBO RHO GTPase-activating protein 1; beta barrel, signaling protein; 1.80A {Mus musculus} Back     alignment and structure
>1ue9_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1i07_A Epidermal growth factor receptor kinase substrate EPS8; hormone/growth factor; 1.80A {Mus musculus} SCOP: b.34.2.1 PDB: 1aoj_A 1i0c_A Back     alignment and structure
>1uj0_A Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2; STAM, SH3, GRB2, GADS, PXXP, HRS, endocytosis, early endosome, signaling protein/signaling protein complex; 1.70A {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2jte_A CD2-associated protein; SH3 domain, coiled coil, cytoplasm, phosphorylation, SH3-binding, signaling protein; NMR {Mus musculus} PDB: 2kro_A Back     alignment and structure
>4esr_A Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domain, dynamin-2, protei binding, chronic myeloid leukemia; 1.53A {Homo sapiens} Back     alignment and structure
>2epd_A RHO GTPase-activating protein 4; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ke9_A Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosphoprotein, protein binding; NMR {Homo sapiens} Back     alignment and structure
>2kgt_A Tyrosine-protein kinase 6; SH3 domain, SRC kinase, PTK6, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1nm7_A Peroxisomal membrane protein PAS20; yeast, PEX5P, PEX14P, PEX13P, import machine, SH3 domain, protein transport; NMR {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>2vkn_A Protein SSU81; membrane, SH3 domain, transmembrane, membrane; 2.05A {Saccharomyces cerevisiae} Back     alignment and structure
>2eyx_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH3, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1x2p_A Protein arginine N-methyltransferase 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dl3_A Sorbin and SH3 domain-containing protein 1; ponsin, C-CBL-associated protein, CAP, SH3 domain protein 5 SH3P12, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dlm_A Back     alignment and structure
>4e6r_A Cytoplasmic protein NCK2; SH3 domain, protein binding, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MLY; 2.20A {Homo sapiens} PDB: 2frw_A 2js0_A Back     alignment and structure
>1wyx_A CRK-associated substrate; beta sheets, cell adhesion; 1.14A {Homo sapiens} Back     alignment and structure
>2dil_A Proline-serine-threonine phosphatase-interacting protein 1; SH3 domain, PEST phosphatase-interacting protein 1, CD2- binding protein 1; NMR {Homo sapiens} Back     alignment and structure
>2dl8_A SLIT-ROBO RHO GTPase-activating protein 2; SH3 domain, formin-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ed0_A ABL interactor 2; coiled coil, cytoskeleton, nuclear protein, phosphorylation, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wxt_A Hypothetical protein FLJ21522; SH3 domain, EPS8-related protein 3, protein-protein interaction, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2bzy_A CRK-like protein, CRKL SH3C; SH3 domain, dimer, nuclear export; 2.5A {Homo sapiens} PDB: 2bzx_A Back     alignment and structure
>2enm_A Sorting nexin-9; SH3-like barrel, protein transport, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2jw4_A Cytoplasmic protein NCK1; SH3 domain, phosphorylation, SH2 domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1s1n_A Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo sapiens} Back     alignment and structure
>3c0c_A Endophilin-A2; endocytosis, SH3, voltage-gated calcium channel, endosome, L binding, membrane, phosphoprotein, proto-oncogene, SH3 DOMA; 1.70A {Rattus norvegicus} Back     alignment and structure
>2yuo_A CIP85, RUN and TBC1 domain containing 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2x3w_D Syndapin I, protein kinase C and casein kinase substrate in N protein 1; endocytosis, N-WAsp, dynamin, pacsin I, transferase; 2.64A {Mus musculus} PDB: 2x3x_D Back     alignment and structure
>1x6b_A RHO guanine exchange factor (GEF) 16; SH3 domain, neuroblastoma, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ekh_A SH3 and PX domain-containing protein 2A; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3thk_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.70A {Rattus norvegicus} SCOP: b.34.2.1 Back     alignment and structure
>2dl7_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2k2m_A EPS8-like protein 1; alternative splicing, coiled coil, cytoplasm, SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2rol_A Back     alignment and structure
>2da9_A SH3-domain kinase binding protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>3eg3_A Proto-oncogene tyrosine-protein kinase ABL1; beta, ATP-binding, cell adhesion, cytoskeleton, LIPO magnesium, manganese, metal-binding, myristate; 1.40A {Homo sapiens} PDB: 3egu_A 3eg0_A 3eg2_A 3eg1_A 1abo_A 1abq_A 1ju5_C* 2o88_A 1bbz_A 1awo_A Back     alignment and structure
>2cre_A HEF-like protein; SH3 domain, SRC homology 3 domain, beta barrel, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2oi3_A Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type tyrosine kinase, transferase; NMR {Homo sapiens} PDB: 2oj2_A 4hck_A 5hck_A Back     alignment and structure
>2k9g_A SH3 domain-containing kinase-binding protein 1; CIN85, adaptor protein, downregulation, CBL, apoptosis, junction, cytoplasmic vesicle, cytoskeleton; NMR {Homo sapiens} Back     alignment and structure
>1y0m_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; SH3 domain, hydrolase; 1.20A {Rattus norvegicus} PDB: 1ywp_A 1ywo_A Back     alignment and structure
>2ege_A Uncharacterized protein KIAA1666; SH3 domain, KIAA1666 protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dbm_A SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH3 domain protein 2A, endophilin 1, EEN-B1, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2knb_B 3iql_A Back     alignment and structure
>2i0n_A Class VII unconventional myosin; beta-sheet loop, structural protein; NMR {Dictyostelium discoideum} Back     alignment and structure
>1wxb_A Epidermal growth factor receptor pathway substrate 8-like protein; SH3, EPS8, EPS8L2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysq_A RHO guanine nucleotide exchange factor 9; SH3 domain, CDC42 guanine nucleotide exchange factor (GEF) 9, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ebp_A SAM and SH3 domain-containing protein 1; proline-glutamate repeat-containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2kea_A Back     alignment and structure
>1wie_A RIM binding protein 2; beta barrel, KIAA0318 protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>4glm_A Dynamin-binding protein; SH3 domain, DNMBP, structural genomics, structural genomics consortium, SGC, SRC homology 3 domains, cell junctions; 1.90A {Homo sapiens} Back     alignment and structure
>2rf0_A Mitogen-activated protein kinase kinase kinase 10; MAP3K10, MLK2, SH3 domain, TKL kinase, MKN28, structural GEN structural genomics consortium, SGC; 2.00A {Homo sapiens} Back     alignment and structure
>2ct4_A CDC42-interacting protein 4; thyroid receptor interacting protein 10, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3u23_A CD2-associated protein; structural genomics, structural genomics consortium, SGC, BE barrel, adaptor protein, protein binding; 1.11A {Homo sapiens} PDB: 2krn_A Back     alignment and structure
>1u3o_A Huntingtin-associated protein-interacting protein; SH3, CIS-proline,, signaling protein; NMR {Rattus norvegicus} Back     alignment and structure
>2yun_A Nostrin; nitric oxide synthase trafficker, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A Back     alignment and structure
>2eqi_A Phospholipase C, gamma 2; SH3 domain, PLCG2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1wx6_A Cytoplasmic protein NCK2; SH3 domain, structural genomics, signal transduction, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Back     alignment and structure
>2d8h_A SH3YL1 protein; SH3 domain, hypothetical protein SH3YL1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jmc_A Spectrin alpha chain, brain and P41 peptide chimera; SPC-SH3, signaling protein; NMR {Gallus gallus} Back     alignment and structure
>2csi_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dl5_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wi7_A SH3-domain kinase binding protein 1; beta barrel, SH3KBP1, RUK, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Back     alignment and structure
>2ega_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dmo_A Neutrophil cytosol factor 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jxb_A T-cell surface glycoprotein CD3 epsilon chain, cytoplasmic protein NCK2; T-cell receptor, SH3 domain, immunology, SH2 domain; NMR {Homo sapiens} Back     alignment and structure
>2cub_A Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor, tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ugv_A KIAA0621, olygophrenin-1 like protein; beta barrel, GRAF protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1x69_A Cortactin isoform A; SH3 domain, CTTN, oncogene EMS1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1z9q_A Neutrophil cytosol factor 4; oxidoreductase activator; NMR {Homo sapiens} Back     alignment and structure
>1ujy_A RHO guanine nucleotide exchange factor 6; structural genomics, SH3 domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2rqv_A BUD emergence protein 1; BEM1P, SH3, CDC42P, cytoplasm, cytoskeleton, SH3 domain, SIG protein; NMR {Saccharomyces cerevisiae} PDB: 2rqw_A Back     alignment and structure
>1i1j_A Melanoma derived growth regulatory protein; SH3 subdomain, hormone/growth factor complex; 1.39A {Homo sapiens} SCOP: b.34.2.1 PDB: 1k0x_A 1hjd_A Back     alignment and structure
>2v1r_A Peroxisomal membrane protein PAS20; protein transport, translocation, transmembrane, peptide COM structural genomics, peroxisome; 2.1A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>1x43_A Endophilin B1, SH3 domain GRB2-like protein B1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2kym_A BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE20P PRR, CDC42P-interacting, S signaling protein; NMR {Lodderomyces elongisporus} Back     alignment and structure
>2dm1_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uff_A Intersectin 2; beta barrel, SH3 domain, endocytosis, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2dbk_A CRK-like protein; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2l0a_A STAM-1, signal transducing adapter molecule 1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1uhf_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1x2q_A Signal transducing adapter molecule 2; SH3 domain, signal transducing adaptor molecule, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1j3t_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>2dlp_A KIAA1783 protein; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2o2o_A SH3-domain kinase-binding protein 1; CIN85, protein binding; NMR {Homo sapiens} Back     alignment and structure
>1udl_A Intersectin 2, KIAA1256; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1jqq_A PEX13P, peroxisomal membrane protein PAS20, PAS20P, roxin-13; compact beta-barrel of five anti-parrallel beta-strands; 2.65A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1n5z_A Back     alignment and structure
>3i5r_A Phosphatidylinositol 3-kinase regulatory subunit alpha; SH3 domain, peptide complex, alternative splicing, disease mutation, HOST-virus interaction, phosphoprotein, polymorphism; 1.70A {Homo sapiens} SCOP: b.34.2.1 PDB: 3i5s_A 1pht_A 1pnj_A 2pni_A 1pks_A 1pkt_A Back     alignment and structure
>2csq_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Back     alignment and structure
>2m0y_A Dedicator of cytokinesis protein 1; apoptosis; NMR {Mus musculus} Back     alignment and structure
>3o5z_A Phosphatidylinositol 3-kinase regulatory subunit; SRC homology 3 domain, protein binding; 2.01A {Homo sapiens} SCOP: b.34.2.0 PDB: 2kt1_A Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>1bb9_A Amphiphysin 2; transferase, SH3 domain; 2.20A {Rattus norvegicus} SCOP: b.34.2.1 PDB: 1muz_A 1mv0_B Back     alignment and structure
>1hsq_A Phospholipase C-gamma (SH3 domain); phosphoric diester hydrolase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2hsp_A Back     alignment and structure
>2rqr_A CED-12 homolog, engulfment and cell motility protein 1, linker, D of cytokinesis protein 2; KIAA0209, KIAA0281, apoptosis, membrane, phagocytosis; NMR {Homo sapiens} Back     alignment and structure
>1ri9_A FYN-binding protein; SH3-like, helically extended, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2kbt_A Chimera of proto-oncogene VAV, linker, immunoglobulin G-binding protein G; sortase, protein ligation, intein, inset, solubility enhancement; NMR {Mus musculus} Back     alignment and structure
>2de0_X Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltransferase, N-glycan, COR SH3 domain; 2.61A {Homo sapiens} Back     alignment and structure
>3cxl_A N-chimerin; SH2, RHO-GAP, structural genomics consortium, SGC, gtpas activation, metal-binding, phorbol-ester binding, SH2 domai finger; 2.60A {Homo sapiens} PDB: 1xa6_A Back     alignment and structure
>3bxj_A RAS GTPase-activating protein syngap; GTPase activation, membrane, phosphoprotein, SH3-binding, signaling protein; 3.00A {Rattus norvegicus} Back     alignment and structure
>1wxu_A Peroxisomal biogenesis factor 13; SH3 domain, PEX13, protein-protein interaction, structural genomics; NMR {Mus musculus} Back     alignment and structure
>2gtj_A FYN-binding protein; SH3, redox, signaling protein; NMR {Homo sapiens} PDB: 2gto_A Back     alignment and structure
>3jv3_A Intersectin-1; SH3 domain, DH domain, guanine nucleotide exchange factor, autoinhibition, domain-swapped, cell junction, cell project endocytosis; 2.40A {Mus musculus} PDB: 3gf9_A Back     alignment and structure
>1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Back     alignment and structure
>1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A Back     alignment and structure
>1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Back     alignment and structure
>1wer_A P120GAP; GTPase activation, RAS, signal transduction, growth regulation, cancer; 1.60A {Homo sapiens} SCOP: a.116.1.2 PDB: 1wq1_G* Back     alignment and structure
>2xp1_A SPT6; transcription, IWS1, histone chaperone, mRNA export; 2.20A {Antonospora locustae} Back     alignment and structure
>3psi_A Transcription elongation factor SPT6; nucleus; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1uur_A Stata protein, STAT protein; transcription activator, SH2, signal transduction, transducer, transcription factor; HET: PTR; 2.7A {Dictyostelium discoideum} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 1uus_A* Back     alignment and structure
>3a98_A DOCK2, dedicator of cytokinesis protein 2; protein-protein complex, DOCK2, ELMO1, SH3 domain, PH domain bundle, proline-rich sequence, cytoskeleton; 2.10A {Homo sapiens} Back     alignment and structure
>2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Back     alignment and structure
>2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} Back     alignment and structure
>1ug1_A KIAA1010 protein; structural genomics, SH3 domain, hypothetical protein BAA76854.1, riken structural genomics/proteomics initiative RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>4dey_A Voltage-dependent L-type calcium channel subunit; maguk, voltage dependent calcium channel, transport protein; 1.95A {Oryctolagus cuniculus} PDB: 4dex_A 1t3l_A 1t3s_A 1vyv_A 1vyu_A 1vyt_A 1t0h_B 1t0j_B 1t0h_A 1t0j_A Back     alignment and structure
>3pvl_A Myosin VIIA isoform 1; protein complex, novel folding, protein cargo binding, cargo proteins, motor protein-protein transport complex; 2.80A {Mus musculus} Back     alignment and structure
>3kfv_A Tight junction protein ZO-3; structural genomics consortium, SGC, cell junction, cell membrane, membrane, SH3 domain; 2.80A {Homo sapiens} Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>1g2b_A Spectrin alpha chain; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton, metal binding protein; 1.12A {Gallus gallus} SCOP: b.34.2.1 PDB: 1tud_A Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens} Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>1y1u_A Signal transducer and activator of transcription; STAT, DNA-binding, SH2 domain, transcription REGU signaling protein; 3.21A {Mus musculus} Back     alignment and structure
>3tvt_A Disks large 1 tumor suppressor protein; DLG, SRC-homology-3, guanylate kinase, phosphorylation-depen cell membrane; 1.60A {Drosophila melanogaster} PDB: 3uat_A* Back     alignment and structure
>1yvl_A Signal transducer and activator of transcription 1-alpha/beta; signaling protein; HET: PTR; 3.00A {Homo sapiens} Back     alignment and structure
>1bg1_A Protein (transcription factor STAT3B); protein-DNA complex, cytokine activation, complex (transcription factor/DNA), transcription/DNA complex; HET: DNA PTR; 2.25A {Mus musculus} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 3cwg_A Back     alignment and structure
>1bf5_A Signal transducer and activator of transcription 1-alpha/beta; complex (SH2 domain/DNA), SH2 domain, transcription factor; HET: DNA PTR; 2.90A {Homo sapiens} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 Back     alignment and structure
>3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens} Back     alignment and structure
>3bux_B E3 ubiquitin-protein ligase CBL; TKB, signal transduction, proto-oncogene, complex, ATP-binding, glycoprotein, kinase, membrane, nucleotide-binding; HET: PTR; 1.35A {Homo sapiens} SCOP: a.39.1.7 a.48.1.1 d.93.1.1 PDB: 1yvh_A* 3bun_B* 3buo_B* 3bum_B* 3buw_B* 3ob1_B* 3ob2_B* 3plf_B* 2cbl_A* 1b47_A 3pfv_A* Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3op0_A Signal transduction protein CBL-C; structural genomics, structural genomics consortium, SGC, SI transduction protein, SH3-binding protein; HET: PTR; 2.52A {Homo sapiens} Back     alignment and structure
>1nf1_A NF1-333, protein (neurofibromin); type I neurofibromatosis, RAS, GAP, signal transduction, cancer, growth regulation, GTP hydrolysis; 2.50A {Homo sapiens} SCOP: a.116.1.2 Back     alignment and structure
>2krs_A Probable enterotoxin; all beta, SH3, ENTD, CPF_0587, CPE0606, structural genomics, PSI-2, protein structure initiative; NMR {Clostridium perfringens} Back     alignment and structure
>2kt8_A Probable surface protein; SH3 family, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; NMR {Clostridium perfringens} PDB: 2kyb_A Back     alignment and structure
>2kq8_A Cell WALL hydrolase; GFT protein structure, NESG, PSI, SH3 domain, structural genomics, protein structure initiative; NMR {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>1uur_A Stata protein, STAT protein; transcription activator, SH2, signal transduction, transducer, transcription factor; HET: PTR; 2.7A {Dictyostelium discoideum} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 1uus_A* Back     alignment and structure
>3psi_A Transcription elongation factor SPT6; nucleus; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 366
d1r1qa_97 d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA 2e-18
d1r1qa_97 d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA 1e-10
d2shpa2109 d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Huma 5e-18
d2shpa2109 d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Huma 8e-11
d1jwoa_97 d.93.1.1 (A:) Csk homologous kinase Chk {Human (Ho 6e-18
d1jwoa_97 d.93.1.1 (A:) Csk homologous kinase Chk {Human (Ho 2e-10
d2fcia1105 d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (B 3e-17
d2fcia1105 d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (B 7e-11
d1k9aa2101 d.93.1.1 (A:77-177) Carboxyl-terminal src kinase ( 1e-16
d1k9aa2101 d.93.1.1 (A:77-177) Carboxyl-terminal src kinase ( 1e-08
d2oq1a1130 d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 1e-16
d2oq1a1130 d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 3e-09
d1jyra_96 d.93.1.1 (A:) Growth factor receptor-bound protein 2e-16
d1jyra_96 d.93.1.1 (A:) Growth factor receptor-bound protein 3e-10
d2eyva1109 d.93.1.1 (A:12-120) Crk proto-oncogen {Human (Homo 5e-16
d2eyva1109 d.93.1.1 (A:12-120) Crk proto-oncogen {Human (Homo 1e-08
d2qmsa1113 d.93.1.1 (A:420-532) Growth factor receptor-bound 1e-15
d2qmsa1113 d.93.1.1 (A:420-532) Growth factor receptor-bound 5e-10
d1fu6a_111 d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-a 1e-15
d1fu6a_111 d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-a 7e-08
d1nrva_105 d.93.1.1 (A:) Growth factor receptor-bound protein 2e-15
d1nrva_105 d.93.1.1 (A:) Growth factor receptor-bound protein 8e-10
d1opka2101 d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (M 2e-15
d1opka2101 d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (M 9e-08
d1d4ta_104 d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sap 2e-15
d1d4ta_104 d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sap 6e-09
d1mila_104 d.93.1.1 (A:) Shc adaptor protein {Human (Homo sap 3e-15
d1mila_104 d.93.1.1 (A:) Shc adaptor protein {Human (Homo sap 6e-10
d1rjaa_100 d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tu 5e-15
d1rjaa_100 d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tu 9e-10
d2izva2112 d.93.1.1 (A:274-385) Suppressor of cytokine signal 2e-14
d2izva2112 d.93.1.1 (A:274-385) Suppressor of cytokine signal 4e-08
d2shpa3108 d.93.1.1 (A:111-218) Tyrosine phoshatase shp-2 {Hu 3e-14
d2shpa3108 d.93.1.1 (A:111-218) Tyrosine phoshatase shp-2 {Hu 2e-07
d1qada_107 d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-a 8e-14
d1qada_107 d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-a 8e-07
d1rpya_86 d.93.1.1 (A:) Adaptor protein Aps {Rat (Rattus nor 1e-13
d1rpya_86 d.93.1.1 (A:) Adaptor protein Aps {Rat (Rattus nor 3e-07
d1lkka_105 d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo 1e-13
d1lkka_105 d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo 6e-08
d1blja_114 d.93.1.1 (A:) P55 Blk protein tyrosine kinase {Mou 2e-13
d1blja_114 d.93.1.1 (A:) P55 Blk protein tyrosine kinase {Mou 5e-06
d1qcfa2103 d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {H 2e-13
d1qcfa2103 d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {H 1e-07
d1i3za_103 d.93.1.1 (A:) Ews/fli1 activated transcript 2, Eat 3e-13
d1i3za_103 d.93.1.1 (A:) Ews/fli1 activated transcript 2, Eat 3e-07
d2c9wa2103 d.93.1.1 (A:32-134) Suppressor of cytokine signali 4e-13
d2c9wa2103 d.93.1.1 (A:32-134) Suppressor of cytokine signali 1e-07
d2cs0a1106 d.93.1.1 (A:8-113) Hematopoietic SH2 domain contai 7e-13
d2cs0a1106 d.93.1.1 (A:8-113) Hematopoietic SH2 domain contai 6e-05
d1a81a1129 d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Hom 9e-13
d1a81a1129 d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Hom 5e-07
d1o48a_106 d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo s 3e-12
d1o48a_106 d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo s 3e-06
d1a81a2125 d.93.1.1 (A:138-262) Syk tyrosine kinase {Human (H 5e-12
d2oq1a2124 d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-7 5e-12
d2oq1a2124 d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-7 7e-06
d1luia_108 d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mou 1e-11
d1luia_108 d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mou 1e-04
d1g83a2104 d.93.1.1 (A:142-245) Tyrosine kinase Fyn {Human (H 1e-11
d1g83a2104 d.93.1.1 (A:142-245) Tyrosine kinase Fyn {Human (H 2e-05
d1xa6a2141 d.93.1.1 (A:21-161) Beta-chimaerin, N-terminal dom 4e-11
d1xa6a2141 d.93.1.1 (A:21-161) Beta-chimaerin, N-terminal dom 1e-06
d1uura3131 d.93.1.1 (A:577-707) STAT homologue {Dictyostelium 8e-11
d1uura3131 d.93.1.1 (A:577-707) STAT homologue {Dictyostelium 2e-04
d1wera_ 324 a.116.1.2 (A:) p120GAP domain {Human (Homo sapiens 4e-09
d1bg1a3141 d.93.1.1 (A:576-716) STAT3b {Mouse (Mus musculus) 6e-08
d1spka_72 b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RI 1e-07
d1awwa_67 b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Hom 2e-07
d1fmka164 b.34.2.1 (A:82-145) c-src protein tyrosine kinase 4e-07
d1efna_57 b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, 8e-07
d1jo8a_58 b.34.2.1 (A:) Actin binding protein ABP1 {Baker's 9e-07
d1arka_60 b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo 9e-07
d1qcfa165 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Hu 3e-06
d1ujya_76 b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens 3e-06
d1uffa_93 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 3e-06
d1wiea_96 b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human 5e-06
d1udla_98 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 6e-06
d1oota_58 b.34.2.1 (A:) Hypothetical protein YFR024c {Baker' 7e-06
d1k9aa171 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (cs 1e-05
d1u06a155 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chic 1e-05
d2hspa_71 b.34.2.1 (A:) Phospholipase C, SH3 domain {Human ( 2e-05
d1sema_58 b.34.2.1 (A:) Growth factor receptor-bound protein 2e-05
d1gcqa_56 b.34.2.1 (A:) Growth factor receptor-bound protein 2e-05
d2iima162 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 d 3e-05
d1ckaa_57 b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse 3e-05
d1ugva_72 b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA062 4e-05
d1k4us_62 b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId 7e-05
d1ue9a_80 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 7e-05
d1ng2a2118 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic 8e-05
d1gcqc_69 b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mu 8e-05
d1opka157 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domai 9e-05
d1gl5a_67 b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musc 9e-05
d1utia_57 b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona 1e-04
d1gria156 b.34.2.1 (A:1-56) Growth factor receptor-bound pro 1e-04
d1uhfa_69 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 1e-04
d1j3ta_74 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 2e-04
d1uhca_79 b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIA 3e-04
d1u5sa171 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [Tax 4e-04
d1uj0a_58 b.34.2.1 (A:) Signal transducing adaptor molecule 5e-04
d1ycsb263 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [ 0.001
d1i07a_59 b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus 0.002
d1zuua156 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyc 0.002
>d1r1qa_ d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA, GRID) {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: SH2-like
superfamily: SH2 domain
family: SH2 domain
domain: GRB2-related adaptor protein 2 (MONA, GRID)
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 77.2 bits (190), Expect = 2e-18
 Identities = 22/87 (25%), Positives = 46/87 (52%), Gaps = 1/87 (1%)

Query: 58  DWFHPECTKNDAVDMLVKAGPGSFLVRPSDNSPGDYSLFFHINNQIQRFRIEKKA-VRYL 116
           +WFH   +++ A ++L+    G F++R S +SPGD+S+     + +Q F++ +     Y 
Sbjct: 7   EWFHEGLSRHQAENLLMGKDIGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDTKGNYF 66

Query: 117 MGGRTFECLDAVINRYRKEQIVEGHTL 143
           +    F  L+ +++ YR   I +   +
Sbjct: 67  LWTEKFPSLNKLVDYYRTTSISKQKQV 93
>d1r1qa_ d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA, GRID) {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d2shpa2 d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d2shpa2 d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1jwoa_ d.93.1.1 (A:) Csk homologous kinase Chk {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1jwoa_ d.93.1.1 (A:) Csk homologous kinase Chk {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d2fcia1 d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 9913]} Length = 105 Back     information, alignment and structure
>d2fcia1 d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 9913]} Length = 105 Back     information, alignment and structure
>d1k9aa2 d.93.1.1 (A:77-177) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1k9aa2 d.93.1.1 (A:77-177) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2oq1a1 d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d2oq1a1 d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1jyra_ d.93.1.1 (A:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1jyra_ d.93.1.1 (A:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2eyva1 d.93.1.1 (A:12-120) Crk proto-oncogen {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d2eyva1 d.93.1.1 (A:12-120) Crk proto-oncogen {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d2qmsa1 d.93.1.1 (A:420-532) Growth factor receptor-bound protein 7 {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d2qmsa1 d.93.1.1 (A:420-532) Growth factor receptor-bound protein 7 {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d1fu6a_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 111 Back     information, alignment and structure
>d1fu6a_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 111 Back     information, alignment and structure
>d1nrva_ d.93.1.1 (A:) Growth factor receptor-bound protein 10, GRB10 {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1nrva_ d.93.1.1 (A:) Growth factor receptor-bound protein 10, GRB10 {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1opka2 d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 Back     information, alignment and structure
>d1opka2 d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 Back     information, alignment and structure
>d1d4ta_ d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1d4ta_ d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1mila_ d.93.1.1 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1mila_ d.93.1.1 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1rjaa_ d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tumor kinase, Brk) {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1rjaa_ d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tumor kinase, Brk) {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d2izva2 d.93.1.1 (A:274-385) Suppressor of cytokine signaling 4, SOCS-4 {Human (Homo sapiens) [TaxId: 9606]} Length = 112 Back     information, alignment and structure
>d2izva2 d.93.1.1 (A:274-385) Suppressor of cytokine signaling 4, SOCS-4 {Human (Homo sapiens) [TaxId: 9606]} Length = 112 Back     information, alignment and structure
>d2shpa3 d.93.1.1 (A:111-218) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d2shpa3 d.93.1.1 (A:111-218) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1qada_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Cow (Bos taurus) [TaxId: 9913]} Length = 107 Back     information, alignment and structure
>d1qada_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Cow (Bos taurus) [TaxId: 9913]} Length = 107 Back     information, alignment and structure
>d1rpya_ d.93.1.1 (A:) Adaptor protein Aps {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 Back     information, alignment and structure
>d1rpya_ d.93.1.1 (A:) Adaptor protein Aps {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 Back     information, alignment and structure
>d1lkka_ d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1lkka_ d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1blja_ d.93.1.1 (A:) P55 Blk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure
>d1blja_ d.93.1.1 (A:) P55 Blk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure
>d1qcfa2 d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1qcfa2 d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1i3za_ d.93.1.1 (A:) Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1i3za_ d.93.1.1 (A:) Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d2c9wa2 d.93.1.1 (A:32-134) Suppressor of cytokine signaling 2, SOCS-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2c9wa2 d.93.1.1 (A:32-134) Suppressor of cytokine signaling 2, SOCS-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2cs0a1 d.93.1.1 (A:8-113) Hematopoietic SH2 domain containing protein HSH2D {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d2cs0a1 d.93.1.1 (A:8-113) Hematopoietic SH2 domain containing protein HSH2D {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1a81a1 d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 129 Back     information, alignment and structure
>d1a81a1 d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 129 Back     information, alignment and structure
>d1o48a_ d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1o48a_ d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1a81a2 d.93.1.1 (A:138-262) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d2oq1a2 d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d2oq1a2 d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1luia_ d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 Back     information, alignment and structure
>d1luia_ d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 Back     information, alignment and structure
>d1g83a2 d.93.1.1 (A:142-245) Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1g83a2 d.93.1.1 (A:142-245) Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1xa6a2 d.93.1.1 (A:21-161) Beta-chimaerin, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 141 Back     information, alignment and structure
>d1xa6a2 d.93.1.1 (A:21-161) Beta-chimaerin, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 141 Back     information, alignment and structure
>d1uura3 d.93.1.1 (A:577-707) STAT homologue {Dictyostelium discoideum [TaxId: 44689]} Length = 131 Back     information, alignment and structure
>d1uura3 d.93.1.1 (A:577-707) STAT homologue {Dictyostelium discoideum [TaxId: 44689]} Length = 131 Back     information, alignment and structure
>d1wera_ a.116.1.2 (A:) p120GAP domain {Human (Homo sapiens) [TaxId: 9606]} Length = 324 Back     information, alignment and structure
>d1bg1a3 d.93.1.1 (A:576-716) STAT3b {Mouse (Mus musculus) [TaxId: 10090]} Length = 141 Back     information, alignment and structure
>d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 67 Back     information, alignment and structure
>d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 64 Back     information, alignment and structure
>d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 58 Back     information, alignment and structure
>d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1wiea_ b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 58 Back     information, alignment and structure
>d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 55 Back     information, alignment and structure
>d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} Length = 58 Back     information, alignment and structure
>d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 69 Back     information, alignment and structure
>d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 69 Back     information, alignment and structure
>d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query366
d2fcia1105 Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 99.94
d1jwoa_97 Csk homologous kinase Chk {Human (Homo sapiens) [T 99.93
d1rjaa_100 Tyrosine-protein kinase 6 (Breast tumor kinase, Br 99.93
d1k9aa2101 Carboxyl-terminal src kinase (csk) {Human (Homo sa 99.93
d1opka2101 Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: 99.92
d2oq1a1130 Tyrosine-protein kinase zap-70 {Human (Homo sapien 99.92
d1nrva_105 Growth factor receptor-bound protein 10, GRB10 {Hu 99.92
d1a81a1129 Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 99.92
d1lkka_105 p56-lck tyrosine kinase {Human (Homo sapiens) [Tax 99.92
d1d4ta_104 The Xlp protein Sap {Human (Homo sapiens) [TaxId: 99.92
d2oq1a2124 Tyrosine-protein kinase zap-70 {Human (Homo sapien 99.91
d2shpa2109 Tyrosine phoshatase shp-2 {Human (Homo sapiens) [T 99.91
d1blja_114 P55 Blk protein tyrosine kinase {Mouse (Mus muscul 99.91
d1qcfa2103 Hemopoetic cell kinase Hck {Human (Homo sapiens) [ 99.91
d1o48a_106 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 99.91
d1a81a2125 Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 99.91
d1g83a2104 Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: 99.9
d1i3za_103 Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus 99.9
d2qmsa1113 Growth factor receptor-bound protein 7 {Human (Hom 99.9
d1mila_104 Shc adaptor protein {Human (Homo sapiens) [TaxId: 99.9
d1luia_108 Itk/tsk protein tyrosine kinase {Mouse (Mus muscul 99.89
d1jyra_96 Growth factor receptor-bound protein 2 (GRB2) {Hum 99.89
d1r1qa_97 GRB2-related adaptor protein 2 (MONA, GRID) {Mouse 99.88
d2cs0a1106 Hematopoietic SH2 domain containing protein HSH2D 99.87
d2izva2112 Suppressor of cytokine signaling 4, SOCS-4 {Human 99.87
d2eyva1109 Crk proto-oncogen {Human (Homo sapiens) [TaxId: 96 99.86
d1qada_107 Phosphatidylinositol 3-kinase, p85-alpha subunit { 99.86
d1fu6a_111 Phosphatidylinositol 3-kinase, p85-alpha subunit { 99.85
d2shpa3108 Tyrosine phoshatase shp-2 {Human (Homo sapiens) [T 99.84
d1rpya_86 Adaptor protein Aps {Rat (Rattus norvegicus) [TaxI 99.83
d2c9wa2103 Suppressor of cytokine signaling 2, SOCS-2 {Human 99.83
d1xa6a2141 Beta-chimaerin, N-terminal domain {Human (Homo sap 99.77
d1jwoa_97 Csk homologous kinase Chk {Human (Homo sapiens) [T 99.57
d1k9aa2101 Carboxyl-terminal src kinase (csk) {Human (Homo sa 99.55
d1rjaa_100 Tyrosine-protein kinase 6 (Breast tumor kinase, Br 99.54
d2oq1a1130 Tyrosine-protein kinase zap-70 {Human (Homo sapien 99.53
d2fcia1105 Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 99.51
d1qcfa2103 Hemopoetic cell kinase Hck {Human (Homo sapiens) [ 99.49
d2oq1a2124 Tyrosine-protein kinase zap-70 {Human (Homo sapien 99.49
d1a81a1129 Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 99.49
d1lkka_105 p56-lck tyrosine kinase {Human (Homo sapiens) [Tax 99.47
d1opka2101 Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: 99.47
d1o48a_106 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 99.46
d1nrva_105 Growth factor receptor-bound protein 10, GRB10 {Hu 99.45
d1blja_114 P55 Blk protein tyrosine kinase {Mouse (Mus muscul 99.44
d1i3za_103 Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus 99.44
d1a81a2125 Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 99.43
d1g83a2104 Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: 99.43
d2qmsa1113 Growth factor receptor-bound protein 7 {Human (Hom 99.4
d2shpa2109 Tyrosine phoshatase shp-2 {Human (Homo sapiens) [T 99.38
d1luia_108 Itk/tsk protein tyrosine kinase {Mouse (Mus muscul 99.38
d1uura3131 STAT homologue {Dictyostelium discoideum [TaxId: 4 99.36
d1d4ta_104 The Xlp protein Sap {Human (Homo sapiens) [TaxId: 99.33
d1jyra_96 Growth factor receptor-bound protein 2 (GRB2) {Hum 99.33
d1r1qa_97 GRB2-related adaptor protein 2 (MONA, GRID) {Mouse 99.31
d2eyva1109 Crk proto-oncogen {Human (Homo sapiens) [TaxId: 96 99.31
d1bg1a3141 STAT3b {Mouse (Mus musculus) [TaxId: 10090]} 99.31
d1mila_104 Shc adaptor protein {Human (Homo sapiens) [TaxId: 99.3
d1qada_107 Phosphatidylinositol 3-kinase, p85-alpha subunit { 99.24
d2cs0a1106 Hematopoietic SH2 domain containing protein HSH2D 99.22
d2shpa3108 Tyrosine phoshatase shp-2 {Human (Homo sapiens) [T 99.2
d2izva2112 Suppressor of cytokine signaling 4, SOCS-4 {Human 99.19
d1efna_57 Fyn proto-oncogene tyrosine kinase, SH3 domain {Hu 99.18
d1fmka164 c-src protein tyrosine kinase {Human (Homo sapiens 99.1
d1jo8a_58 Actin binding protein ABP1 {Baker's yeast (Sacchar 99.1
d1arka_60 SH3 domain from nebulin {Human (Homo sapiens) [Tax 99.09
d2rn8a153 Bruton's tyrosine kinase {Mus musculus [TaxId: 100 99.07
d1fu6a_111 Phosphatidylinositol 3-kinase, p85-alpha subunit { 99.06
d1gcqa_56 Growth factor receptor-bound protein 2 (GRB2), N- 99.03
d1gcqc_69 Vav N-terminal SH3 domain {Mouse (Mus musculus) [T 99.03
d1rpya_86 Adaptor protein Aps {Rat (Rattus norvegicus) [TaxI 99.02
d1ckaa_57 C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) 99.02
d2c9wa2103 Suppressor of cytokine signaling 2, SOCS-2 {Human 99.02
d1qcfa165 Hemapoetic cell kinase Hck {Human (Homo sapiens) [ 99.02
d1wlpb153 p47pox (neutrophil cytosolic factor 1) {Human (Hom 99.01
d1u06a155 alpha-Spectrin, SH3 domain {Chicken (Gallus gallus 99.01
d2iima162 p56-lck tyrosine kinase, SH3 domain {Human (Homo s 99.0
d1k4us_62 p67phox {Human (Homo sapiens) [TaxId: 9606]} 99.0
d1ng2a158 p47pox (neutrophil cytosolic factor 1) {Human (Hom 98.99
d1sema_58 Growth factor receptor-bound protein 2 (GRB2), N- 98.98
d1k9aa171 Carboxyl-terminal src kinase (csk) {Human (Homo sa 98.97
d1utia_57 Grb2-related adaptor protein 2 (Mona/Gads) {Mouse 98.96
d1gl5a_67 tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 98.95
d1spka_72 BAI1-associated protein 2-like 1 (RIKEN cDNA 13000 98.95
d1opka157 Abl tyrosine kinase, SH3 domain {Mouse (Mus muscul 98.94
d1awwa_67 Bruton's tyrosine kinase {Human (Homo sapiens) [Ta 98.94
d1uj0a_58 Signal transducing adaptor molecule Stam2 {Mouse ( 98.93
d1zuua156 BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 98.92
d1wiea_96 RIM binding protein 2, RIMBP2 {Human (Homo sapiens 98.92
d1wfwa_74 Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} 98.91
d1kjwa196 Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} 98.9
d1gria156 Growth factor receptor-bound protein 2 (GRB2), N- 98.89
d1ue9a_80 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 98.88
d1i07a_59 EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 1009 98.84
d1xa6a2141 Beta-chimaerin, N-terminal domain {Human (Homo sap 98.81
d1uhfa_69 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 98.8
d1udla_98 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 98.8
d1uffa_93 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 98.78
d1ycsb263 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 98.77
d1oota_58 Hypothetical protein YFR024c {Baker's yeast (Sacch 98.76
d1j3ta_74 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 98.76
d2hspa_71 Phospholipase C, SH3 domain {Human (Homo sapiens) 98.76
d1u5sa171 Nck-2 {Human (Homo sapiens) [TaxId: 9606]} 98.75
d1ujya_76 Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606 98.74
d1ugva_72 Olygophrenin-1 like protein (KIAA0621) {Human (Hom 98.73
d1ng2a2118 p47pox (neutrophil cytosolic factor 1) {Human (Hom 98.72
d1ug1a_92 Hypothetical protein Baa76854.1 (KIAA1010) {Human 98.72
d2v1ra167 Peroxisomal membrane protein Pex13p {Baker's yeast 98.7
d1uhca_79 Hypothetical protein Baa76854.1 (KIAA1010) {Human 98.66
d1phta_83 Phosphatidylinositol 3-kinase (p85-alpha subunit, 98.61
d1t0ha_96 SH3-like domain of the L-type calcium channel {Rab 98.52
d1vyva1145 SH3-like domain of the L-type calcium channel {Rat 98.46
d1i1ja_106 Melanoma inhibitory activity protein {Human (Homo 98.46
d1bb9a_83 Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 101 98.44
d1vyua1136 SH3-like domain of the L-type calcium channel {Rat 98.15
d1wera_ 324 p120GAP domain {Human (Homo sapiens) [TaxId: 9606] 97.99
d1uura3131 STAT homologue {Dictyostelium discoideum [TaxId: 4 97.56
d1bg1a3141 STAT3b {Mouse (Mus musculus) [TaxId: 10090]} 97.21
d1bf5a3142 STAT-1 {Human (Homo sapiens) [TaxId: 9606]} 97.11
d1ri9a_77 Fyn-binding protein (T-cell adapter protein adap) 94.94
d1nf1a_ 324 GAP related domain of neurofibromin {Human (Homo s 85.48
>d2fcia1 d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: SH2-like
superfamily: SH2 domain
family: SH2 domain
domain: Phospholipase C-gamma-1
species: Cow (Bos taurus) [TaxId: 9913]

Probab=99.94  E-value=3e-27  Score=193.43  Aligned_cols=101  Identities=25%  Similarity=0.547  Sum_probs=94.6

Q ss_pred             CCCCCcccCcCCcccHHHHHHHHhcCC-CCcEEEecCCCCCCceEEEEeecCeeEEEEEEeCCeEEecCCcccCCHHHHH
Q psy13521         51 IDPNTVFDWFHPECTKNDAVDMLVKAG-PGSFLVRPSDNSPGDYSLFFHINNQIQRFRIEKKAVRYLMGGRTFECLDAVI  129 (366)
Q Consensus        51 ~~p~e~~~WyhG~IsR~eAE~lL~~~~-~GsFLVR~S~s~pg~y~LSv~~~~~V~H~rI~~~g~~y~~~~~~F~SL~eLV  129 (366)
                      +..|+.++||||.|+|++||++|.+.+ +|+||||+| +.+|.|+||++.+++|+||+|..+++.|.+++..|+||.+||
T Consensus         3 p~~he~~~Wy~g~i~R~eAe~lL~~~~~~G~FLVR~S-~~~~~yvLSv~~~~~v~H~~I~~~~~~~~~~~~~F~sl~~LV   81 (105)
T d2fcia1           3 PGIHESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKR-NEPNSYAISFRAEGKIKHCRVQQEGQTVMLGNSEFDSLVDLI   81 (105)
T ss_dssp             SCTTSSSCCCCSSSCSHHHHHHHHHSSSSCCEEEEEC-SSTTCEEEEEEETTEECCCEEBCCSSCEECSSSEESTTHHHH
T ss_pred             CcccccCCCccCCCCHHHHHHHHHhCCCCCeEEEEec-CCCCCEEEEEEeccccEEEEEEecCCeEecCCcccCCHHHHH
Confidence            456889999999999999999999887 899999999 578999999999999999999888888999999999999999


Q ss_pred             HHhhhcCCccceeecCCccCCCc
Q psy13521        130 NRYRKEQIVEGHTLGFPVTRMSR  152 (366)
Q Consensus       130 ~~Y~~~~l~l~~~L~~Pv~~~~~  152 (366)
                      +||+++++++.++|++||+++.|
T Consensus        82 ~~y~~~~~~~~~~L~~P~~~~~p  104 (105)
T d2fcia1          82 SYYEKHPLYRKMKLRYPINEENS  104 (105)
T ss_dssp             HHHHHSCCSTTCSSCCCCCCTTT
T ss_pred             HHHhhCCCCCccCCCCCCCCCCC
Confidence            99999999999999999998876
>d1jwoa_ d.93.1.1 (A:) Csk homologous kinase Chk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjaa_ d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tumor kinase, Brk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k9aa2 d.93.1.1 (A:77-177) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opka2 d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2oq1a1 d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nrva_ d.93.1.1 (A:) Growth factor receptor-bound protein 10, GRB10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a81a1 d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lkka_ d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d4ta_ d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2oq1a2 d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2shpa2 d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blja_ d.93.1.1 (A:) P55 Blk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qcfa2 d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o48a_ d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a81a2 d.93.1.1 (A:138-262) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g83a2 d.93.1.1 (A:142-245) Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i3za_ d.93.1.1 (A:) Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2qmsa1 d.93.1.1 (A:420-532) Growth factor receptor-bound protein 7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mila_ d.93.1.1 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1luia_ d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jyra_ d.93.1.1 (A:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r1qa_ d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA, GRID) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cs0a1 d.93.1.1 (A:8-113) Hematopoietic SH2 domain containing protein HSH2D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2izva2 d.93.1.1 (A:274-385) Suppressor of cytokine signaling 4, SOCS-4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eyva1 d.93.1.1 (A:12-120) Crk proto-oncogen {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qada_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fu6a_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2shpa3 d.93.1.1 (A:111-218) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rpya_ d.93.1.1 (A:) Adaptor protein Aps {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2c9wa2 d.93.1.1 (A:32-134) Suppressor of cytokine signaling 2, SOCS-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xa6a2 d.93.1.1 (A:21-161) Beta-chimaerin, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jwoa_ d.93.1.1 (A:) Csk homologous kinase Chk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k9aa2 d.93.1.1 (A:77-177) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjaa_ d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tumor kinase, Brk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2oq1a1 d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcia1 d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qcfa2 d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2oq1a2 d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a81a1 d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lkka_ d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opka2 d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o48a_ d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nrva_ d.93.1.1 (A:) Growth factor receptor-bound protein 10, GRB10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blja_ d.93.1.1 (A:) P55 Blk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i3za_ d.93.1.1 (A:) Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a81a2 d.93.1.1 (A:138-262) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g83a2 d.93.1.1 (A:142-245) Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qmsa1 d.93.1.1 (A:420-532) Growth factor receptor-bound protein 7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2shpa2 d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1luia_ d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uura3 d.93.1.1 (A:577-707) STAT homologue {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1d4ta_ d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jyra_ d.93.1.1 (A:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r1qa_ d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA, GRID) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2eyva1 d.93.1.1 (A:12-120) Crk proto-oncogen {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bg1a3 d.93.1.1 (A:576-716) STAT3b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mila_ d.93.1.1 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qada_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2cs0a1 d.93.1.1 (A:8-113) Hematopoietic SH2 domain containing protein HSH2D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2shpa3 d.93.1.1 (A:111-218) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2izva2 d.93.1.1 (A:274-385) Suppressor of cytokine signaling 4, SOCS-4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} Back     information, alignment and structure
>d1fu6a_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rpya_ d.93.1.1 (A:) Adaptor protein Aps {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c9wa2 d.93.1.1 (A:32-134) Suppressor of cytokine signaling 2, SOCS-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} Back     information, alignment and structure
>d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wiea_ b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xa6a2 d.93.1.1 (A:21-161) Beta-chimaerin, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug1a_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phta_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1vyva1 b.34.2.1 (A:71-215) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1i1ja_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vyua1 b.34.2.1 (A:39-174) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wera_ a.116.1.2 (A:) p120GAP domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uura3 d.93.1.1 (A:577-707) STAT homologue {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1bg1a3 d.93.1.1 (A:576-716) STAT3b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bf5a3 d.93.1.1 (A:569-710) STAT-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ri9a_ b.34.2.1 (A:) Fyn-binding protein (T-cell adapter protein adap) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nf1a_ a.116.1.2 (A:) GAP related domain of neurofibromin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure