Psyllid ID: psy13565

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180--
MKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGVIAGLTVMRIINEPTAAAIAYGLDKKEGEKNVLVFDLGGGTFDVSLLTIDNDHRRRKDHHGGGDRRQDQVAPFLFLQITDAEKTTMEEAIDDKIKWLDENQDADAPEFQKKKKELEDVVQPIIAKLYQGAGGAPPPPGGDAGKDEL
cHHHHHHHHccccccEEEEccccccHHHHHHHHHHcHHcccEEEEEccHHHHHHHHHHcccccccEEEEEEEcccccEEEEEEEEcccEEEEccccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccc
HHHHHHHHHcccccEEEEEEcccccHHHHHHHHHHHHHcccEEEEEEEHHHHHHHHccccccccccEEEEEEEEccEEEEEEEEEEccEEEEcccccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHcccccccc
MKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGVIAGLTVMRIINEPTAAAIAYGldkkegekNVLVFDlgggtfdvslltidndhrrrkdhhgggdrrqdqvapfLFLQITDAEKTTMEEAIDDKIKWldenqdadapefQKKKKELEDVVQPIIAKLyqgaggappppggdagkdel
mketaeaylgkkvthaVVTVPAYFNDAQRQATKDAGVIAGLTVMRIINEPTAAAIAYGLDKKEGEKNVLVFDLGGGTFDVSLLTIDNDhrrrkdhhgggdrrqdqvaPFLFLQITDAEKTTMEEAIDDKIKWLDENQDADAPEFQKKKKELEDVVQPIIAKLyqgaggappppggdagkdel
MKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGVIAGLTVMRIINEPTAAAIAYGLDKKEGEKNVLVFDLGGGTFDVSLLTIDNdhrrrkdhhgggdrrQDQVAPFLFLQITDAEKTTMEEAIDDKIKWLDENQDADAPEFQKKKKELEDVVQPIIAKLYQgaggappppggdagKDEL
******AYLGKKVTHAVVTVPAYFNDAQRQATKDAGVIAGLTVMRIINEPTAAAIAYGLDKKEGEKNVLVFDLGGGTFDVSLLTID*******************VAPFLFLQITDAEKTTMEEAIDDKIKWL********************VVQPIIAKLY*******************
**ETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGVIAGLTVMRIINEPTAAAIAYGLDKKEGEKNVLVFDLGGGTFDVSLLTIDNDHRRRKDHHGGGDRRQDQVAPFLFLQI******************************************PI************************
MKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGVIAGLTVMRIINEPTAAAIAYGLDKKEGEKNVLVFDLGGGTFDVSLLTIDNDHR************QDQVAPFLFLQITDAEKTTMEEAIDDKIKWLDENQDADAPEFQKKKKELEDVVQPIIAKLYQGAG***************
MKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGVIAGLTVMRIINEPTAAAIAYGLDKKEGEKNVLVFDLGGGTFDVSLLTIDNDHRRRKDHHGGGDRRQDQVAPFLFLQITDAEKTTMEEAIDDKIKWLDENQDADAPEFQKKKKELEDVVQPIIAKLYQGAGGAPPPPGG*******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGVIAGLTVMRIINEPTAAAIAYGLDKKEGEKNVLVFDLGGGTFDVSLLTIDNDHRRRKDHHGGGDRRQDQVAPFLFLQITDAEKTTMEEAIDDKIKWLDENQDADAPEFQKKKKELEDVVQPIIAKLYQGAGGAPPPPGGDAGKDEL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query182 2.2.26 [Sep-21-2011]
P29844 656 Heat shock 70 kDa protein yes N/A 0.467 0.129 0.988 5e-43
Q3S4T7 654 78 kDa glucose-regulated N/A N/A 0.456 0.126 0.954 2e-42
Q0VCX2 655 78 kDa glucose-regulated yes N/A 0.456 0.126 0.954 2e-42
P20029 655 78 kDa glucose-regulated yes N/A 0.456 0.126 0.954 2e-42
Q90593 652 78 kDa glucose-regulated yes N/A 0.456 0.127 0.954 2e-42
Q5R4P0 654 78 kDa glucose-regulated yes N/A 0.445 0.123 0.954 2e-42
P06761 654 78 kDa glucose-regulated yes N/A 0.445 0.123 0.954 2e-42
P07823 654 78 kDa glucose-regulated N/A N/A 0.445 0.123 0.954 2e-42
P11021 654 78 kDa glucose-regulated yes N/A 0.456 0.126 0.954 2e-42
Q91883 658 78 kDa glucose-regulated N/A N/A 0.472 0.130 0.954 2e-42
>sp|P29844|HSP7C_DROME Heat shock 70 kDa protein cognate 3 OS=Drosophila melanogaster GN=Hsc70-3 PE=2 SV=2 Back     alignment and function desciption
 Score =  173 bits (439), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 86/87 (98%), Positives = 86/87 (98%)

Query: 1   MKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGVIAGLTVMRIINEPTAAAIAYGLD 60
           MKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGVIAGL VMRIINEPTAAAIAYGLD
Sbjct: 153 MKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGVIAGLQVMRIINEPTAAAIAYGLD 212

Query: 61  KKEGEKNVLVFDLGGGTFDVSLLTIDN 87
           KKEGEKNVLVFDLGGGTFDVSLLTIDN
Sbjct: 213 KKEGEKNVLVFDLGGGTFDVSLLTIDN 239
Probably plays a role in facilitating the assembly of multimeric protein complexes inside the ER.
Drosophila melanogaster (taxid: 7227)
>sp|Q3S4T7|GRP78_SPETR 78 kDa glucose-regulated protein OS=Spermophilus tridecemlineatus GN=HSPA5 PE=2 SV=1 Back     alignment and function description
>sp|Q0VCX2|GRP78_BOVIN 78 kDa glucose-regulated protein OS=Bos taurus GN=HSPA5 PE=2 SV=1 Back     alignment and function description
>sp|P20029|GRP78_MOUSE 78 kDa glucose-regulated protein OS=Mus musculus GN=Hspa5 PE=1 SV=3 Back     alignment and function description
>sp|Q90593|GRP78_CHICK 78 kDa glucose-regulated protein OS=Gallus gallus GN=HSPA5 PE=1 SV=1 Back     alignment and function description
>sp|Q5R4P0|GRP78_PONAB 78 kDa glucose-regulated protein OS=Pongo abelii GN=HSPA5 PE=2 SV=1 Back     alignment and function description
>sp|P06761|GRP78_RAT 78 kDa glucose-regulated protein OS=Rattus norvegicus GN=Hspa5 PE=1 SV=1 Back     alignment and function description
>sp|P07823|GRP78_MESAU 78 kDa glucose-regulated protein OS=Mesocricetus auratus GN=HSPA5 PE=1 SV=1 Back     alignment and function description
>sp|P11021|GRP78_HUMAN 78 kDa glucose-regulated protein OS=Homo sapiens GN=HSPA5 PE=1 SV=2 Back     alignment and function description
>sp|Q91883|GRP78_XENLA 78 kDa glucose-regulated protein OS=Xenopus laevis GN=hspa5 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query182
357622014 963 heat shock cognate 70 protein [Danaus pl 0.467 0.088 0.988 1e-41
389608441 659 heat shock protein cognate 3 [Papilio xu 0.478 0.132 0.988 1e-41
156361178 669 predicted protein [Nematostella vectensi 0.604 0.164 0.782 2e-41
195165202 657 GL20354 [Drosophila persimilis] gi|19410 0.598 0.165 0.807 2e-41
390356140 664 PREDICTED: LOW QUALITY PROTEIN: 78 kDa g 0.478 0.131 0.965 2e-41
195355290 509 GM13044 [Drosophila sechellia] gi|194129 0.467 0.166 0.988 2e-41
289743105 657 heat shock protein cognate 3 [Glossina m 0.461 0.127 0.988 2e-41
195457222 657 GK18328 [Drosophila willistoni] gi|19417 0.461 0.127 0.988 2e-41
195131887 656 GI14717 [Drosophila mojavensis] gi|19390 0.467 0.129 0.988 2e-41
195396571 657 GJ16781 [Drosophila virilis] gi|19414667 0.461 0.127 0.988 2e-41
>gi|357622014|gb|EHJ73638.1| heat shock cognate 70 protein [Danaus plexippus] Back     alignment and taxonomy information
 Score =  174 bits (442), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 86/87 (98%), Positives = 86/87 (98%)

Query: 1   MKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGVIAGLTVMRIINEPTAAAIAYGLD 60
           MKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGVIAGL VMRIINEPTAAAIAYGLD
Sbjct: 459 MKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLD 518

Query: 61  KKEGEKNVLVFDLGGGTFDVSLLTIDN 87
           KKEGEKNVLVFDLGGGTFDVSLLTIDN
Sbjct: 519 KKEGEKNVLVFDLGGGTFDVSLLTIDN 545

Source: Danaus plexippus

Species: Danaus plexippus

Genus: Danaus

Family: Nymphalidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|389608441|dbj|BAM17830.1| heat shock protein cognate 3 [Papilio xuthus] Back     alignment and taxonomy information
>gi|156361178|ref|XP_001625396.1| predicted protein [Nematostella vectensis] gi|156212228|gb|EDO33296.1| predicted protein [Nematostella vectensis] Back     alignment and taxonomy information
>gi|195165202|ref|XP_002023428.1| GL20354 [Drosophila persimilis] gi|194105533|gb|EDW27576.1| GL20354 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|390356140|ref|XP_003728714.1| PREDICTED: LOW QUALITY PROTEIN: 78 kDa glucose-regulated protein-like [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
>gi|195355290|ref|XP_002044125.1| GM13044 [Drosophila sechellia] gi|194129394|gb|EDW51437.1| GM13044 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|289743105|gb|ADD20300.1| heat shock protein cognate 3 [Glossina morsitans morsitans] Back     alignment and taxonomy information
>gi|195457222|ref|XP_002075480.1| GK18328 [Drosophila willistoni] gi|194171565|gb|EDW86466.1| GK18328 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|195131887|ref|XP_002010376.1| GI14717 [Drosophila mojavensis] gi|193908826|gb|EDW07693.1| GI14717 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|195396571|ref|XP_002056904.1| GJ16781 [Drosophila virilis] gi|194146671|gb|EDW62390.1| GJ16781 [Drosophila virilis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query182
FB|FBgn0001218 656 Hsc70-3 "Heat shock 70-kDa pro 0.478 0.132 0.988 5.4e-56
UNIPROTKB|Q0VCX2 655 HSPA5 "78 kDa glucose-regulate 0.478 0.132 0.954 2.9e-55
UNIPROTKB|P11021 654 HSPA5 "78 kDa glucose-regulate 0.478 0.133 0.954 3.6e-55
UNIPROTKB|G3I8R9 654 I79_019946 "78 kDa glucose-reg 0.478 0.133 0.954 3.6e-55
UNIPROTKB|P07823 654 HSPA5 "78 kDa glucose-regulate 0.478 0.133 0.954 3.6e-55
MGI|MGI:95835 655 Hspa5 "heat shock protein 5" [ 0.478 0.132 0.954 4.6e-55
UNIPROTKB|F1PIC7 654 HSPA5 "Uncharacterized protein 0.478 0.133 0.954 5.8e-55
RGD|2843 654 Hspa5 "heat shock protein 5" [ 0.478 0.133 0.954 5.8e-55
UNIPROTKB|Q90593 652 HSPA5 "78 kDa glucose-regulate 0.478 0.133 0.954 7e-55
UNIPROTKB|F1RS36 634 HSPA5 "78 kDa glucose-regulate 0.478 0.137 0.954 4.7e-54
FB|FBgn0001218 Hsc70-3 "Heat shock 70-kDa protein cognate 3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 429 (156.1 bits), Expect = 5.4e-56, Sum P(2) = 5.4e-56
 Identities = 86/87 (98%), Positives = 86/87 (98%)

Query:     1 MKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGVIAGLTVMRIINEPTAAAIAYGLD 60
             MKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGVIAGL VMRIINEPTAAAIAYGLD
Sbjct:   153 MKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGVIAGLQVMRIINEPTAAAIAYGLD 212

Query:    61 KKEGEKNVLVFDLGGGTFDVSLLTIDN 87
             KKEGEKNVLVFDLGGGTFDVSLLTIDN
Sbjct:   213 KKEGEKNVLVFDLGGGTFDVSLLTIDN 239
GO:0009408 "response to heat" evidence=ISS;NAS
GO:0016887 "ATPase activity" evidence=NAS
GO:0005783 "endoplasmic reticulum" evidence=IDA;NAS
GO:0030431 "sleep" evidence=TAS
GO:0016246 "RNA interference" evidence=IMP
GO:0005811 "lipid particle" evidence=IDA
GO:0005615 "extracellular space" evidence=IDA
GO:0005875 "microtubule associated complex" evidence=IDA
GO:0051298 "centrosome duplication" evidence=IMP
UNIPROTKB|Q0VCX2 HSPA5 "78 kDa glucose-regulated protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P11021 HSPA5 "78 kDa glucose-regulated protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|G3I8R9 I79_019946 "78 kDa glucose-regulated protein" [Cricetulus griseus (taxid:10029)] Back     alignment and assigned GO terms
UNIPROTKB|P07823 HSPA5 "78 kDa glucose-regulated protein" [Mesocricetus auratus (taxid:10036)] Back     alignment and assigned GO terms
MGI|MGI:95835 Hspa5 "heat shock protein 5" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1PIC7 HSPA5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|2843 Hspa5 "heat shock protein 5" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q90593 HSPA5 "78 kDa glucose-regulated protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1RS36 HSPA5 "78 kDa glucose-regulated protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q91883GRP78_XENLANo assigned EC number0.95400.47250.1306N/AN/A
P29844HSP7C_DROMENo assigned EC number0.98850.46700.1295yesN/A
Q5R4P0GRP78_PONABNo assigned EC number0.95400.44500.1238yesN/A
Q9LKR3MD37A_ARATHNo assigned EC number0.90800.47800.1300yesN/A
P07823GRP78_MESAUNo assigned EC number0.95400.44500.1238N/AN/A
Q03684BIP4_TOBACNo assigned EC number0.90800.46150.1259N/AN/A
Q03685BIP5_TOBACNo assigned EC number0.90800.47800.1302N/AN/A
Q24895GRP78_ECHMUNo assigned EC number0.90800.45600.1278N/AN/A
P36604GRP78_SCHPONo assigned EC number0.69290.60430.1659yesN/A
P83616GRP78_ASPNGNo assigned EC number0.82750.45050.1220yesN/A
Q6BZH1GRP78_DEBHANo assigned EC number0.81390.46700.1244yesN/A
Q39043MD37F_ARATHNo assigned EC number0.90800.47800.1302yesN/A
A2Q0Z1HSP7C_HORSENo assigned EC number0.69820.60430.1702yesN/A
P27420HSP7C_CAEELNo assigned EC number0.86200.46700.1285yesN/A
Q3S4T7GRP78_SPETRNo assigned EC number0.95400.45600.1269N/AN/A
P06761GRP78_RATNo assigned EC number0.95400.44500.1238yesN/A
Q0VCX2GRP78_BOVINNo assigned EC number0.95400.45600.1267yesN/A
P20029GRP78_MOUSENo assigned EC number0.95400.45600.1267yesN/A
P11021GRP78_HUMANNo assigned EC number0.95400.45600.1269yesN/A
Q90593GRP78_CHICKNo assigned EC number0.95400.45600.1273yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query182
cd10241374 cd10241, HSPA5-like_NBD, Nucleotide-binding domain 3e-63
cd10233376 cd10233, HSPA1-2_6-8-like_NBD, Nucleotide-binding 3e-59
pfam00012 598 pfam00012, HSP70, Hsp70 protein 2e-55
PRK00290 627 PRK00290, dnaK, molecular chaperone DnaK; Provisio 5e-54
PTZ00009 653 PTZ00009, PTZ00009, heat shock 70 kDa protein; Pro 2e-51
cd10234376 cd10234, HSPA9-Ssq1-like_NBD, Nucleotide-binding d 4e-51
cd11733377 cd11733, HSPA9-like_NBD, Nucleotide-binding domain 1e-48
cd10235339 cd10235, HscC_like_NBD, Nucleotide-binding domain 6e-48
cd10170369 cd10170, HSP70_NBD, Nucleotide-binding domain of t 2e-47
TIGR02350 595 TIGR02350, prok_dnaK, chaperone protein DnaK 2e-47
COG0443 579 COG0443, DnaK, Molecular chaperone [Posttranslatio 1e-44
PRK13411 653 PRK13411, PRK13411, molecular chaperone DnaK; Prov 2e-44
PRK13410 668 PRK13410, PRK13410, molecular chaperone DnaK; Prov 6e-44
cd10236355 cd10236, HscA_like_NBD, Nucleotide-binding domain 8e-44
cd11734373 cd11734, Ssq1_like_NBD, Nucleotide-binding domain 1e-43
PTZ00400 663 PTZ00400, PTZ00400, DnaK-type molecular chaperone; 7e-43
CHL00094 621 CHL00094, dnaK, heat shock protein 70 1e-41
PRK05183 616 PRK05183, hscA, chaperone protein HscA; Provisiona 2e-39
TIGR01991 599 TIGR01991, HscA, Fe-S protein assembly chaperone H 1e-36
PLN03184 673 PLN03184, PLN03184, chloroplast Hsp70; Provisional 6e-35
PTZ00186 657 PTZ00186, PTZ00186, heat shock 70 kDa precursor pr 8e-34
cd10237417 cd10237, HSPA13-like_NBD, Nucleotide-binding domai 4e-31
PRK01433 595 PRK01433, hscA, chaperone protein HscA; Provisiona 8e-28
cd10228381 cd10228, HSPA4_like_NDB, Nucleotide-binding domain 2e-25
cd10238375 cd10238, HSPA14-like_NBD, Nucleotide-binding domai 2e-23
cd10230388 cd10230, HYOU1-like_NBD, Nucleotide-binding domain 3e-22
cd10232386 cd10232, ScSsz1p_like_NBD, Nucleotide-binding doma 2e-20
cd11737383 cd11737, HSPA4_NBD, Nucleotide-binding domain of H 3e-17
cd11739383 cd11739, HSPH1_NBD, Nucleotide-binding domain of H 5e-16
cd11738383 cd11738, HSPA4L_NBD, Nucleotide-binding domain of 4e-15
PTZ00009653 PTZ00009, PTZ00009, heat shock 70 kDa protein; Pro 2e-14
cd11732377 cd11732, HSP105-110_like_NBD, Nucleotide-binding d 2e-13
cd10231 415 cd10231, YegD_like, Escherichia coli YegD, a putat 3e-13
cd10229404 cd10229, HSPA12_like_NBD, Nucleotide-binding domai 1e-11
PRK11678 450 PRK11678, PRK11678, putative chaperone; Provisiona 2e-09
cd00012185 cd00012, NBD_sugar-kinase_HSP70_actin, Nucleotide- 3e-07
COG4820277 COG4820, EutJ, Ethanolamine utilization protein, p 5e-07
TIGR02529239 TIGR02529, EutJ, ethanolamine utilization protein 1e-06
cd10225320 cd10225, MreB_like, MreB and similar proteins 1e-06
COG1077342 COG1077, MreB, Actin-like ATPase involved in cell 2e-06
pfam06723327 pfam06723, MreB_Mbl, MreB/Mbl protein 2e-06
TIGR00904333 TIGR00904, mreB, cell shape determining protein, M 2e-06
PRK13928336 PRK13928, PRK13928, rod shape-determining protein 3e-06
PRK13929335 PRK13929, PRK13929, rod-share determining protein 5e-06
PRK13930335 PRK13930, PRK13930, rod shape-determining protein 1e-05
PRK15080267 PRK15080, PRK15080, ethanolamine utilization prote 1e-05
pfam00012598 pfam00012, HSP70, Hsp70 protein 2e-05
PRK00290627 PRK00290, dnaK, molecular chaperone DnaK; Provisio 1e-04
PRK13927334 PRK13927, PRK13927, rod shape-determining protein 0.002
COG0849418 COG0849, ftsA, Cell division ATPase FtsA [Cell div 0.002
>gnl|CDD|212681 cd10241, HSPA5-like_NBD, Nucleotide-binding domain of human HSPA5 and similar proteins Back     alignment and domain information 
 Score =  198 bits (506), Expect = 3e-63
 Identities = 80/87 (91%), Positives = 82/87 (94%)

Query: 1   MKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGVIAGLTVMRIINEPTAAAIAYGLD 60
           MKE AEAYLGKKV HAVVTVPAYFNDAQRQATKDAG IAGL V+RIINEPTAAAIAYGLD
Sbjct: 124 MKEIAEAYLGKKVKHAVVTVPAYFNDAQRQATKDAGTIAGLNVVRIINEPTAAAIAYGLD 183

Query: 61  KKEGEKNVLVFDLGGGTFDVSLLTIDN 87
           KK GEKN+LVFDLGGGTFDVSLLTIDN
Sbjct: 184 KKGGEKNILVFDLGGGTFDVSLLTIDN 210

This subfamily includes human HSPA5 (also known as 70-kDa heat shock protein 5, glucose-regulated protein 78/GRP78, and immunoglobulin heavy chain-binding protein/BIP, MIF2; the gene encoding HSPA5 maps to 9q33.3.), Sacchaormyces cerevisiae Kar2p (also known as Grp78p), and related proteins. This subfamily belongs to the heat shock protein 70 (HSP70) family of chaperones that assist in protein folding and assembly and can direct incompetent "client" proteins towards degradation. HSPA5 and Kar2p are chaperones of the endoplasmic reticulum (ER). Typically, HSP70s have a nucleotide-binding domain (NBD) and a substrate-binding domain (SBD). The nucleotide sits in a deep cleft formed between the two lobes of the NBD. The two subdomains of each lobe change conformation between ATP-bound, ADP-bound, and nucleotide-free states. ATP binding opens up the substrate-binding site; substrate-binding increases the rate of ATP hydrolysis. HSP70 chaperone activity is regulated by various co-chaperones: J-domain proteins and nucleotide exchange factors (NEFs). Multiple ER DNAJ domain proteins have been identified and may exist in distinct complexes with HSPA5 in various locations in the ER, for example DNAJC3-p58IPK in the lumen. HSPA5-NEFs include SIL1 and an atypical HSP70 family protein HYOU1/ORP150. The ATPase activity of Kar2p is stimulated by the NEFs: Sil1p and Lhs1p. Length = 374
>gnl|CDD|212675 cd10233, HSPA1-2_6-8-like_NBD, Nucleotide-binding domain of HSPA1-A, -B, -L, HSPA-2, -6, -7, -8, and similar proteins Back     alignment and domain information
>gnl|CDD|215656 pfam00012, HSP70, Hsp70 protein Back     alignment and domain information
>gnl|CDD|234715 PRK00290, dnaK, molecular chaperone DnaK; Provisional Back     alignment and domain information
>gnl|CDD|240227 PTZ00009, PTZ00009, heat shock 70 kDa protein; Provisional Back     alignment and domain information
>gnl|CDD|212676 cd10234, HSPA9-Ssq1-like_NBD, Nucleotide-binding domain of human HSPA9 and similar proteins Back     alignment and domain information
>gnl|CDD|212683 cd11733, HSPA9-like_NBD, Nucleotide-binding domain of human HSPA9, Escherichia coli DnaK, and similar proteins Back     alignment and domain information
>gnl|CDD|212677 cd10235, HscC_like_NBD, Nucleotide-binding domain of Escherichia coli HscC and similar proteins Back     alignment and domain information
>gnl|CDD|212667 cd10170, HSP70_NBD, Nucleotide-binding domain of the HSP70 family Back     alignment and domain information
>gnl|CDD|233830 TIGR02350, prok_dnaK, chaperone protein DnaK Back     alignment and domain information
>gnl|CDD|223520 COG0443, DnaK, Molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|184039 PRK13411, PRK13411, molecular chaperone DnaK; Provisional Back     alignment and domain information
>gnl|CDD|184038 PRK13410, PRK13410, molecular chaperone DnaK; Provisional Back     alignment and domain information
>gnl|CDD|212678 cd10236, HscA_like_NBD, Nucleotide-binding domain of HscA and similar proteins Back     alignment and domain information
>gnl|CDD|212684 cd11734, Ssq1_like_NBD, Nucleotide-binding domain of Saccharomyces cerevisiae Ssq1 and similar proteins Back     alignment and domain information
>gnl|CDD|240403 PTZ00400, PTZ00400, DnaK-type molecular chaperone; Provisional Back     alignment and domain information
>gnl|CDD|214360 CHL00094, dnaK, heat shock protein 70 Back     alignment and domain information
>gnl|CDD|235360 PRK05183, hscA, chaperone protein HscA; Provisional Back     alignment and domain information
>gnl|CDD|233673 TIGR01991, HscA, Fe-S protein assembly chaperone HscA Back     alignment and domain information
>gnl|CDD|215618 PLN03184, PLN03184, chloroplast Hsp70; Provisional Back     alignment and domain information
>gnl|CDD|140213 PTZ00186, PTZ00186, heat shock 70 kDa precursor protein; Provisional Back     alignment and domain information
>gnl|CDD|212679 cd10237, HSPA13-like_NBD, Nucleotide-binding domain of human HSPA13 and similar proteins Back     alignment and domain information
>gnl|CDD|234955 PRK01433, hscA, chaperone protein HscA; Provisional Back     alignment and domain information
>gnl|CDD|212670 cd10228, HSPA4_like_NDB, Nucleotide-binding domain of 105/110 kDa heat shock proteins including HSPA4 and similar proteins Back     alignment and domain information
>gnl|CDD|212680 cd10238, HSPA14-like_NBD, Nucleotide-binding domain of human HSPA14 and similar proteins Back     alignment and domain information
>gnl|CDD|212672 cd10230, HYOU1-like_NBD, Nucleotide-binding domain of human HYOU1 and similar proteins Back     alignment and domain information
>gnl|CDD|212674 cd10232, ScSsz1p_like_NBD, Nucleotide-binding domain of Saccharmomyces cerevisiae Ssz1pp and similar proteins Back     alignment and domain information
>gnl|CDD|212687 cd11737, HSPA4_NBD, Nucleotide-binding domain of HSPA4 Back     alignment and domain information
>gnl|CDD|212689 cd11739, HSPH1_NBD, Nucleotide-binding domain of HSPH1 Back     alignment and domain information
>gnl|CDD|212688 cd11738, HSPA4L_NBD, Nucleotide-binding domain of HSPA4L Back     alignment and domain information
>gnl|CDD|240227 PTZ00009, PTZ00009, heat shock 70 kDa protein; Provisional Back     alignment and domain information
>gnl|CDD|212682 cd11732, HSP105-110_like_NBD, Nucleotide-binding domain of 105/110 kDa heat shock proteins including HSPA4, HYOU1, and similar proteins Back     alignment and domain information
>gnl|CDD|212673 cd10231, YegD_like, Escherichia coli YegD, a putative chaperone protein, and related proteins Back     alignment and domain information
>gnl|CDD|212671 cd10229, HSPA12_like_NBD, Nucleotide-binding domain of HSPA12A, HSPA12B and similar proteins Back     alignment and domain information
>gnl|CDD|236954 PRK11678, PRK11678, putative chaperone; Provisional Back     alignment and domain information
>gnl|CDD|212657 cd00012, NBD_sugar-kinase_HSP70_actin, Nucleotide-Binding Domain of the sugar kinase/HSP70/actin superfamily Back     alignment and domain information
>gnl|CDD|227157 COG4820, EutJ, Ethanolamine utilization protein, possible chaperonin [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213718 TIGR02529, EutJ, ethanolamine utilization protein EutJ family protein Back     alignment and domain information
>gnl|CDD|212668 cd10225, MreB_like, MreB and similar proteins Back     alignment and domain information
>gnl|CDD|224003 COG1077, MreB, Actin-like ATPase involved in cell morphogenesis [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|115385 pfam06723, MreB_Mbl, MreB/Mbl protein Back     alignment and domain information
>gnl|CDD|129982 TIGR00904, mreB, cell shape determining protein, MreB/Mrl family Back     alignment and domain information
>gnl|CDD|237563 PRK13928, PRK13928, rod shape-determining protein Mbl; Provisional Back     alignment and domain information
>gnl|CDD|184403 PRK13929, PRK13929, rod-share determining protein MreBH; Provisional Back     alignment and domain information
>gnl|CDD|237564 PRK13930, PRK13930, rod shape-determining protein MreB; Provisional Back     alignment and domain information
>gnl|CDD|237904 PRK15080, PRK15080, ethanolamine utilization protein EutJ; Provisional Back     alignment and domain information
>gnl|CDD|215656 pfam00012, HSP70, Hsp70 protein Back     alignment and domain information
>gnl|CDD|234715 PRK00290, dnaK, molecular chaperone DnaK; Provisional Back     alignment and domain information
>gnl|CDD|237562 PRK13927, PRK13927, rod shape-determining protein MreB; Provisional Back     alignment and domain information
>gnl|CDD|223918 COG0849, ftsA, Cell division ATPase FtsA [Cell division and chromosome partitioning] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query182
3iuc_A408 Crystal Structure Of The Human 70kda Heat Shock Pro 5e-44
3ldl_A384 Crystal Structure Of Human Grp78 (70kda Heat Shock 6e-44
3fe1_A403 Crystal Structure Of The Human 70kda Heat Shock Pro 2e-37
3c7n_B 554 Structure Of The Hsp110:hsc70 Nucleotide Exchange C 2e-37
1ngg_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 2e-37
1bup_A386 T13s Mutant Of Bovine 70 Kilodalton Heat Shock Prot 2e-37
1kax_A381 70kd Heat Shock Cognate Protein Atpase Domain, K71m 2e-37
1kaz_A381 70kd Heat Shock Cognate Protein Atpase Domain, K71e 2e-37
2qw9_B394 Crystal Structure Of Bovine Hsc70 (1-394aa)in The A 2e-37
1ngh_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 2e-37
1kay_A381 70kd Heat Shock Cognate Protein Atpase Domain, K71a 2e-37
1hx1_A400 Crystal Structure Of A Bag Domain In Complex With T 2e-37
1ba1_A386 Heat-Shock Cognate 70kd Protein 44kd Atpase N-Termi 2e-37
3cqx_A386 Chaperone Complex Length = 386 2e-37
1hpm_A386 How Potassium Affects The Activity Of The Molecular 2e-37
3fzf_A381 Crystal Structure Of Hsc70BAG1 IN COMPLEX WITH ATP 3e-37
1yuw_A 554 Crystal Structure Of Bovine Hsc70(Aa1-554)e213aD214 3e-37
2bup_A381 T13g Mutant Of The Atpase Fragment Of Bovine Hsc70 3e-37
3kvg_A400 Crystal Structure Of The N-Terminal Domain Of Hsp70 5e-37
1ngb_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 6e-37
3jxu_A409 Crystal Structure Of The Human 70kda Heat Shock Pro 6e-37
3d2f_B382 Crystal Structure Of A Complex Of Sse1p And Hsp70 L 6e-37
2e8a_A391 Crystal Structure Of The Human Hsp70 Atpase Domain 6e-37
2e88_A391 Crystal Structure Of The Human Hsp70 Atpase Domain 6e-37
1s3x_A382 The Crystal Structure Of The Human Hsp70 Atpase Dom 7e-37
3a8y_A392 Crystal Structure Of The Complex Between The Bag5 B 7e-37
1ngd_A386 Structural Basis Of The 70-kilodalton Heat Shock Co 7e-37
1ngf_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 7e-37
1hjo_A380 Atpase Domain Of Human Heat Shock 70kda Protein 1 L 7e-37
1nga_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 8e-37
1atr_A386 Threonine 204 Of The Chaperone Protein Hsc70 Influe 1e-36
1ngc_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 1e-36
1nge_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 1e-36
1ats_A386 Threonine 204 Of The Chaperone Protein Hsc70 Influe 1e-36
1ba0_A386 Heat-Shock Cognate 70kd Protein 44kd Atpase N-Termi 1e-36
3gdq_A408 Crystal Structure Of The Human 70kda Heat Shock Pro 2e-36
3qfu_A394 Crystal Structure Of Yeast Hsp70 (BipKAR2) COMPLEXE 2e-36
2qwn_A394 Crystal Structure Of Disulfide-Bond-Crosslinked Com 2e-36
3qfp_A390 Crystal Structure Of Yeast Hsp70 (BipKAR2) ATPASE D 2e-36
3d2e_B382 Crystal Structure Of A Complex Of Sse1p And Hsp70, 4e-36
3i33_A404 Crystal Structure Of The Human 70kda Heat Shock Pro 7e-36
2v7z_A 543 Crystal Structure Of The 70-Kda Heat Shock Cognate 8e-36
1qqo_A378 E175s Mutant Of Bovine 70 Kilodalton Heat Shock Pro 2e-35
1qqm_A378 D199s Mutant Of Bovine 70 Kilodalton Heat Shock Pro 2e-35
1qqn_A378 D206s Mutant Of Bovine 70 Kilodalton Heat Shock Pro 2e-35
4fsv_A387 Crystal Structure Of A Heat Shock 70kda Protein 2 ( 5e-35
2kho_A 605 Nmr-Rdc XRAY STRUCTURE OF E. COLI HSP70 (DNAK) CHAP 6e-33
3gl1_A387 Crystal Structure Of Atpase Domain Of Ssb1 Chaperon 8e-33
1dkg_D383 Crystal Structure Of The Nucleotide Exchange Factor 1e-32
4b9q_A 605 Open Conformation Of Atp-Bound Hsp70 Homolog Dnak L 1e-31
2v7y_A 509 Crystal Structure Of The Molecular Chaperone Dnak F 2e-30
4gni_A409 Structure Of The Ssz1 Atpase Bound To Atp And Magne 3e-09
2qxl_A 658 Crystal Structure Analysis Of Sse1, A Yeast Hsp110 6e-08
3c7n_A 668 Structure Of The Hsp110:hsc70 Nucleotide Exchange C 7e-08
3d2f_A 675 Crystal Structure Of A Complex Of Sse1p And Hsp70 L 7e-08
1jcf_A344 Mreb From Thermotoga Maritima, Trigonal Length = 34 1e-07
3d2e_A 675 Crystal Structure Of A Complex Of Sse1p And Hsp70, 1e-07
1xqs_C191 Crystal Structure Of The Hspbp1 Core Domain Complex 1e-07
1jce_A344 Mreb From Thermotoga Maritima Length = 344 3e-07
2p32_A120 Crystal Structure Of The C-Terminal 10 Kda Subdomai 4e-07
1ud0_A113 Crystal Structure Of The C-Terminal 10-Kda Subdomai 5e-07
3lof_A113 C-Terminal Domain Of Human Heat Shock 70kda Protein 2e-05
2lmg_A75 Solution Structure Of The C-Terminal Domain (537-61 1e-04
>pdb|3IUC|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 5 (BipGRP78) ATPASE DOMAIN IN COMPLEX WITH ADP Length = 408 Back     alignment and structure 
Iteration: 1

 Score =  173 bits (438), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 85/87 (97%)
Query: 1   MKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGVIAGLTVMRIINEPTAAAIAYGLD 60
           MKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAG IAGL VMRIINEPTAAAIAYGLD
Sbjct: 151 MKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLD 210
Query: 61  KKEGEKNVLVFDLGGGTFDVSLLTIDN 87
           K+EGEKN+LVFDLGGGTFDVSLLTIDN
Sbjct: 211 KREGEKNILVFDLGGGTFDVSLLTIDN 237
>pdb|3LDL|A Chain A, Crystal Structure Of Human Grp78 (70kda Heat Shock Protein 5 BIP) Atpase Domain In Complex With Atp Length = 384 Back     alignment and structure
>pdb|3FE1|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 6 (Hsp70b') Atpase Domain In Complex With Adp And Inorganic Phosphate Length = 403 Back     alignment and structure
>pdb|3C7N|B Chain B, Structure Of The Hsp110:hsc70 Nucleotide Exchange Complex Length = 554 Back     alignment and structure
>pdb|1NGG|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1BUP|A Chain A, T13s Mutant Of Bovine 70 Kilodalton Heat Shock Protein Length = 386 Back     alignment and structure
>pdb|1KAX|A Chain A, 70kd Heat Shock Cognate Protein Atpase Domain, K71m Mutant Length = 381 Back     alignment and structure
>pdb|1KAZ|A Chain A, 70kd Heat Shock Cognate Protein Atpase Domain, K71e Mutant Length = 381 Back     alignment and structure
>pdb|2QW9|B Chain B, Crystal Structure Of Bovine Hsc70 (1-394aa)in The Apo State Length = 394 Back     alignment and structure
>pdb|1NGH|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1KAY|A Chain A, 70kd Heat Shock Cognate Protein Atpase Domain, K71a Mutant Length = 381 Back     alignment and structure
>pdb|1HX1|A Chain A, Crystal Structure Of A Bag Domain In Complex With The Hsc70 Atpase Domain Length = 400 Back     alignment and structure
>pdb|1BA1|A Chain A, Heat-Shock Cognate 70kd Protein 44kd Atpase N-Terminal Mutant With Cys 17 Replaced By Lys Length = 386 Back     alignment and structure
>pdb|3CQX|A Chain A, Chaperone Complex Length = 386 Back     alignment and structure
>pdb|1HPM|A Chain A, How Potassium Affects The Activity Of The Molecular Chaperone Hsc70. Ii. Potassium Binds Specifically In The Atpase Active Site Length = 386 Back     alignment and structure
>pdb|3FZF|A Chain A, Crystal Structure Of Hsc70BAG1 IN COMPLEX WITH ATP Length = 381 Back     alignment and structure
>pdb|1YUW|A Chain A, Crystal Structure Of Bovine Hsc70(Aa1-554)e213aD214A MUTANT Length = 554 Back     alignment and structure
>pdb|2BUP|A Chain A, T13g Mutant Of The Atpase Fragment Of Bovine Hsc70 Length = 381 Back     alignment and structure
>pdb|3KVG|A Chain A, Crystal Structure Of The N-Terminal Domain Of Hsp70 (Cgd2_20) From Cryptosporidium Parvum In Complex With Amppnp Length = 400 Back     alignment and structure
>pdb|1NGB|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|3JXU|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 1a (Hsp70-1) Atpase Domain In Complex With Adp And Inorganic Phosphate Length = 409 Back     alignment and structure
>pdb|3D2F|B Chain B, Crystal Structure Of A Complex Of Sse1p And Hsp70 Length = 382 Back     alignment and structure
>pdb|2E8A|A Chain A, Crystal Structure Of The Human Hsp70 Atpase Domain In Complex With Amp-Pnp Length = 391 Back     alignment and structure
>pdb|2E88|A Chain A, Crystal Structure Of The Human Hsp70 Atpase Domain In The Apo Form Length = 391 Back     alignment and structure
>pdb|1S3X|A Chain A, The Crystal Structure Of The Human Hsp70 Atpase Domain Length = 382 Back     alignment and structure
>pdb|3A8Y|A Chain A, Crystal Structure Of The Complex Between The Bag5 Bd5 And Hsp70 Nbd Length = 392 Back     alignment and structure
>pdb|1NGD|A Chain A, Structural Basis Of The 70-kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1NGF|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1HJO|A Chain A, Atpase Domain Of Human Heat Shock 70kda Protein 1 Length = 380 Back     alignment and structure
>pdb|1NGA|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1ATR|A Chain A, Threonine 204 Of The Chaperone Protein Hsc70 Influences The Structure Of The Active Site But Is Not Essential For Atp Hydrolysis Length = 386 Back     alignment and structure
>pdb|1NGC|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1NGE|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1ATS|A Chain A, Threonine 204 Of The Chaperone Protein Hsc70 Influences The Structure Of The Active Site But Is Not Essential For Atp Hydrolysis Length = 386 Back     alignment and structure
>pdb|1BA0|A Chain A, Heat-Shock Cognate 70kd Protein 44kd Atpase N-Terminal 1nge 3 Length = 386 Back     alignment and structure
>pdb|3GDQ|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 1-Like Atpase Domain In Complex With Adp And Inorganic Phosphate Length = 408 Back     alignment and structure
>pdb|2QWN|A Chain A, Crystal Structure Of Disulfide-Bond-Crosslinked Complex Of Bovine Hsc70 (1-386aa)r171c And Bovine Auxilin (810-910aa)d876c In The AdpPi State Length = 394 Back     alignment and structure
>pdb|3QFP|A Chain A, Crystal Structure Of Yeast Hsp70 (BipKAR2) ATPASE DOMAIN Length = 390 Back     alignment and structure
>pdb|3D2E|B Chain B, Crystal Structure Of A Complex Of Sse1p And Hsp70, Selenomethionine- Labeled Crystals Length = 382 Back     alignment and structure
>pdb|3I33|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 2 (Hsp70-2) Atpase Domain In Complex With Adp And Inorganic Phosphate Length = 404 Back     alignment and structure
>pdb|2V7Z|A Chain A, Crystal Structure Of The 70-Kda Heat Shock Cognate Protein From Rattus Norvegicus In Post-Atp Hydrolysis State Length = 543 Back     alignment and structure
>pdb|1QQO|A Chain A, E175s Mutant Of Bovine 70 Kilodalton Heat Shock Protein Length = 378 Back     alignment and structure
>pdb|1QQM|A Chain A, D199s Mutant Of Bovine 70 Kilodalton Heat Shock Protein Length = 378 Back     alignment and structure
>pdb|1QQN|A Chain A, D206s Mutant Of Bovine 70 Kilodalton Heat Shock Protein Length = 378 Back     alignment and structure
>pdb|4FSV|A Chain A, Crystal Structure Of A Heat Shock 70kda Protein 2 (Hspa2) From Homo Sapiens At 1.80 A Resolution Length = 387 Back     alignment and structure
>pdb|2KHO|A Chain A, Nmr-Rdc XRAY STRUCTURE OF E. COLI HSP70 (DNAK) CHAPERONE (1-605) Complexed With Adp And Substrate Length = 605 Back     alignment and structure
>pdb|3GL1|A Chain A, Crystal Structure Of Atpase Domain Of Ssb1 Chaperone, A Member Of The Hsp70 Family, From Saccharomyces Cerevisiae Length = 387 Back     alignment and structure
>pdb|1DKG|D Chain D, Crystal Structure Of The Nucleotide Exchange Factor Grpe Bound To The Atpase Domain Of The Molecular Chaperone Dnak Length = 383 Back     alignment and structure
>pdb|4B9Q|A Chain A, Open Conformation Of Atp-Bound Hsp70 Homolog Dnak Length = 605 Back     alignment and structure
>pdb|2V7Y|A Chain A, Crystal Structure Of The Molecular Chaperone Dnak From Geobacillus Kaustophilus Hta426 In Post-Atp Hydrolysis State Length = 509 Back     alignment and structure
>pdb|4GNI|A Chain A, Structure Of The Ssz1 Atpase Bound To Atp And Magnesium Length = 409 Back     alignment and structure
>pdb|2QXL|A Chain A, Crystal Structure Analysis Of Sse1, A Yeast Hsp110 Length = 658 Back     alignment and structure
>pdb|3C7N|A Chain A, Structure Of The Hsp110:hsc70 Nucleotide Exchange Complex Length = 668 Back     alignment and structure
>pdb|3D2F|A Chain A, Crystal Structure Of A Complex Of Sse1p And Hsp70 Length = 675 Back     alignment and structure
>pdb|1JCF|A Chain A, Mreb From Thermotoga Maritima, Trigonal Length = 344 Back     alignment and structure
>pdb|3D2E|A Chain A, Crystal Structure Of A Complex Of Sse1p And Hsp70, Selenomethionine- Labeled Crystals Length = 675 Back     alignment and structure
>pdb|1XQS|C Chain C, Crystal Structure Of The Hspbp1 Core Domain Complexed With The Fragment Of Hsp70 Atpase Domain Length = 191 Back     alignment and structure
>pdb|1JCE|A Chain A, Mreb From Thermotoga Maritima Length = 344 Back     alignment and structure
>pdb|2P32|A Chain A, Crystal Structure Of The C-Terminal 10 Kda Subdomain From C. Elegans Hsp70 Length = 120 Back     alignment and structure
>pdb|1UD0|A Chain A, Crystal Structure Of The C-Terminal 10-Kda Subdomain Of Hsc70 Length = 113 Back     alignment and structure
>pdb|3LOF|A Chain A, C-Terminal Domain Of Human Heat Shock 70kda Protein 1b. Length = 113 Back     alignment and structure
>pdb|2LMG|A Chain A, Solution Structure Of The C-Terminal Domain (537-610) Of Human Heat Shock Protein 70 Length = 75 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query182
3qfu_A394 78 kDa glucose-regulated protein homolog; HSP70, K 5e-71
3i33_A404 Heat shock-related 70 kDa protein 2; protein-ADP c 3e-67
1yuw_A 554 Heat shock cognate 71 kDa protein; chaperone; 2.60 3e-66
1dkg_D383 Molecular chaperone DNAK; HSP70, GRPE, nucleotide 3e-58
3d2f_A 675 Heat shock protein homolog SSE1; nucleotide exchan 2e-57
3d2f_A675 Heat shock protein homolog SSE1; nucleotide exchan 6e-16
2kho_A 605 Heat shock protein 70; molecular chaperone, HSP70, 1e-54
2v7y_A 509 Chaperone protein DNAK; HSP70, heat shock protein, 2e-52
3h1q_A272 Ethanolamine utilization protein EUTJ; ethanolamin 2e-20
2p32_A120 Heat shock 70 kDa protein A; three-helix bundle, c 1e-19
3lof_A113 Heat shock 70 kDa protein 1; structural genomics, 4e-19
1ud0_A113 HSC70, 70 kDa heat-shock-like protein; chaperone; 8e-19
2zgy_A320 Plasmid segregation protein PARM; plasmid partitio 3e-14
2fsj_A346 Hypothetical protein TA0583; actin homologs, archa 2e-11
4apw_A329 ALP12; actin-like protein; 19.70A {Clostridium tet 8e-10
2ych_A377 Competence protein PILM; cell cycle, type IV pilus 7e-07
3js6_A355 Uncharacterized PARM protein; partition, segregati 1e-06
1jce_A344 ROD shape-determining protein MREB; MBL, actin, HS 4e-05
>3i33_A Heat shock-related 70 kDa protein 2; protein-ADP complex, ATP-binding, chaperone, nucleotide-BIND phosphoprotein, stress response; HET: ADP; 1.30A {Homo sapiens} PDB: 1hx1_A 3jxu_A* 2qwl_A* 2qw9_A* 2qwm_A* 1hpm_A* 1ngi_A* 1ngj_A* 3hsc_A* 1ngb_A* 3ldq_A* 3fzf_A* 3fzk_A* 3fzl_A* 3fzm_A* 3fzh_A* 3m3z_A* 1ngh_A* 1ngd_A* 1ngf_A* ... Length = 404 Back     alignment and structure
>1yuw_A Heat shock cognate 71 kDa protein; chaperone; 2.60A {Bos taurus} SCOP: b.130.1.1 c.55.1.1 c.55.1.1 PDB: 3c7n_B* 2v7z_A* Length = 554 Back     alignment and structure
>1dkg_D Molecular chaperone DNAK; HSP70, GRPE, nucleotide exchange factor, coiled-coil, complex (HSP24/HSP70); 2.80A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 Length = 383 Back     alignment and structure
>3d2f_A Heat shock protein homolog SSE1; nucleotide exchange factor, protein folding, ATP-binding, Ca binding, chaperone, nucleotide-binding, phosphoprotein; HET: ATP; 2.30A {Saccharomyces cerevisiae} PDB: 3d2e_A* 3c7n_A* 2qxl_A* Length = 675 Back     alignment and structure
>3d2f_A Heat shock protein homolog SSE1; nucleotide exchange factor, protein folding, ATP-binding, Ca binding, chaperone, nucleotide-binding, phosphoprotein; HET: ATP; 2.30A {Saccharomyces cerevisiae} PDB: 3d2e_A* 3c7n_A* 2qxl_A* Length = 675 Back     alignment and structure
>2kho_A Heat shock protein 70; molecular chaperone, HSP70, peptide binding, protein folding, acetylation, ATP-binding, cell inner membrane; NMR {Escherichia coli} Length = 605 Back     alignment and structure
>2v7y_A Chaperone protein DNAK; HSP70, heat shock protein, ATPase, domain rearrangement; HET: ADP; 2.37A {Geobacillus kaustophilus HTA426} Length = 509 Back     alignment and structure
>3h1q_A Ethanolamine utilization protein EUTJ; ethanolamine utilization EUTJ, structural genomics, PSI-2; HET: ATP; 2.80A {Carboxydothermus hydrogenoformans z-29organism_taxid} Length = 272 Back     alignment and structure
>2p32_A Heat shock 70 kDa protein A; three-helix bundle, chaperone; 3.20A {Caenorhabditis elegans} Length = 120 Back     alignment and structure
>3lof_A Heat shock 70 kDa protein 1; structural genomics, HSPA1B, HSP70, PSI-2, prote structure initiative; 2.40A {Homo sapiens} PDB: 2lmg_A Length = 113 Back     alignment and structure
>1ud0_A HSC70, 70 kDa heat-shock-like protein; chaperone; 3.45A {Rattus norvegicus} SCOP: a.8.4.1 Length = 113 Back     alignment and structure
>2zgy_A Plasmid segregation protein PARM; plasmid partition, structural protein; HET: GDP; 1.90A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 PDB: 1mwk_A* 2qu4_A 1mwm_A* 2zgz_A* 2zhc_A* 3iku_A 3iky_A Length = 320 Back     alignment and structure
>2fsj_A Hypothetical protein TA0583; actin homologs, archaea, ATPase, MREB, PARM, structural PROT; 1.90A {Thermoplasma acidophilum} SCOP: c.55.1.12 c.55.1.12 PDB: 2fsk_A 2fsn_A* Length = 346 Back     alignment and structure
>4apw_A ALP12; actin-like protein; 19.70A {Clostridium tetani} Length = 329 Back     alignment and structure
>2ych_A Competence protein PILM; cell cycle, type IV pilus actin secretion; HET: ATP; 2.20A {Thermus thermophilus} Length = 377 Back     alignment and structure
>3js6_A Uncharacterized PARM protein; partition, segregation, filament, unknown function; 1.95A {Staphylococcus aureus} Length = 355 Back     alignment and structure
>1jce_A ROD shape-determining protein MREB; MBL, actin, HSP-70, FTSZ, structural protein; 2.10A {Thermotoga maritima} SCOP: c.55.1.1 c.55.1.1 PDB: 1jcf_A 1jcg_A* 2wus_A Length = 344 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query182
4b9q_A 605 Chaperone protein DNAK; HET: ATP; 2.40A {Escherich 99.96
4gni_A409 Putative heat shock protein; HSP70-type ATPase, AT 99.96
3d2f_A 675 Heat shock protein homolog SSE1; nucleotide exchan 99.96
1yuw_A 554 Heat shock cognate 71 kDa protein; chaperone; 2.60 99.95
2kho_A 605 Heat shock protein 70; molecular chaperone, HSP70, 99.95
3i33_A404 Heat shock-related 70 kDa protein 2; protein-ADP c 99.95
3qfu_A394 78 kDa glucose-regulated protein homolog; HSP70, K 99.95
2v7y_A 509 Chaperone protein DNAK; HSP70, heat shock protein, 99.95
1dkg_D383 Molecular chaperone DNAK; HSP70, GRPE, nucleotide 99.93
1jce_A344 ROD shape-determining protein MREB; MBL, actin, HS 99.88
2fsj_A346 Hypothetical protein TA0583; actin homologs, archa 99.66
4a2a_A419 Cell division protein FTSA, putative; cell cycle, 99.64
3h1q_A272 Ethanolamine utilization protein EUTJ; ethanolamin 99.6
2ych_A377 Competence protein PILM; cell cycle, type IV pilus 99.55
1k8k_A 418 ARP3, actin-like protein 3, actin-2; beta-propelle 99.45
2fxu_A 375 Alpha-actin-1, actin, alpha skeletal muscle; actin 99.39
2zgy_A320 Plasmid segregation protein PARM; plasmid partitio 99.19
3js6_A355 Uncharacterized PARM protein; partition, segregati 99.04
1k8k_B 394 ARP2, actin-like protein 2; beta-propeller, struct 99.02
2d0o_A610 DIOL dehydratase-reactivating factor large subunit 98.84
1nbw_A607 Glycerol dehydratase reactivase alpha subunit; mol 98.75
3dwl_A 427 Actin-related protein 3; propellor, actin-binding, 98.73
3qb0_A 498 Actin-related protein 4; actin fold, ATP binding, 98.55
4am6_A 655 Actin-like protein ARP8; nuclear protein, chromati 98.54
4apw_A329 ALP12; actin-like protein; 19.70A {Clostridium tet 98.52
4fo0_A 593 Actin-related protein 8; chromatin remodeling, nuc 98.46
1t6c_A315 Exopolyphosphatase; alpha/beta protein, actin-like 97.27
2p32_A120 Heat shock 70 kDa protein A; three-helix bundle, c 97.26
3lof_A113 Heat shock 70 kDa protein 1; structural genomics, 97.25
1ud0_A113 HSC70, 70 kDa heat-shock-like protein; chaperone; 96.83
4ehu_A276 Activator of 2-hydroxyisocaproyl-COA dehydratase; 96.75
3mdq_A315 Exopolyphosphatase; structural genomics, joint cen 96.68
3hi0_A 508 Putative exopolyphosphatase; 17739545, structural 96.55
3cer_A343 Possible exopolyphosphatase-like protein; NESG, BL 96.53
1u6z_A 513 Exopolyphosphatase; alpha/beta protein, askha (ace 96.08
4e81_A219 Chaperone protein DNAK; chaperone; 1.90A {Escheric 91.13
3cet_A334 Conserved archaeal protein; Q6M145, MRR63, NESG, X 91.09
3aap_A353 Ectonucleoside triphosphate diphosphohydrolase I; 89.36
1u00_A227 HSC66, chaperone protein HSCA; DNAK, HSP70; 1.95A 85.93
3d2f_A675 Heat shock protein homolog SSE1; nucleotide exchan 84.66
3cj1_A 456 Ectonucleoside triphosphate diphosphohydrolase 2; 80.22
>4b9q_A Chaperone protein DNAK; HET: ATP; 2.40A {Escherichia coli} PDB: 2kho_A 1dkg_D Back     alignment and structure
Probab=99.96  E-value=6.9e-29  Score=212.92  Aligned_cols=165  Identities=46%  Similarity=0.715  Sum_probs=142.2

Q ss_pred             CHHHHHhHhCCccCeEEEecCCCCCHHHHHHHHHHHHHcCCcEEEeecchhHHHHHhhcccccCceeEEEEecCCceEEE
Q psy13565          1 MKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGVIAGLTVMRIINEPTAAAIAYGLDKKEGEKNVLVFDLGGGTFDV   80 (182)
Q Consensus         1 l~~~~~~~~g~~~~~~vitvP~~~~~~~r~~l~~a~~~ag~~~~~~i~ep~Aaa~~~~~~~~~~~~~vlv~D~G~gt~dv   80 (182)
                      |++.+++++|.++.++|||||++|++.||+++++|++.||++++.+++||+|||++|++.....+.+++|||+||||||+
T Consensus       123 lk~~ae~~lg~~v~~~VITVPa~f~~~qr~a~~~Aa~~AGl~v~~li~EP~AAAlaygl~~~~~~~~vlV~DlGGGT~Dv  202 (605)
T 4b9q_A          123 MKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYGLDKGTGNRTIAVYDLGGGAFDI  202 (605)
T ss_dssp             HHHHHHHHHTSCCCEEEEEECTTCCHHHHHHHHHHHHHTTCEEEEEEEHHHHHHHHHHTTSCCSSEEEEEEEECSSCEEE
T ss_pred             HHHHHHHHhCCCCCeEEEEECCCCCHHHHHHHHHHHHHcCCceEEEeCcHHHHHHHhhhhccCCCCEEEEEECCCCeEEE
Confidence            46788999999999999999999999999999999999999999999999999999988876667899999999999999


Q ss_pred             EEEEEeC----Cceee----ccCCCCcchhhhcccchhhhhhch----------hhhhhHHHHHHHHHhcccccccCCc-
Q psy13565         81 SLLTIDN----DHRRR----KDHHGGGDRRQDQVAPFLFLQITD----------AEKTTMEEAIDDKIKWLDENQDADA-  141 (182)
Q Consensus        81 sv~~~~~----~~~~~----~~~~~GG~~id~~l~~~l~~~l~~----------~~~~~l~~~~~~~k~~L~~~~~~~~-  141 (182)
                      +++++.+    +.+.+    ++..+||++||+.|.+++..++..          ....+|+..++++|..|+.+..... 
T Consensus       203 si~~~~~~~~~~~~evla~~gd~~lGG~d~D~~l~~~l~~~f~~~~~~~~~~~~~~~~~L~~~aE~~K~~Ls~~~~~~i~  282 (605)
T 4b9q_A          203 SIIEIDEVDGEKTFEVLATNGDTHLGGEDFDSRLINYLVEEFKKDQGIDLRNDPLAMQRLKEAAEKAKIELSSAQQTDVN  282 (605)
T ss_dssp             EEEEEEESSSCEEEEEEEEEEETTCSHHHHHHHHHHHHHHHHHHHTCCCGGGCHHHHHHHHHHHHHHHHHTTTCSEEEEE
T ss_pred             EEEEEecCCCCceEEEEEecCCCCcChHHHHHHHHHHHHHHHhhhcCCCcccCHHHHHHHHHHHHHHHHhcCcCCCeEEE
Confidence            9999877    55553    467899999999999999876532          2334688899999999987654422 


Q ss_pred             -------------hhhhhcHHHHHHHHHHHHHHHhcc
Q psy13565        142 -------------PEFQKKKKELEDVVQPIIAKLYQG  165 (182)
Q Consensus       142 -------------~~~~itr~el~~~i~p~l~~~~~~  165 (182)
                                   ..+.++|++|++++.|++++++..
T Consensus       283 ~~~~~~~~~g~~~~~~~itr~~~e~l~~~~~~~i~~~  319 (605)
T 4b9q_A          283 LPYITADATGPKHMNIKVTRAKLESLVEDLVNRSIEP  319 (605)
T ss_dssp             EEEEEECSSSEEEEEEEEEHHHHHHHHHHHHHHTTHH
T ss_pred             EeeeccCCCCCeeEEEEEeHHHHHHHHHHHHHHHHHH
Confidence                         346899999999999999988753
>4gni_A Putative heat shock protein; HSP70-type ATPase, ATP binding protein, magnesium binding, C translational chaperone; HET: ATP; 1.80A {Chaetomium thermophilum var} Back     alignment and structure
>3d2f_A Heat shock protein homolog SSE1; nucleotide exchange factor, protein folding, ATP-binding, Ca binding, chaperone, nucleotide-binding, phosphoprotein; HET: ATP; 2.30A {Saccharomyces cerevisiae} PDB: 3d2e_A* 3c7n_A* 2qxl_A* Back     alignment and structure
>1yuw_A Heat shock cognate 71 kDa protein; chaperone; 2.60A {Bos taurus} SCOP: b.130.1.1 c.55.1.1 c.55.1.1 PDB: 3c7n_B* 2v7z_A* Back     alignment and structure
>2kho_A Heat shock protein 70; molecular chaperone, HSP70, peptide binding, protein folding, acetylation, ATP-binding, cell inner membrane; NMR {Escherichia coli} Back     alignment and structure
>3i33_A Heat shock-related 70 kDa protein 2; protein-ADP complex, ATP-binding, chaperone, nucleotide-BIND phosphoprotein, stress response; HET: ADP; 1.30A {Homo sapiens} PDB: 4fsv_A* 1hx1_A 3jxu_A* 2qwl_A* 2qw9_A* 2qwm_A* 1hpm_A* 1ngi_A* 1ngj_A* 3hsc_A* 1ngb_A* 3ldq_A* 3fzf_A* 3fzk_A* 3fzl_A* 3fzm_A* 3fzh_A* 3m3z_A* 1ngh_A* 1ngd_A* ... Back     alignment and structure
>2v7y_A Chaperone protein DNAK; HSP70, heat shock protein, ATPase, domain rearrangement; HET: ADP; 2.37A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1dkg_D Molecular chaperone DNAK; HSP70, GRPE, nucleotide exchange factor, coiled-coil, complex (HSP24/HSP70); 2.80A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 Back     alignment and structure
>1jce_A ROD shape-determining protein MREB; MBL, actin, HSP-70, FTSZ, structural protein; 2.10A {Thermotoga maritima} SCOP: c.55.1.1 c.55.1.1 PDB: 1jcf_A 1jcg_A* 2wus_A Back     alignment and structure
>2fsj_A Hypothetical protein TA0583; actin homologs, archaea, ATPase, MREB, PARM, structural PROT; 1.90A {Thermoplasma acidophilum} SCOP: c.55.1.12 c.55.1.12 PDB: 2fsk_A 2fsn_A* Back     alignment and structure
>4a2a_A Cell division protein FTSA, putative; cell cycle, actin, divisome; HET: ATP; 1.80A {Thermotoga maritima} PDB: 1e4g_T* 1e4f_T* 4a2b_A* Back     alignment and structure
>3h1q_A Ethanolamine utilization protein EUTJ; ethanolamine utilization EUTJ, structural genomics, PSI-2; HET: ATP; 2.80A {Carboxydothermus hydrogenoformans z-29organism_taxid} Back     alignment and structure
>2ych_A Competence protein PILM; cell cycle, type IV pilus actin secretion; HET: ATP; 2.20A {Thermus thermophilus} Back     alignment and structure
>1k8k_A ARP3, actin-like protein 3, actin-2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 c.55.1.1 PDB: 1tyq_A* 1u2v_A* 2p9i_A* 2p9k_A* 2p9l_A 2p9n_A* 2p9p_A* 2p9s_A* 2p9u_A* 3dxk_A* 3dxm_A* 3rse_A Back     alignment and structure
>2fxu_A Alpha-actin-1, actin, alpha skeletal muscle; actin complexed to bistramide A, structural protein; HET: HIC ATP BID; 1.35A {Oryctolagus cuniculus} SCOP: c.55.1.1 c.55.1.1 PDB: 1h1v_A* 1kxp_A* 1lot_B* 1m8q_7* 1ma9_B* 1mvw_1* 1nwk_A* 1o18_1* 1o19_1* 1o1a_1* 1o1b_0* 1o1c_0* 1o1d_0* 1o1e_1* 1o1f_0* 1o1g_1* 1j6z_A* 1qz6_A* 1rdw_X* 1rfq_A* ... Back     alignment and structure
>2zgy_A Plasmid segregation protein PARM; plasmid partition, structural protein; HET: GDP; 1.90A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 PDB: 1mwk_A* 2qu4_A 1mwm_A* 2zgz_A* 2zhc_A* 3iku_A 3iky_A Back     alignment and structure
>3js6_A Uncharacterized PARM protein; partition, segregation, filament, unknown function; 1.95A {Staphylococcus aureus} Back     alignment and structure
>1k8k_B ARP2, actin-like protein 2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 PDB: 1tyq_B* 1u2v_B* 2p9i_B* 2p9l_B 2p9n_B* 2p9p_B* 2p9s_B* 2p9u_B* 3dxk_B* 3dxm_B* 3rse_B 2p9k_B* Back     alignment and structure
>2d0o_A DIOL dehydratase-reactivating factor large subunit; chaperone; HET: ADP; 2.00A {Klebsiella oxytoca} SCOP: c.8.6.1 c.55.1.6 c.55.1.6 PDB: 2d0p_A Back     alignment and structure
>1nbw_A Glycerol dehydratase reactivase alpha subunit; molecular chaperone, actin-like ATPase domain, beta/BETA/alpha swiveling domain, hydrolase; 2.40A {Klebsiella pneumoniae} SCOP: c.8.6.1 c.55.1.6 c.55.1.6 Back     alignment and structure
>3dwl_A Actin-related protein 3; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3qb0_A Actin-related protein 4; actin fold, ATP binding, nucleus, structural protein; HET: ATP; 3.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4am6_A Actin-like protein ARP8; nuclear protein, chromatin remodelling complex, ATP-binding nuclear actin-related protein; 2.70A {Saccharomyces cerevisiae} PDB: 4am7_A* Back     alignment and structure
>4apw_A ALP12; actin-like protein; 19.70A {Clostridium tetani} Back     alignment and structure
>4fo0_A Actin-related protein 8; chromatin remodeling, nucleosomes, NU gene regulation; HET: ATP; 2.60A {Homo sapiens} Back     alignment and structure
>1t6c_A Exopolyphosphatase; alpha/beta protein, actin-like fold, hydrolase; 1.53A {Aquifex aeolicus} SCOP: c.55.1.8 c.55.1.8 PDB: 1t6d_A 2j4r_A* Back     alignment and structure
>2p32_A Heat shock 70 kDa protein A; three-helix bundle, chaperone; 3.20A {Caenorhabditis elegans} Back     alignment and structure
>3lof_A Heat shock 70 kDa protein 1; structural genomics, HSPA1B, HSP70, PSI-2, prote structure initiative; 2.40A {Homo sapiens} PDB: 2lmg_A Back     alignment and structure
>1ud0_A HSC70, 70 kDa heat-shock-like protein; chaperone; 3.45A {Rattus norvegicus} SCOP: a.8.4.1 Back     alignment and structure
>4ehu_A Activator of 2-hydroxyisocaproyl-COA dehydratase; actin fold, ATPase, electron transfer, ATP/ADP binding; HET: ANP; 1.60A {Clostridium difficile} PDB: 4eht_A* 4eia_A Back     alignment and structure
>3mdq_A Exopolyphosphatase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE; 1.50A {Cytophaga hutchinsonii} Back     alignment and structure
>3hi0_A Putative exopolyphosphatase; 17739545, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>3cer_A Possible exopolyphosphatase-like protein; NESG, BLR13, Q8G5J2, X-RAY, structure, structural genomics, PSI-2; 2.40A {Bifidobacterium longum NCC2705} Back     alignment and structure
>1u6z_A Exopolyphosphatase; alpha/beta protein, askha (acetate and sugar kinases, HSC70, superfamily; 1.90A {Escherichia coli} SCOP: a.211.1.5 c.55.1.8 c.55.1.8 PDB: 2flo_A* Back     alignment and structure
>4e81_A Chaperone protein DNAK; chaperone; 1.90A {Escherichia coli} PDB: 3dpp_A* 3dpq_A* 3qnj_A 3dpo_A 1dkz_A 1dky_A 1dkx_A 1bpr_A 2bpr_A 1dg4_A Back     alignment and structure
>3cet_A Conserved archaeal protein; Q6M145, MRR63, NESG, XRAY, structure, structural genomics, PSI-2, protein structure initiative; 1.80A {Methanococcus maripaludis S2} PDB: 3c0b_A Back     alignment and structure
>3aap_A Ectonucleoside triphosphate diphosphohydrolase I; adenosine triphosphatase, ntpdase; 1.60A {Legionella pneumophila} PDB: 3aaq_A* 3aar_A* Back     alignment and structure
>1u00_A HSC66, chaperone protein HSCA; DNAK, HSP70; 1.95A {Escherichia coli} SCOP: a.8.4.1 b.130.1.1 Back     alignment and structure
>3d2f_A Heat shock protein homolog SSE1; nucleotide exchange factor, protein folding, ATP-binding, Ca binding, chaperone, nucleotide-binding, phosphoprotein; HET: ATP; 2.30A {Saccharomyces cerevisiae} PDB: 3d2e_A* 3c7n_A* 2qxl_A* Back     alignment and structure
>3cj1_A Ectonucleoside triphosphate diphosphohydrolase 2; alpha/beta protein, actin-like fold, alternative splicing, calcium, glycoprotein, magnesium; 1.70A {Rattus norvegicus} PDB: 3cj7_A* 3cj9_A* 3cja_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 182
d1dkgd1183 c.55.1.1 (D:3-185) Heat shock protein 70kDa, ATPas 4e-31
d1bupa1185 c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPas 3e-28
d1ud0a_84 a.8.4.1 (A:) DnaK {Rat (Rattus norvegicus) [TaxId: 2e-20
d1jcea1137 c.55.1.1 (A:4-140) Prokaryotic actin homolog MreB 1e-16
d2zgya2163 c.55.1.1 (A:158-320) Plasmid segregation protein P 2e-08
d1bupa2193 c.55.1.1 (A:189-381) Heat shock protein 70kDa, ATP 3e-08
d1dkgd2198 c.55.1.1 (D:186-383) Heat shock protein 70kDa, ATP 3e-08
d1jcea2196 c.55.1.1 (A:141-336) Prokaryotic actin homolog Mre 2e-06
d2fsja1161 c.55.1.12 (A:165-325) Hypothetical protein Ta0583 6e-05
d1u00a1112 a.8.4.1 (A:504-615) Chaperone protein hscA (Hsc66) 8e-04
>d1dkgd1 c.55.1.1 (D:3-185) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} Length = 183 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Actin-like ATPase domain
family: Actin/HSP70
domain: Heat shock protein 70kDa, ATPase fragment
species: Escherichia coli, gene dnaK [TaxId: 562]

 Score =  109 bits (273), Expect = 4e-31
 Identities = 51/62 (82%), Positives = 55/62 (88%)

Query: 1   MKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGVIAGLTVMRIINEPTAAAIAYGLD 60
           MK+TAE YLG+ VT AV+TVPAYFNDAQRQATKDAG IAGL V RIINEPTAAA+AYGLD
Sbjct: 121 MKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYGLD 180

Query: 61  KK 62
           K 
Sbjct: 181 KG 182
>d1bupa1 c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} Length = 185 Back     information, alignment and structure
>d1ud0a_ a.8.4.1 (A:) DnaK {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 84 Back     information, alignment and structure
>d1jcea1 c.55.1.1 (A:4-140) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]} Length = 137 Back     information, alignment and structure
>d2zgya2 c.55.1.1 (A:158-320) Plasmid segregation protein ParM {Escherichia coli [TaxId: 562]} Length = 163 Back     information, alignment and structure
>d1bupa2 c.55.1.1 (A:189-381) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} Length = 193 Back     information, alignment and structure
>d1dkgd2 c.55.1.1 (D:186-383) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} Length = 198 Back     information, alignment and structure
>d1jcea2 c.55.1.1 (A:141-336) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]} Length = 196 Back     information, alignment and structure
>d2fsja1 c.55.1.12 (A:165-325) Hypothetical protein Ta0583 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 161 Back     information, alignment and structure
>d1u00a1 a.8.4.1 (A:504-615) Chaperone protein hscA (Hsc66) {Escherichia coli [TaxId: 562]} Length = 112 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query182
d1bupa2193 Heat shock protein 70kDa, ATPase fragment {Cow (Bo 99.63
d1dkgd2198 Heat shock protein 70kDa, ATPase fragment {Escheri 99.59
d1dkgd1183 Heat shock protein 70kDa, ATPase fragment {Escheri 99.57
d1bupa1185 Heat shock protein 70kDa, ATPase fragment {Cow (Bo 99.57
d1jcea1137 Prokaryotic actin homolog MreB {Thermotoga maritim 99.43
d1jcea2196 Prokaryotic actin homolog MreB {Thermotoga maritim 98.72
d1e4ft2191 Cell division protein FtsA {Thermotoga maritima [T 98.72
d2zgya2163 Plasmid segregation protein ParM {Escherichia coli 98.55
d1ud0a_84 DnaK {Rat (Rattus norvegicus) [TaxId: 10116]} 98.24
d2fsja1161 Hypothetical protein Ta0583 {Archaeon Thermoplasma 98.24
d1t6ca2180 Exopolyphosphatase Ppx {Aquifex aeolicus [TaxId: 6 97.08
d1u6za3177 Exopolyphosphatase Ppx {Escherichia coli [TaxId: 5 96.57
d2fxua2 225 Actin {Cow (Bos taurus) [TaxId: 9913]} 95.05
d1k8ka2 258 Actin-related protein 3, Arp3 {Cow (Bos taurus) [T 94.98
d1nbwa3202 ATPase domain of the glycerol dehydratase reactiva 94.55
d2d0oa3203 Diol dehydratase-reactivating factor large subunit 94.37
d1k8kb1190 Actin-related protein 2, Arp2 {Cow (Bos taurus) [T 93.45
d1nbwa2239 ATPase domain of the glycerol dehydratase reactiva 92.05
d1q18a1110 Glucokinase Glk {Escherichia coli [TaxId: 562]} 86.89
>d1bupa2 c.55.1.1 (A:189-381) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Actin-like ATPase domain
family: Actin/HSP70
domain: Heat shock protein 70kDa, ATPase fragment
species: Cow (Bos taurus) [TaxId: 9913]

Probab=99.63  E-value=2.9e-16  Score=114.68  Aligned_cols=101  Identities=26%  Similarity=0.413  Sum_probs=82.4

Q ss_pred             CceeEEEEecCCceEEEEEEEEeCCceee----ccCCCCcchhhhcccchhhhhhch----------hhhhhHHHHHHHH
Q psy13565         64 GEKNVLVFDLGGGTFDVSLLTIDNDHRRR----KDHHGGGDRRQDQVAPFLFLQITD----------AEKTTMEEAIDDK  129 (182)
Q Consensus        64 ~~~~vlv~D~G~gt~dvsv~~~~~~~~~~----~~~~~GG~~id~~l~~~l~~~l~~----------~~~~~l~~~~~~~  129 (182)
                      .+++|||+||||||||+|++++.++.+.+    ++..+||++||+.|++++..++..          ....+|+.+++++
T Consensus         3 ~e~~VlV~D~GggT~Dvsv~~~~~~~~~v~~~~g~~~lGG~~~D~~l~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~e~~   82 (193)
T d1bupa2           3 AERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERA   82 (193)
T ss_dssp             SCEEEEEEEECSSCEEEEEEEEETTEEEEEEEEEETTCSHHHHHHHHHHHHHHHHHHHHSCCCTTCHHHHHHHHHHHHHH
T ss_pred             CCcEEEEEEeCCCeEEEEEEEEeCCEEEEEEecCCCCcchhHHHHHHHHHHHHHHHHHhCCCCccCHHHHHHHHHHHHHH
Confidence            45789999999999999999998887763    457899999999999999765532          2334688899999


Q ss_pred             HhcccccccCCc----------hhhhhcHHHHHHHHHHHHHHHhc
Q psy13565        130 IKWLDENQDADA----------PEFQKKKKELEDVVQPIIAKLYQ  164 (182)
Q Consensus       130 k~~L~~~~~~~~----------~~~~itr~el~~~i~p~l~~~~~  164 (182)
                      |+.|+.+..+..          ..+.++|++|++++.|+++++.+
T Consensus        83 K~~ls~~~~~~~~~~~~~~~~~~~~~itr~~~e~~~~~~~~~~~~  127 (193)
T d1bupa2          83 KRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLD  127 (193)
T ss_dssp             HHHHTTSSEEEEEEEEEETTEEEEEEEEHHHHHHHTHHHHHHTHH
T ss_pred             hhccCCCceEEEEEecccCCCccceEEcHHHHHHHHHHHHHHHHH
Confidence            999988776543          34579999999999999987764
>d1dkgd2 c.55.1.1 (D:186-383) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} Back     information, alignment and structure
>d1dkgd1 c.55.1.1 (D:3-185) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} Back     information, alignment and structure
>d1bupa1 c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jcea1 c.55.1.1 (A:4-140) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jcea2 c.55.1.1 (A:141-336) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e4ft2 c.55.1.1 (T:200-390) Cell division protein FtsA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2zgya2 c.55.1.1 (A:158-320) Plasmid segregation protein ParM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ud0a_ a.8.4.1 (A:) DnaK {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fsja1 c.55.1.12 (A:165-325) Hypothetical protein Ta0583 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1t6ca2 c.55.1.8 (A:133-312) Exopolyphosphatase Ppx {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1u6za3 c.55.1.8 (A:136-312) Exopolyphosphatase Ppx {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fxua2 c.55.1.1 (A:147-371) Actin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k8ka2 c.55.1.1 (A:161-418) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nbwa3 c.55.1.6 (A:406-607) ATPase domain of the glycerol dehydratase reactivase alpha subunit {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2d0oa3 c.55.1.6 (A:404-606) Diol dehydratase-reactivating factor large subunit DdrA {Klebsiella oxytoca [TaxId: 571]} Back     information, alignment and structure
>d1k8kb1 c.55.1.1 (B:154-343) Actin-related protein 2, Arp2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nbwa2 c.55.1.6 (A:2-91,A:257-405) ATPase domain of the glycerol dehydratase reactivase alpha subunit {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1q18a1 c.55.1.7 (A:2-111) Glucokinase Glk {Escherichia coli [TaxId: 562]} Back     information, alignment and structure