Psyllid ID: psy13714

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-----
MTSRDVMIKCNLKHPPGNEIYRKDSISFFEIDGRKNKNYAQNLCLLAKLFLDHKTLHYDTDPFLFYIMTEQDSRGFHIVGIRKNDKTLAAQLLLLWSSSESVYIAWIVRLPWFDPRPRVDFILNR
ccHHHHHHHcccccccccEEEEEccEEEEEEcccccHHHHHHHHHHHHHHcccEEEEEcccccEEEEEEEEcccccEEEEEEEcHHHHHHHHHHHcccccccEEEEEEEcccccccccEEEEEcc
cccHHHHHcccccccccEEEEEcccEEEEEEEHHHcHHHHHHHHHHHHccccccccccccccEEEEEEEEEEccEEEEEEEEEEEcccccEHHHHHHcHccccEEEEEEccHHHHccccEEEEcc
MTSRDVMIkcnlkhppgneiyrkdsisffeidgrknkNYAQNLCLLAKLFLdhktlhydtdpfLFYIMTEqdsrgfhivgIRKNDKTLAAQLLLLWSSSESVYIAWIVrlpwfdprprvdfilnr
mtsrdvmikcnlkhppgneiyrkDSISFFEIDGRKNKNYAQNLCLLAKLFLDHKTLHYDTDPFLFYIMTEQDSRGFHIVGIRKNDKTLAAQLLLLWSSSESVYIAWIVrlpwfdprprvdfilnr
MTSRDVMIKCNLKHPPGNEIYRKDSISFFEIDGRKNKNYAQNLCLLAKLFLDHKTLHYDTDPFLFYIMTEQDSRGFHIVGIRKNDKTLAAQllllwsssesVYIAWIVRLPWFDPRPRVDFILNR
*******IKCNLKH*PGNEIYRKDSISFFEIDGRKNKNYAQNLCLLAKLFLDHKTLHYDTDPFLFYIMTEQDSRGFHIVGIRKNDKTLAAQLLLLWSSSESVYIAWIVRLPWFDPRPRVDFIL**
**SRDVMIKCNLKHPPGNEIYRKDSISFFEIDGRKNKNYAQNLCLLAKLFLDHKTLHYDTDPFLFYIMTEQDSRGFHIVGIRKNDKTLAAQLLLLWSSSESVYIAWIVRLPWFDPRPRVDFILNR
MTSRDVMIKCNLKHPPGNEIYRKDSISFFEIDGRKNKNYAQNLCLLAKLFLDHKTLHYDTDPFLFYIMTEQDSRGFHIVGIRKNDKTLAAQLLLLWSSSESVYIAWIVRLPWFDPRPRVDFILNR
******MIKCNLKHPPGNEIYRKDSISFFEIDGRKNKNYAQNLCLLAKLFLDHKTLHYDTDPFLFYIMTEQDSRGFHIVGIRKNDKTLAAQLLLLWSSSESVYIAWIVRLPWFDPRPRVDFILNR
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTSRDVMIKCNLKHPPGNEIYRKDSISFFEIDGRKNKNYAQNLCLLAKLFLDHKTLHYDTDPFLFYIMTEQDSRGFHIVGIRKNDKTLAAQLLLLWSSSESVYIAWIVRLPWFDPRPRVDFILNR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query125 2.2.26 [Sep-21-2011]
Q960X4 541 Histone acetyltransferase yes N/A 0.776 0.179 0.663 6e-35
Q92993 513 Histone acetyltransferase yes N/A 0.8 0.194 0.618 4e-34
Q99MK2 513 Histone acetyltransferase yes N/A 0.8 0.194 0.618 4e-34
Q8CHK4 513 Histone acetyltransferase no N/A 0.8 0.194 0.618 4e-34
Q5RBG4 461 Histone acetyltransferase yes N/A 0.8 0.216 0.618 5e-34
Q9TYU5 458 Histone acetyltransferase yes N/A 0.8 0.218 0.590 4e-32
Q810T5 612 Histone acetyltransferase no N/A 0.616 0.125 0.714 2e-28
Q5SVQ0 613 Histone acetyltransferase no N/A 0.616 0.125 0.714 2e-28
O95251 611 Histone acetyltransferase no N/A 0.616 0.126 0.714 2e-28
Q9FLF7 445 Probable MYST-like histon yes N/A 0.856 0.240 0.521 5e-28
>sp|Q960X4|TIP60_DROME Histone acetyltransferase Tip60 OS=Drosophila melanogaster GN=Tip60 PE=1 SV=1 Back     alignment and function desciption
 Score =  145 bits (366), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 82/107 (76%), Gaps = 10/107 (9%)

Query: 7   MIKCNLKHPPGNEIYRKDSISFFEIDGRKNKNYAQNLCLLAKLFLDHKTLHYDTDPFLFY 66
           + KCNL+HPPGNEIYRK +ISFFEIDGRKNK YAQNLCLLAKLFLDHKTL+YDTDPFLFY
Sbjct: 308 LSKCNLRHPPGNEIYRKHTISFFEIDGRKNKVYAQNLCLLAKLFLDHKTLYYDTDPFLFY 367

Query: 67  IMTEQDSRGFHIVGIRKNDKTLAAQLLLLWSSSESVYIAWIVRLPWF 113
           +MTE DSRGFHIVG    +K           S+E   +A I+ +P +
Sbjct: 368 VMTEFDSRGFHIVGYFSKEK----------ESTEDYNVACILTMPPY 404
Catalytic subunit of the Tip60 chromatin-remodeling complex which is involved in DNA repair. Upon induction of DNA double-strand breaks, acetylates phosphorylated histone H2AV in nucleosomes on 'Lys-4' and exchanges it with unmodified H2AV.
Drosophila melanogaster (taxid: 7227)
EC: 2EC: .EC: 3EC: .EC: 1EC: .EC: 4EC: 8
>sp|Q92993|KAT5_HUMAN Histone acetyltransferase KAT5 OS=Homo sapiens GN=KAT5 PE=1 SV=2 Back     alignment and function description
>sp|Q99MK2|KAT5_RAT Histone acetyltransferase KAT5 OS=Rattus norvegicus GN=Kat5 PE=1 SV=2 Back     alignment and function description
>sp|Q8CHK4|KAT5_MOUSE Histone acetyltransferase KAT5 OS=Mus musculus GN=Kat5 PE=1 SV=2 Back     alignment and function description
>sp|Q5RBG4|KAT5_PONAB Histone acetyltransferase KAT5 OS=Pongo abelii GN=KAT5 PE=2 SV=1 Back     alignment and function description
>sp|Q9TYU5|TIP60_CAEEL Histone acetyltransferase Tip60 homolog OS=Caenorhabditis elegans GN=mys-1 PE=2 SV=1 Back     alignment and function description
>sp|Q810T5|KAT7_RAT Histone acetyltransferase KAT7 OS=Rattus norvegicus GN=Kat7 PE=2 SV=1 Back     alignment and function description
>sp|Q5SVQ0|KAT7_MOUSE Histone acetyltransferase KAT7 OS=Mus musculus GN=Kat7 PE=2 SV=1 Back     alignment and function description
>sp|O95251|KAT7_HUMAN Histone acetyltransferase KAT7 OS=Homo sapiens GN=KAT7 PE=1 SV=1 Back     alignment and function description
>sp|Q9FLF7|MYST1_ARATH Probable MYST-like histone acetyltransferase 1 OS=Arabidopsis thaliana GN=HAG4 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query125
307207184 453 Histone acetyltransferase HTATIP [Harpeg 0.8 0.220 0.681 1e-35
307171299 455 Histone acetyltransferase HTATIP [Campon 0.8 0.219 0.690 3e-35
156537355 457 PREDICTED: histone acetyltransferase Tip 0.776 0.212 0.682 5e-35
332019221 453 Histone acetyltransferase Tip60 [Acromyr 0.8 0.220 0.672 7e-35
242010451 468 histone acetyltransferase Tip60, putativ 0.776 0.207 0.672 9e-35
324506834 466 Histone acetyltransferase Tip60 [Ascaris 0.824 0.221 0.654 1e-34
312084866 449 histone acetyltransferase [Loa loa] 0.8 0.222 0.654 2e-34
322789367 419 hypothetical protein SINV_13509 [Solenop 0.8 0.238 0.663 2e-34
402582349 395 hypothetical protein WUBG_12796, partial 0.8 0.253 0.654 2e-34
393906841 467 histone acetyltransferase [Loa loa] 0.8 0.214 0.654 2e-34
>gi|307207184|gb|EFN84974.1| Histone acetyltransferase HTATIP [Harpegnathos saltator] Back     alignment and taxonomy information
 Score =  153 bits (386), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 85/110 (77%), Gaps = 10/110 (9%)

Query: 7   MIKCNLKHPPGNEIYRKDSISFFEIDGRKNKNYAQNLCLLAKLFLDHKTLHYDTDPFLFY 66
           ++KCNL+HPPGNEIYRK SISFFEIDGRKNKNYAQNLCLLAKLFLDHKTLHYDTDPFLFY
Sbjct: 219 LVKCNLRHPPGNEIYRKGSISFFEIDGRKNKNYAQNLCLLAKLFLDHKTLHYDTDPFLFY 278

Query: 67  IMTEQDSRGFHIVGIRKNDKTLAAQLLLLWSSSESVYIAWIVRLPWFDPR 116
           +MT+ DSRGFHIVG    +K           S+E   +A I+ LP +  R
Sbjct: 279 VMTDFDSRGFHIVGYFSKEK----------ESTEDHNVACILTLPPYQRR 318

Source: Harpegnathos saltator

Species: Harpegnathos saltator

Genus: Harpegnathos

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|307171299|gb|EFN63224.1| Histone acetyltransferase HTATIP [Camponotus floridanus] Back     alignment and taxonomy information
>gi|156537355|ref|XP_001606507.1| PREDICTED: histone acetyltransferase Tip60-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|332019221|gb|EGI59731.1| Histone acetyltransferase Tip60 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|242010451|ref|XP_002425981.1| histone acetyltransferase Tip60, putative [Pediculus humanus corporis] gi|212509972|gb|EEB13243.1| histone acetyltransferase Tip60, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|324506834|gb|ADY42906.1| Histone acetyltransferase Tip60 [Ascaris suum] Back     alignment and taxonomy information
>gi|312084866|ref|XP_003144450.1| histone acetyltransferase [Loa loa] Back     alignment and taxonomy information
>gi|322789367|gb|EFZ14679.1| hypothetical protein SINV_13509 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|402582349|gb|EJW76295.1| hypothetical protein WUBG_12796, partial [Wuchereria bancrofti] Back     alignment and taxonomy information
>gi|393906841|gb|EFO19620.2| histone acetyltransferase [Loa loa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query125
FB|FBgn0026080 541 Tip60 "Tip60" [Drosophila mela 0.624 0.144 0.846 4.8e-33
ZFIN|ZDB-GENE-030131-985 538 htatip "HIV-1 tat interactive 0.64 0.148 0.787 3e-32
UNIPROTKB|E2RE53 461 KAT5 "Uncharacterized protein" 0.64 0.173 0.762 9.8e-32
UNIPROTKB|E9PJI1 302 KAT5 "Histone acetyltransferas 0.64 0.264 0.762 9.8e-32
UNIPROTKB|Q5RBG4 461 KAT5 "Histone acetyltransferas 0.64 0.173 0.762 9.8e-32
ZFIN|ZDB-GENE-040718-57 541 zgc:92510 "zgc:92510" [Danio r 0.64 0.147 0.775 1.2e-31
UNIPROTKB|E1BMS5 513 KAT5 "Uncharacterized protein" 0.64 0.155 0.762 1.2e-31
UNIPROTKB|Q92993 513 KAT5 "Histone acetyltransferas 0.64 0.155 0.762 1.2e-31
UNIPROTKB|F1RRK4 513 KAT5 "Uncharacterized protein" 0.64 0.155 0.762 1.2e-31
MGI|MGI:1932051 513 Kat5 "K(lysine) acetyltransfer 0.64 0.155 0.762 1.2e-31
FB|FBgn0026080 Tip60 "Tip60" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 362 (132.5 bits), Expect = 4.8e-33, P = 4.8e-33
 Identities = 66/78 (84%), Positives = 71/78 (91%)

Query:     9 KCNLKHPPGNEIYRKDSISFFEIDGRKNKNYAQNLCLLAKLFLDHKTLHYDTDPFLFYIM 68
             KCNL+HPPGNEIYRK +ISFFEIDGRKNK YAQNLCLLAKLFLDHKTL+YDTDPFLFY+M
Sbjct:   310 KCNLRHPPGNEIYRKHTISFFEIDGRKNKVYAQNLCLLAKLFLDHKTLYYDTDPFLFYVM 369

Query:    69 TEQDSRGFHIVGIRKNDK 86
             TE DSRGFHIVG    +K
Sbjct:   370 TEFDSRGFHIVGYFSKEK 387
GO:0004402 "histone acetyltransferase activity" evidence=ISS;IMP
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0016573 "histone acetylation" evidence=IDA
GO:0000123 "histone acetyltransferase complex" evidence=IPI
GO:0005634 "nucleus" evidence=IDA
GO:0043486 "histone exchange" evidence=IDA
GO:0006974 "response to DNA damage stimulus" evidence=IMP
GO:0005705 "polytene chromosome interband" evidence=IDA
GO:0007399 "nervous system development" evidence=IMP
GO:0043967 "histone H4 acetylation" evidence=IMP
GO:0048167 "regulation of synaptic plasticity" evidence=IDA
GO:2000331 "regulation of terminal button organization" evidence=IDA
ZFIN|ZDB-GENE-030131-985 htatip "HIV-1 tat interactive protein, homolog (human)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E2RE53 KAT5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E9PJI1 KAT5 "Histone acetyltransferase KAT5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5RBG4 KAT5 "Histone acetyltransferase KAT5" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040718-57 zgc:92510 "zgc:92510" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1BMS5 KAT5 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q92993 KAT5 "Histone acetyltransferase KAT5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RRK4 KAT5 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1932051 Kat5 "K(lysine) acetyltransferase 5" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6FPH9ESA1_CANGA2, ., 3, ., 1, ., 4, 80.54280.760.2130yesN/A
Q2UMQ5ESA1_ASPOR2, ., 3, ., 1, ., 4, 80.53330.760.1877yesN/A
Q75BY2ESA1_ASHGO2, ., 3, ., 1, ., 4, 80.54280.760.2183yesN/A
O94446ESA1_SCHPO2, ., 3, ., 1, ., 4, 80.54280.760.2051yesN/A
Q08649ESA1_YEAST2, ., 3, ., 1, ., 4, 80.54280.760.2134yesN/A
Q9FLF7MYST1_ARATH2, ., 3, ., 1, ., 4, 80.52130.8560.2404yesN/A
Q5RBG4KAT5_PONAB2, ., 3, ., 1, ., 4, 80.61810.80.2169yesN/A
Q960X4TIP60_DROME2, ., 3, ., 1, ., 4, 80.66350.7760.1792yesN/A
Q9TYU5TIP60_CAEEL2, ., 3, ., 1, ., 4, 80.59090.80.2183yesN/A
Q8LI34MYST1_ORYSJ2, ., 3, ., 1, ., 4, 80.51280.8560.2377yesN/A
Q92993KAT5_HUMAN2, ., 3, ., 1, ., 4, 80.61810.80.1949yesN/A
Q99MK2KAT5_RAT2, ., 3, ., 1, ., 4, 80.61810.80.1949yesN/A
Q6CKE9ESA1_KLULA2, ., 3, ., 1, ., 4, 80.55230.760.2164yesN/A
Q6C710ESA1_YARLI2, ., 3, ., 1, ., 4, 80.53330.760.2025yesN/A
Q4WHG1ESA1_ASPFU2, ., 3, ., 1, ., 4, 80.52770.7840.2028yesN/A
Q6BU95ESA1_DEBHA2, ., 3, ., 1, ., 4, 80.53330.760.1823yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.3.1LOW CONFIDENCE prediction!
3rd Layer2.3.1.48LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query125
pfam01853189 pfam01853, MOZ_SAS, MOZ/SAS family 2e-44
PLN00104 450 PLN00104, PLN00104, MYST -like histone acetyltrans 3e-43
COG5027395 COG5027, SAS2, Histone acetyltransferase (MYST fam 2e-36
PLN03238 290 PLN03238, PLN03238, probable histone acetyltransfe 2e-35
PTZ00064 552 PTZ00064, PTZ00064, histone acetyltransferase; Pro 4e-34
PLN03239 351 PLN03239, PLN03239, histone acetyltransferase; Pro 1e-30
>gnl|CDD|216741 pfam01853, MOZ_SAS, MOZ/SAS family Back     alignment and domain information 
 Score =  142 bits (360), Expect = 2e-44
 Identities = 54/69 (78%), Positives = 59/69 (85%)

Query: 12 LKHPPGNEIYRKDSISFFEIDGRKNKNYAQNLCLLAKLFLDHKTLHYDTDPFLFYIMTEQ 71
          L+HPPGNEIYRK +IS FE+DGRK K Y QNLCLLAKLFLDHKTL+YD DPFLFYI+TE 
Sbjct: 1  LRHPPGNEIYRKGNISVFEVDGRKQKLYCQNLCLLAKLFLDHKTLYYDVDPFLFYILTET 60

Query: 72 DSRGFHIVG 80
          D  G HIVG
Sbjct: 61 DETGCHIVG 69

This region of these proteins has been suggested to be homologous to acetyltransferases. Length = 189
>gnl|CDD|215056 PLN00104, PLN00104, MYST -like histone acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|227360 COG5027, SAS2, Histone acetyltransferase (MYST family) [Chromatin structure and dynamics] Back     alignment and domain information
>gnl|CDD|215642 PLN03238, PLN03238, probable histone acetyltransferase MYST; Provisional Back     alignment and domain information
>gnl|CDD|173359 PTZ00064, PTZ00064, histone acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|178777 PLN03239, PLN03239, histone acetyltransferase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 125
KOG2747|consensus 396 100.0
PLN03238 290 probable histone acetyltransferase MYST; Provision 100.0
PF01853188 MOZ_SAS: MOZ/SAS family; InterPro: IPR002717 Moz i 100.0
PTZ00064 552 histone acetyltransferase; Provisional 100.0
PLN00104 450 MYST -like histone acetyltransferase; Provisional 100.0
PLN03239 351 histone acetyltransferase; Provisional 100.0
COG5027 395 SAS2 Histone acetyltransferase (MYST family) [Chro 100.0
PF1350879 Acetyltransf_7: Acetyltransferase (GNAT) domain; P 97.56
PF13673117 Acetyltransf_10: Acetyltransferase (GNAT) domain; 97.53
PRK10146144 aminoalkylphosphonic acid N-acetyltransferase; Pro 97.31
PRK07757152 acetyltransferase; Provisional 97.2
PRK09831147 putative acyltransferase; Provisional 97.03
TIGR01575131 rimI ribosomal-protein-alanine acetyltransferase. 96.9
PRK13688156 hypothetical protein; Provisional 96.85
TIGR03827266 GNAT_ablB putative beta-lysine N-acetyltransferase 96.85
PRK03624140 putative acetyltransferase; Provisional 96.8
PRK10975194 TDP-fucosamine acetyltransferase; Provisional 96.79
TIGR02382191 wecD_rffC TDP-D-fucosamine acetyltransferase. This 96.76
cd0430165 NAT_SF N-Acyltransferase superfamily: Various enzy 96.75
PRK10514145 putative acetyltransferase; Provisional 96.69
PRK10314153 putative acyltransferase; Provisional 96.68
PRK07922169 N-acetylglutamate synthase; Validated 96.63
PRK12308614 bifunctional argininosuccinate lyase/N-acetylgluta 96.62
PF0058383 Acetyltransf_1: Acetyltransferase (GNAT) family; I 96.61
TIGR03448 292 mycothiol_MshD mycothiol biosynthesis acetyltransf 96.6
PHA01807153 hypothetical protein 96.54
PLN02825515 amino-acid N-acetyltransferase 96.46
PLN02706150 glucosamine 6-phosphate N-acetyltransferase 96.26
PRK05279441 N-acetylglutamate synthase; Validated 96.25
PRK10140162 putative acetyltransferase YhhY; Provisional 96.23
PRK10562145 putative acetyltransferase; Provisional 96.15
TIGR01890429 N-Ac-Glu-synth amino-acid N-acetyltransferase. Thi 96.06
COG0456177 RimI Acetyltransferases [General function predicti 96.01
PTZ00330147 acetyltransferase; Provisional 95.83
KOG2696|consensus 403 95.77
TIGR02406157 ectoine_EctA L-2,4-diaminobutyric acid acetyltrans 95.76
TIGR00124 332 cit_ly_ligase [citrate (pro-3S)-lyase] ligase. ATP 95.76
COG0454156 WecD Histone acetyltransferase HPA2 and related ac 95.72
PF0844586 FR47: FR47-like protein; InterPro: IPR013653 Prote 95.6
PRK09491146 rimI ribosomal-protein-alanine N-acetyltransferase 95.39
PF13420155 Acetyltransf_4: Acetyltransferase (GNAT) domain; P 95.36
TIGR03448292 mycothiol_MshD mycothiol biosynthesis acetyltransf 95.24
PF13527127 Acetyltransf_9: Acetyltransferase (GNAT) domain; P 95.14
KOG3216|consensus163 94.88
COG3153171 Predicted acetyltransferase [General function pred 94.53
cd02169 297 Citrate_lyase_ligase Citrate lyase ligase. Citrate 94.12
TIGR03103 547 trio_acet_GNAT GNAT-family acetyltransferase TIGR0 94.07
PRK01346 411 hypothetical protein; Provisional 93.93
COG1246153 ArgA N-acetylglutamate synthase and related acetyl 93.19
PRK10151179 ribosomal-protein-L7/L12-serine acetyltransferase; 92.73
COG1247169 Sortase and related acyltransferases [Cell envelop 92.68
PF13302142 Acetyltransf_3: Acetyltransferase (GNAT) domain; P 92.6
PF13718196 GNAT_acetyltr_2: GNAT acetyltransferase 2; PDB: 2Z 91.98
TIGR01686320 FkbH FkbH-like domain. The C-terminal portion of t 91.73
PHA00673154 acetyltransferase domain containing protein 91.21
PF13523152 Acetyltransf_8: Acetyltransferase (GNAT) domain; P 91.1
PRK15130186 spermidine N1-acetyltransferase; Provisional 90.23
KOG2488|consensus202 90.02
COG238899 Predicted acetyltransferase [General function pred 87.89
TIGR03585156 PseH pseudaminic acid biosynthesis N-acetyl transf 87.45
KOG3396|consensus150 86.39
PF1454278 Acetyltransf_CG: GCN5-related N-acetyl-transferase 86.1
KOG3139|consensus165 84.65
PRK10809194 ribosomal-protein-S5-alanine N-acetyltransferase; 84.06
PF0844489 Gly_acyl_tr_C: Aralkyl acyl-CoA:amino acid N-acylt 82.15
>KOG2747|consensus Back     alignment and domain information 
Probab=100.00  E-value=8.2e-64  Score=425.22  Aligned_cols=112  Identities=55%  Similarity=0.920  Sum_probs=109.3

Q ss_pred             chHHHHhhCCccCCCcceEEecCCeEEEEEeCCCChhhhhhhhHhhhhcccceeeeeeCCCceEEEEEEeCCCCcEEEEE
Q psy13714          2 TSRDVMIKCNLKHPPGNEIYRKDSISFFEIDGRKNKNYAQNLCLLAKLFLDHKTLHYDTDPFLFYIMTEQDSRGFHIVGI   81 (125)
Q Consensus         2 t~~~H~~~C~~~~PPG~eiYr~~~~si~EVdG~~~~~ycqnLcLlaKlFLd~Ktl~~dv~~F~FYVl~e~D~~G~h~vGy   81 (125)
                      .|+||+.+|.++||||+||||+++||||||||+++++|||||||||||||||||||||||||+||||||.|+.|+  |||
T Consensus       173 ~l~rH~~kC~~rhPPG~EIYR~~~iSvfEVDG~~~k~YCQnLCLlaKLFLdhKTLYyDvdpFlFYVlte~d~~G~--VGY  250 (396)
T KOG2747|consen  173 SLQRHLKKCKLRHPPGNEIYRKGNISVFEVDGRKQKLYCQNLCLLAKLFLDHKTLYYDVDPFLFYVLTECDSYGC--VGY  250 (396)
T ss_pred             HHHHHHHhcCCCCCCcceeeecCCEEEEEecCcchhHHHHHHHHHHHHHhcCceeEEeccceEEEEEEecCCcce--eee
Confidence            478999999999999999999999999999999999999999999999999999999999999999999999996  999


Q ss_pred             EecchhhHHHHhhhhcCCCceeeEEEEEcCCCCCCCcccccccC
Q psy13714         82 RKNDKTLAAQLLLLWSSSESVYIAWIVRLPWFDPRPRVDFILNR  125 (125)
Q Consensus        82 FSkEk~~~~~~~~~~ss~~~~nLacI~vLP~yQ~kGyG~~LI~~  125 (125)
                      |||||+          |.++||||||+|||+|||||||++||+.
T Consensus       251 FSKEK~----------s~~~yNlaCILtLPpyQRkGYGklLIdF  284 (396)
T KOG2747|consen  251 FSKEKE----------SSENYNLACILTLPPYQRKGYGKLLIDF  284 (396)
T ss_pred             eccccc----------cccccceeeeeecChhhhcccchhhhhh
Confidence            999999          8999999999999999999999999984

>PLN03238 probable histone acetyltransferase MYST; Provisional Back     alignment and domain information
>PF01853 MOZ_SAS: MOZ/SAS family; InterPro: IPR002717 Moz is a monocytic leukemia Zn_finger protein and the SAS protein from Saccharomyces cerevisiae (Baker's yeast) is involved in silencing the Hmr locus Back     alignment and domain information
>PTZ00064 histone acetyltransferase; Provisional Back     alignment and domain information
>PLN00104 MYST -like histone acetyltransferase; Provisional Back     alignment and domain information
>PLN03239 histone acetyltransferase; Provisional Back     alignment and domain information
>COG5027 SAS2 Histone acetyltransferase (MYST family) [Chromatin structure and dynamics] Back     alignment and domain information
>PF13508 Acetyltransf_7: Acetyltransferase (GNAT) domain; PDB: 3EY5_A 3FRM_B 3D8P_B 3GY9_A 3GYA_A 3S6F_A 2Q7B_A 1CM0_B 1XEB_B 1Y7R_A Back     alignment and domain information
>PF13673 Acetyltransf_10: Acetyltransferase (GNAT) domain; PDB: 2FIW_A 1BOB_A 3FNC_B 3EXN_A Back     alignment and domain information
>PRK10146 aminoalkylphosphonic acid N-acetyltransferase; Provisional Back     alignment and domain information
>PRK07757 acetyltransferase; Provisional Back     alignment and domain information
>PRK09831 putative acyltransferase; Provisional Back     alignment and domain information
>TIGR01575 rimI ribosomal-protein-alanine acetyltransferase Back     alignment and domain information
>PRK13688 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03827 GNAT_ablB putative beta-lysine N-acetyltransferase Back     alignment and domain information
>PRK03624 putative acetyltransferase; Provisional Back     alignment and domain information
>PRK10975 TDP-fucosamine acetyltransferase; Provisional Back     alignment and domain information
>TIGR02382 wecD_rffC TDP-D-fucosamine acetyltransferase Back     alignment and domain information
>cd04301 NAT_SF N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate Back     alignment and domain information
>PRK10514 putative acetyltransferase; Provisional Back     alignment and domain information
>PRK10314 putative acyltransferase; Provisional Back     alignment and domain information
>PRK07922 N-acetylglutamate synthase; Validated Back     alignment and domain information
>PRK12308 bifunctional argininosuccinate lyase/N-acetylglutamate synthase; Provisional Back     alignment and domain information
>PF00583 Acetyltransf_1: Acetyltransferase (GNAT) family; InterPro: IPR000182 The N-acetyltransferases (NAT) (EC 2 Back     alignment and domain information
>TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase Back     alignment and domain information
>PHA01807 hypothetical protein Back     alignment and domain information
>PLN02825 amino-acid N-acetyltransferase Back     alignment and domain information
>PLN02706 glucosamine 6-phosphate N-acetyltransferase Back     alignment and domain information
>PRK05279 N-acetylglutamate synthase; Validated Back     alignment and domain information
>PRK10140 putative acetyltransferase YhhY; Provisional Back     alignment and domain information
>PRK10562 putative acetyltransferase; Provisional Back     alignment and domain information
>TIGR01890 N-Ac-Glu-synth amino-acid N-acetyltransferase Back     alignment and domain information
>COG0456 RimI Acetyltransferases [General function prediction only] Back     alignment and domain information
>PTZ00330 acetyltransferase; Provisional Back     alignment and domain information
>KOG2696|consensus Back     alignment and domain information
>TIGR02406 ectoine_EctA L-2,4-diaminobutyric acid acetyltransferase Back     alignment and domain information
>TIGR00124 cit_ly_ligase [citrate (pro-3S)-lyase] ligase Back     alignment and domain information
>COG0454 WecD Histone acetyltransferase HPA2 and related acetyltransferases [Transcription / General function prediction only] Back     alignment and domain information
>PF08445 FR47: FR47-like protein; InterPro: IPR013653 Proteins in this entry have a conserved region similar to the C-terminal region of the Drosophila melanogaster (Fruit fly) hypothetical protein FR47 (Q9VR51 from SWISSPROT) Back     alignment and domain information
>PRK09491 rimI ribosomal-protein-alanine N-acetyltransferase; Provisional Back     alignment and domain information
>PF13420 Acetyltransf_4: Acetyltransferase (GNAT) domain; PDB: 3DR8_A 3DR6_A 2AE6_B 2JLM_C 2J8R_A 1YVO_B 2J8M_A 2J8N_A 2BL1_A 3IWG_A Back     alignment and domain information
>TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase Back     alignment and domain information
>PF13527 Acetyltransf_9: Acetyltransferase (GNAT) domain; PDB: 3SXN_C 2I00_D 1M4D_B 1M44_A 1M4G_B 1M4I_A 2OZG_A 2HV2_F 3N7Z_A 3RYO_B Back     alignment and domain information
>KOG3216|consensus Back     alignment and domain information
>COG3153 Predicted acetyltransferase [General function prediction only] Back     alignment and domain information
>cd02169 Citrate_lyase_ligase Citrate lyase ligase Back     alignment and domain information
>TIGR03103 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103 Back     alignment and domain information
>PRK01346 hypothetical protein; Provisional Back     alignment and domain information
>COG1246 ArgA N-acetylglutamate synthase and related acetyltransferases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10151 ribosomal-protein-L7/L12-serine acetyltransferase; Provisional Back     alignment and domain information
>COG1247 Sortase and related acyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF13302 Acetyltransf_3: Acetyltransferase (GNAT) domain; PDB: 3TTH_C 3JUW_A 2ZXV_A 2Z0Z_A 2VI7_B 3EG7_F 1YRE_C 3IGR_B 3FBU_A 2FCK_A Back     alignment and domain information
>PF13718 GNAT_acetyltr_2: GNAT acetyltransferase 2; PDB: 2ZPA_B Back     alignment and domain information
>TIGR01686 FkbH FkbH-like domain Back     alignment and domain information
>PHA00673 acetyltransferase domain containing protein Back     alignment and domain information
>PF13523 Acetyltransf_8: Acetyltransferase (GNAT) domain; PDB: 2VQY_A 2BUE_A 1V0C_A 1YK3_D 2PR8_A 2QIR_A 2PRB_A 2QML_A 2PC1_A Back     alignment and domain information
>PRK15130 spermidine N1-acetyltransferase; Provisional Back     alignment and domain information
>KOG2488|consensus Back     alignment and domain information
>COG2388 Predicted acetyltransferase [General function prediction only] Back     alignment and domain information
>TIGR03585 PseH pseudaminic acid biosynthesis N-acetyl transferase Back     alignment and domain information
>KOG3396|consensus Back     alignment and domain information
>PF14542 Acetyltransf_CG: GCN5-related N-acetyl-transferase; PDB: 2H5M_A 2Q44_A 1XMT_A 2Q4Y_A 2IL4_A 2EVN_A 1R57_A Back     alignment and domain information
>KOG3139|consensus Back     alignment and domain information
>PRK10809 ribosomal-protein-S5-alanine N-acetyltransferase; Provisional Back     alignment and domain information
>PF08444 Gly_acyl_tr_C: Aralkyl acyl-CoA:amino acid N-acyltransferase, C-terminal region; InterPro: IPR013652 This entry represents mammalian-specific glycine N-acyltransferase (also called aralkyl acyl-CoA:amino acid N-acyltransferase; 2 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query125
2ou2_A 280 Acetyltransferase Domain Of Human Hiv-1 Tat Interac 3e-33
1mj9_A 278 Crystal Structure Of Yeast Esa1(C304s) Mutant Compl 4e-28
1mja_A 278 Crystal Structure Of Yeast Esa1 Histone Acetyltrans 4e-28
1mjb_A 278 Crystal Structure Of Yeast Esa1 Histone Acetyltrans 5e-28
1fy7_A 278 Crystal Structure Of Yeast Esa1 Histone Acetyltrans 5e-28
3to9_A 276 Crystal Structure Of Yeast Esa1 E338q Hat Domain Bo 2e-27
3to6_A 276 Crystal Structure Of Yeast Esa1 Hat Domain Complexe 2e-27
2rc4_A 287 Crystal Structure Of The Hat Domain Of The Human Mo 2e-25
2ozu_A 284 Crystal Structure Of Human Myst Histone Acetyltrans 8e-25
4dnc_A 289 Crystal Structure Of Human Mof In Complex With Msl1 4e-24
2y0m_A 287 Crystal Structure Of The Complex Between Dosage Com 4e-24
3qah_A 304 Crystal Structure Of Apo-Form Human Mof Catalytic D 4e-24
2pq8_A 278 Myst Histone Acetyltransferase 1 Length = 278 8e-24
2giv_A 295 Human Myst Histone Acetyltransferase 1 Length = 295 1e-23
3tob_A270 Human Mof E350q Crystal Structure With Active Site 2e-23
3toa_A266 Human Mof Crystal Structure With Active Site Lysine 2e-23
>pdb|2OU2|A Chain A, Acetyltransferase Domain Of Human Hiv-1 Tat Interacting Protein, 60kda, Isoform 3 Length = 280 Back     alignment and structure 
Iteration: 1

 Score =  136 bits (343), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 70/80 (87%)
Query: 7   MIKCNLKHPPGNEIYRKDSISFFEIDGRKNKNYAQNLCLLAKLFLDHKTLHYDTDPFLFY 66
           + KC+L+HPPGNEIYRK +ISFFEIDGRKNK+Y+QNLCLLAK FLDH TL+YDTDPFLFY
Sbjct: 54  LTKCDLRHPPGNEIYRKGTISFFEIDGRKNKSYSQNLCLLAKCFLDHXTLYYDTDPFLFY 113
Query: 67  IMTEQDSRGFHIVGIRKNDK 86
           +MTE D +GFHIVG    +K
Sbjct: 114 VMTEYDCKGFHIVGYFSKEK 133
>pdb|1MJ9|A Chain A, Crystal Structure Of Yeast Esa1(C304s) Mutant Complexed With Coenzyme A Length = 278 Back     alignment and structure
>pdb|1MJA|A Chain A, Crystal Structure Of Yeast Esa1 Histone Acetyltransferase Domain Complexed With Acetyl Coenzyme A Length = 278 Back     alignment and structure
>pdb|1MJB|A Chain A, Crystal Structure Of Yeast Esa1 Histone Acetyltransferase E338q Mutant Complexed With Acetyl Coenzyme A Length = 278 Back     alignment and structure
>pdb|1FY7|A Chain A, Crystal Structure Of Yeast Esa1 Histone Acetyltransferase Domain Complexed With Coenzyme A Length = 278 Back     alignment and structure
>pdb|3TO9|A Chain A, Crystal Structure Of Yeast Esa1 E338q Hat Domain Bound To Coenzyme A With Active Site Lysine Acetylated Length = 276 Back     alignment and structure
>pdb|3TO6|A Chain A, Crystal Structure Of Yeast Esa1 Hat Domain Complexed With H4k16coa Bisubstrate Inhibitor Length = 276 Back     alignment and structure
>pdb|2RC4|A Chain A, Crystal Structure Of The Hat Domain Of The Human Moz Protein Length = 287 Back     alignment and structure
>pdb|2OZU|A Chain A, Crystal Structure Of Human Myst Histone Acetyltransferase 3 In Complex With Acetylcoenzyme A Length = 284 Back     alignment and structure
>pdb|4DNC|A Chain A, Crystal Structure Of Human Mof In Complex With Msl1 Length = 289 Back     alignment and structure
>pdb|2Y0M|A Chain A, Crystal Structure Of The Complex Between Dosage Compensation Factors Msl1 And Mof Length = 287 Back     alignment and structure
>pdb|3QAH|A Chain A, Crystal Structure Of Apo-Form Human Mof Catalytic Domain Length = 304 Back     alignment and structure
>pdb|2PQ8|A Chain A, Myst Histone Acetyltransferase 1 Length = 278 Back     alignment and structure
>pdb|2GIV|A Chain A, Human Myst Histone Acetyltransferase 1 Length = 295 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query125
2ou2_A 280 Histone acetyltransferase htatip; structural genom 1e-39
2pq8_A 278 Probable histone acetyltransferase MYST1; MOF, str 1e-38
2ozu_A 284 Histone acetyltransferase MYST3; structural genomi 4e-37
3to7_A 276 Histone acetyltransferase ESA1; MYST family; HET: 9e-37
>2ou2_A Histone acetyltransferase htatip; structural genomics, structural genomics consortium, SGC; HET: ALY ACO; 2.30A {Homo sapiens} Length = 280 Back     alignment and structure
 Score =  132 bits (334), Expect = 1e-39
 Identities = 68/119 (57%), Positives = 84/119 (70%), Gaps = 10/119 (8%)

Query: 7   MIKCNLKHPPGNEIYRKDSISFFEIDGRKNKNYAQNLCLLAKLFLDHKTLHYDTDPFLFY 66
           + KC+L+HPPGNEIYRK +ISFFEIDGRKNK+Y+QNLCLLAK FLDHKTL+YDTDPFLFY
Sbjct: 54  LTKCDLRHPPGNEIYRKGTISFFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFY 113

Query: 67  IMTEQDSRGFHIVGIRKNDKTLAAQLLLLWSSSESVYIAWIVRLPWFDPRPRVDFILNR 125
           +MTE D +GFHIVG    +K           S+E   +A I+ LP +  R     ++  
Sbjct: 114 VMTEYDCKGFHIVGYFSKEK----------ESTEDYNVACILTLPPYQRRGYGKLLIEF 162
>2pq8_A Probable histone acetyltransferase MYST1; MOF, structural genomics, structural genomics consortium, SGC; HET: COA; 1.45A {Homo sapiens} PDB: 2giv_A* 3qah_A* 2y0m_A* 3toa_A* 3tob_A* Length = 278 Back     alignment and structure
>2ozu_A Histone acetyltransferase MYST3; structural genomics, structural G consortium, SGC; HET: ALY ACO; 2.30A {Homo sapiens} SCOP: d.108.1.1 PDB: 2rc4_A* 1m36_A Length = 284 Back     alignment and structure
>3to7_A Histone acetyltransferase ESA1; MYST family; HET: ALY COA; 1.90A {Saccharomyces cerevisiae} PDB: 3to6_A* 1fy7_A* 1mja_A* 1mjb_A* 3to9_A* 1mj9_A* Length = 276 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query125
2ou2_A 280 Histone acetyltransferase htatip; structural genom 100.0
2pq8_A 278 Probable histone acetyltransferase MYST1; MOF, str 100.0
2ozu_A 284 Histone acetyltransferase MYST3; structural genomi 100.0
3to7_A 276 Histone acetyltransferase ESA1; MYST family; HET: 100.0
2p0w_A324 Histone acetyltransferase type B catalytic subuni; 99.78
1bob_A320 HAT1, histone acetyltransferase; histone modificat 98.94
2atr_A138 Acetyltransferase, GNAT family; MCSG, structural g 97.69
3efa_A147 Putative acetyltransferase; structural genom 2, pr 97.66
2k5t_A128 Uncharacterized protein YHHK; N-acetyl transferase 97.64
1y7r_A133 Hypothetical protein SA2161; structural genomics, 97.6
3gy9_A150 GCN5-related N-acetyltransferase; YP_001815201.1, 97.58
1r57_A102 Conserved hypothetical protein; GCN5, N-acetyltran 97.55
3lod_A162 Putative acyl-COA N-acyltransferase; structural ge 97.49
1tiq_A180 Protease synthase and sporulation negative regulat 97.49
3ey5_A181 Acetyltransferase-like, GNAT family; structural ge 97.46
3e0k_A150 Amino-acid acetyltransferase; N-acetylglutamate sy 97.46
3bln_A143 Acetyltransferase GNAT family; NP_981174.1, struct 97.46
3fnc_A163 Protein LIN0611, putative acetyltransferase; GNAT, 97.46
3exn_A160 Probable acetyltransferase; GCN5-related N-acetylt 97.42
3pp9_A187 Putative streptothricin acetyltransferase; toxin p 97.41
2jdc_A146 Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1. 97.36
2pdo_A144 Acetyltransferase YPEA; alpha-beta-alpha sandwich, 97.36
3s6f_A145 Hypothetical acetyltransferase; acyl-COA N-acyltra 97.35
2ozh_A142 Hypothetical protein XCC2953; structural genomics, 97.34
1yvk_A163 Hypothetical protein BSU33890; ALPHS-beta protein, 97.33
3mgd_A157 Predicted acetyltransferase; structural genomics, 97.32
4ag7_A165 Glucosamine-6-phosphate N-acetyltransferase; HET: 97.31
2r7h_A177 Putative D-alanine N-acetyltransferase of GNAT FA; 97.31
1q2y_A140 Protein YJCF, similar to hypothetical proteins; GC 97.26
1y9k_A157 IAA acetyltransferase; structural genomics, midwes 97.26
1cjw_A166 Protein (serotonin N-acetyltransferase); HET: COT; 97.26
1qsm_A152 HPA2 histone acetyltransferase; protein-acetyl coe 97.25
2cy2_A174 TTHA1209, probable acetyltransferase; structural g 97.24
1xeb_A150 Hypothetical protein PA0115; midwest center for st 97.24
3owc_A188 Probable acetyltransferase; structural genomics, P 97.22
3jvn_A166 Acetyltransferase; alpha-beta protein, structural 97.22
3d8p_A163 Acetyltransferase of GNAT family; NP_373092.1, str 97.21
1bo4_A168 Protein (serratia marcescens aminoglycoside-3-N- a 97.21
1z4e_A153 Transcriptional regulator; nysgxrc target T2017, G 97.18
2dxq_A150 AGR_C_4057P, acetyltransferase; structural genomic 97.17
2q0y_A153 GCN5-related N-acetyltransferase; YP_295895.1, ace 97.16
4e0a_A164 BH1408 protein; structural genomics, PSI-biology, 97.15
3t9y_A150 Acetyltransferase, GNAT family; PSI-biology, struc 97.15
1y9w_A140 Acetyltransferase; structural genomics, Pro struct 97.15
1yx0_A159 Hypothetical protein YSNE; NESG, GFT structral gen 97.11
2fl4_A149 Spermine/spermidine acetyltransferase; structural 97.11
1s3z_A165 Aminoglycoside 6'-N-acetyltransferase; GNAT, amino 97.11
1ufh_A180 YYCN protein; alpha and beta, fold, acetyltransfer 97.11
3t90_A149 Glucose-6-phosphate acetyltransferase 1; GNAT fold 97.1
2aj6_A159 Hypothetical protein MW0638; structural genomics, 97.1
1wwz_A159 Hypothetical protein PH1933; structural genomics, 97.09
3i9s_A183 Integron cassette protein; oyster POND, woods HOLE 97.07
3i3g_A161 N-acetyltransferase; malaria, structural genomics, 97.06
2gan_A190 182AA long hypothetical protein; alpha-beta protei 97.06
3dsb_A157 Putative acetyltransferase; APC60368.2, ST genomic 97.06
2cnt_A160 Modification of 30S ribosomal subunit protein S18; 97.06
1z4r_A168 General control of amino acid synthesis protein 5- 97.05
1mk4_A157 Hypothetical protein YQJY; alpha-beta-alpha sandwi 97.05
4evy_A166 Aminoglycoside N(6')-acetyltransferase type 1; cen 97.05
3kkw_A182 Putative uncharacterized protein; acetyltransferas 97.04
3dr6_A174 YNCA; acetyltransferase, csgid target, essential g 97.04
3fyn_A176 Integron gene cassette protein HFX_CASS3; integron 97.02
1ghe_A177 Acetyltransferase; acyl coenzyme A complex; HET: A 97.0
1qst_A160 TGCN5 histone acetyl transferase; GCN5-related N-a 96.99
3fix_A183 N-acetyltransferase; termoplasma acidophilum, stru 96.99
1u6m_A199 Acetyltransferase, GNAT family; structural genomic 96.98
1vkc_A158 Putative acetyl transferase; structural genomics, 96.98
1ygh_A164 ADA4, protein (transcriptional activator GCN5); tr 96.98
1i12_A160 Glucosamine-phosphate N-acetyltransferase; GNAT, a 96.98
3ld2_A197 SMU.2055, putative acetyltransferase; HET: COA; 2. 96.96
2x7b_A168 N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulf 96.95
3d3s_A189 L-2,4-diaminobutyric acid acetyltransferase; alpha 96.94
2bei_A170 Diamine acetyltransferase 2; SSAT2, BC011751, AAH1 96.93
2fe7_A166 Probable N-acetyltransferase; structural genomics, 96.92
2fia_A162 Acetyltransferase; structural genomics, PSI, prote 96.92
3f5b_A182 Aminoglycoside N(6')acetyltransferase; APC60744, l 96.92
2qec_A204 Histone acetyltransferase HPA2 and related acetylt 96.9
2bue_A202 AAC(6')-IB; GNAT, transferase, aminoglycoside, flu 96.9
1on0_A158 YYCN protein; structural genomics, alpha-beta prot 96.89
2oh1_A179 Acetyltransferase, GNAT family; YP_013287.1, struc 96.89
2i6c_A160 Putative acetyltransferase; GNAT family, structura 96.86
3frm_A254 Uncharacterized conserved protein; APC61048, staph 96.86
2g3a_A152 Acetyltransferase; structural genomics, PSI, prote 96.85
1kux_A207 Aralkylamine, serotonin N-acetyltransferase; enzym 96.84
2fiw_A172 GCN5-related N-acetyltransferase:aminotransferase 96.81
2eui_A153 Probable acetyltransferase; dimer, structural geno 96.81
2q7b_A181 Acetyltransferase, GNAT family; NP_689019.1, struc 96.8
2b5g_A171 Diamine acetyltransferase 1; structural genomics, 96.79
2vez_A190 Putative glucosamine 6-phosphate acetyltransferase 96.78
3eg7_A176 Spermidine N1-acetyltransferase; structural genomi 96.78
1n71_A180 AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, 96.78
2ob0_A170 Human MAK3 homolog; acetyltransferase, structural 96.77
2pc1_A201 Acetyltransferase, GNAT family; NP_688560.1, struc 96.73
2q04_A211 Acetoin utilization protein; ZP_00540088.1, struct 96.72
2ree_A 224 CURA; GNAT, S-acetyltransferase, decarboxylase, po 96.71
2kcw_A147 Uncharacterized acetyltransferase YJAB; GNAT fold, 96.71
3tth_A170 Spermidine N1-acetyltransferase; central intermedi 96.67
2o28_A184 Glucosamine 6-phosphate N-acetyltransferase; struc 96.64
2pr1_A163 Uncharacterized N-acetyltransferase YLBP; YIBP pro 96.56
3ddd_A 288 Putative acetyltransferase; NP_142035.1, structura 96.54
2ge3_A170 Probable acetyltransferase; structural GEN PSI, pr 96.53
2i79_A172 Acetyltransferase, GNAT family; acetyl coenzyme *A 96.51
1s7k_A182 Acetyl transferase; GNAT; 1.80A {Salmonella typhim 96.51
1nsl_A184 Probable acetyltransferase; structural genomics, h 96.48
3igr_A184 Ribosomal-protein-S5-alanine N-acetyltransferase; 96.48
3f8k_A160 Protein acetyltransferase; GCN5-related N-acetyltr 96.47
3juw_A175 Probable GNAT-family acetyltransferase; structural 96.46
3ec4_A228 Putative acetyltransferase from the GNAT family; Y 96.46
1yre_A197 Hypothetical protein PA3270; APC5563, midwest cent 96.43
1vhs_A175 Similar to phosphinothricin acetyltransferase; str 96.41
1m4i_A181 Aminoglycoside 2'-N-acetyltransferase; COA binding 96.36
3iwg_A276 Acetyltransferase, GNAT family; structural genomic 96.32
4h89_A173 GCN5-related N-acetyltransferase; N-acyltransferas 96.25
3eo4_A164 Uncharacterized protein MJ1062; APC60792.2,MJ_1062 96.21
2j8m_A172 Acetyltransferase PA4866 from P. aeruginosa; GCN5 96.18
3c26_A 266 Putative acetyltransferase TA0821; NP_394282.1, A 96.16
3fbu_A168 Acetyltransferase, GNAT family; structur genomics, 96.14
1yr0_A175 AGR_C_1654P, phosphinothricin acetyltransferase; s 96.09
2ae6_A166 Acetyltransferase, GNAT family; GCN5-related N-ace 95.99
3g8w_A169 Lactococcal prophage PS3 protein 05; APC61042, ace 95.94
2jlm_A182 Putative phosphinothricin N-acetyltransferase; met 95.94
3r9f_A188 MCCE protein; microcin C7, acetyltransferase, SELF 95.93
2vi7_A177 Acetyltransferase PA1377; GNAT, GCN5 family, N-ace 95.83
1p0h_A 318 Hypothetical protein RV0819; GNAT fold, acetyltran 95.78
2z10_A194 Ribosomal-protein-alanine acetyltransferase; alpha 95.76
3tt2_A 330 GCN5-related N-acetyltransferase; structural genom 95.73
4fd4_A217 Arylalkylamine N-acetyltransferase like 5B; GNAT; 95.72
1xmt_A103 Putative acetyltransferase; structural genomics, p 95.68
4fd5_A222 Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A 95.66
2fsr_A195 Acetyltransferase; alpha-beta-sandwich, structural 95.64
3d2m_A456 Putative acetylglutamate synthase; protein-COA-Glu 95.59
3tt2_A330 GCN5-related N-acetyltransferase; structural genom 95.55
3pzj_A209 Probable acetyltransferases; MCSG, PSI-2, structur 95.55
3qb8_A197 A654L protein; GNAT N-acetyltransferase, acetyltra 95.51
2wpx_A 339 ORF14; transferase, acetyl transferase, antibiotic 95.48
1p0h_A318 Hypothetical protein RV0819; GNAT fold, acetyltran 95.46
2hv2_A 400 Hypothetical protein; PSI, protein structure initi 95.22
2wpx_A339 ORF14; transferase, acetyl transferase, antibiotic 95.18
2fck_A181 Ribosomal-protein-serine acetyltransferase, putat; 95.17
2r1i_A172 GCN5-related N-acetyltransferase; YP_831484.1, put 95.11
3g3s_A249 GCN5-related N-acetyltransferase; ZP_00874857.1, a 95.0
2qml_A198 BH2621 protein; structural genomics, joint center 94.95
4ava_A333 Lysine acetyltransferase; allosteric regulation, d 94.62
3r1k_A 428 Enhanced intracellular surviVal protein; GNAT, ace 94.55
2vzy_A218 RV0802C; transferase, GCN5-related N-acetyltransfe 94.52
3tcv_A246 GCN5-related N-acetyltransferase; GRAM negative co 94.52
2ozg_A 396 GCN5-related N-acetyltransferase; YP_325469.1, ace 94.49
3n7z_A 388 Acetyltransferase, GNAT family; PSI2, MCSG, struct 94.48
3sxn_A 422 Enhanced intracellular surviVal protein; GNAT fold 94.44
2i00_A 406 Acetyltransferase, GNAT family; structural genomic 94.43
3te4_A215 GH12636P, dopamine N acetyltransferase, isoform A; 94.31
2zpa_A 671 Uncharacterized protein YPFI; RNA modification enz 94.17
3h4q_A188 Putative acetyltransferase; NP_371943.1, structura 93.85
4fd7_A238 Putative arylalkylamine N-acetyltransferase 7; GNA 93.68
1sqh_A312 Hypothetical protein CG14615-PA; structural genomi 93.19
2g0b_A198 FEEM; N-acyl transferase, environmental DNA, prote 92.13
2zw5_A 301 Bleomycin acetyltransferase; dimer, two domains; H 91.73
1yk3_A210 Hypothetical protein RV1347C/MT1389; acyltransfera 90.87
2ft0_A235 TDP-fucosamine acetyltransferase; GNAT fold acetyl 80.13
>2ou2_A Histone acetyltransferase htatip; structural genomics, structural genomics consortium, SGC; HET: ALY ACO; 2.30A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=7.4e-66  Score=421.27  Aligned_cols=113  Identities=60%  Similarity=1.028  Sum_probs=111.3

Q ss_pred             chHHHHhhCCccCCCcceEEecCCeEEEEEeCCCChhhhhhhhHhhhhcccceeeeeeCCCceEEEEEEeCCCCcEEEEE
Q psy13714          2 TSRDVMIKCNLKHPPGNEIYRKDSISFFEIDGRKNKNYAQNLCLLAKLFLDHKTLHYDTDPFLFYIMTEQDSRGFHIVGI   81 (125)
Q Consensus         2 t~~~H~~~C~~~~PPG~eiYr~~~~si~EVdG~~~~~ycqnLcLlaKlFLd~Ktl~~dv~~F~FYVl~e~D~~G~h~vGy   81 (125)
                      +++||+.+|+++||||+||||++++|||||||+++++||||||||||||||||||||||+||+||||||.|+.|+|+|||
T Consensus        49 ~~~~H~~~C~~r~PPG~eIYr~~~~svfEVDG~~~k~yCQnLcLlaKLFLdhKtlyyDV~~FlFYVl~e~D~~g~h~vGY  128 (280)
T 2ou2_A           49 CLQRHLTKCDLRHPPGNEIYRKGTISFFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDCKGFHIVGY  128 (280)
T ss_dssp             HHHHHHHHCCCSSCSSEEEEEETTEEEEEEETTTSHHHHHHHHHHHHTTCSCCTTTTCCTTEEEEEEEEEETTEEEEEEE
T ss_pred             HHHHHHhhCCCCCCCccEEEEcCCEEEEEEeCccchHHHHHHHHHHHHhhccceeeeecCceEEEEEEEecCCCcEEEEE
Confidence            58899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EecchhhHHHHhhhhcCCCceeeEEEEEcCCCCCCCccccccc
Q psy13714         82 RKNDKTLAAQLLLLWSSSESVYIAWIVRLPWFDPRPRVDFILN  124 (125)
Q Consensus        82 FSkEk~~~~~~~~~~ss~~~~nLacI~vLP~yQ~kGyG~~LI~  124 (125)
                      |||||.          |+++||||||+|||+|||||||++||+
T Consensus       129 FSKEK~----------s~~~~NLaCIltlP~yQrkGyG~lLI~  161 (280)
T 2ou2_A          129 FSKEKE----------STEDYNVACILTLPPYQRRGYGKLLIE  161 (280)
T ss_dssp             EEEESS----------CTTCEEESCEEECGGGTTSSHHHHHHH
T ss_pred             eecccc----------CccccceEEEEecchHHhcchhHHHHH
Confidence            999999          999999999999999999999999996
>2pq8_A Probable histone acetyltransferase MYST1; MOF, structural genomics, structural genomics consortium, SGC; HET: COA; 1.45A {Homo sapiens} PDB: 2giv_A* 3qah_A* 2y0m_A* 3toa_A* 3tob_A* Back     alignment and structure
>2ozu_A Histone acetyltransferase MYST3; structural genomics, structural G consortium, SGC; HET: ALY ACO; 2.30A {Homo sapiens} SCOP: d.108.1.1 PDB: 2rc4_A* 1m36_A Back     alignment and structure
>3to7_A Histone acetyltransferase ESA1; MYST family; HET: ALY COA; 1.90A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 3to6_A* 1fy7_A* 1mja_A* 1mjb_A* 3to9_A* 1mj9_A* Back     alignment and structure
>2p0w_A Histone acetyltransferase type B catalytic subuni; HAT1, structural genomics, structural genomics consortium, S transferase; HET: ACO; 1.90A {Homo sapiens} Back     alignment and structure
>1bob_A HAT1, histone acetyltransferase; histone modification, acetyl coenzyme A binding-protein; HET: ACO; 2.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 Back     alignment and structure
>2atr_A Acetyltransferase, GNAT family; MCSG, structural genomics, PSI, protein structure INIT midwest center for structural genomics; 2.01A {Streptococcus pneumoniae} SCOP: d.108.1.1 Back     alignment and structure
>3efa_A Putative acetyltransferase; structural genom 2, protein structure initiative, midwest center for structu genomics, MCSG; 2.42A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2k5t_A Uncharacterized protein YHHK; N-acetyl transferase, COA, bound ligand, coenzyme A, structural genomics, PSI-2, protein structure initiative; HET: COA; NMR {Escherichia coli K12} Back     alignment and structure
>1y7r_A Hypothetical protein SA2161; structural genomics, protein structure initiative, PSI, midwest center for structural genomics; 1.70A {Staphylococcus aureus} SCOP: d.108.1.1 Back     alignment and structure
>3gy9_A GCN5-related N-acetyltransferase; YP_001815201.1, putative acetyltransferase; HET: MSE COA SO4; 1.52A {Exiguobacterium sibiricum 255-15} PDB: 3gya_A* Back     alignment and structure
>1r57_A Conserved hypothetical protein; GCN5, N-acetyltransferase, structural genomics, PSI, protein structure initiative; NMR {Staphylococcus aureus} SCOP: d.108.1.1 PDB: 2h5m_A* Back     alignment and structure
>3lod_A Putative acyl-COA N-acyltransferase; structural genomics, PSI2, MCSG, structure initiative; 2.50A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1tiq_A Protease synthase and sporulation negative regulatory protein PAI 1; alpha-beta protein, structural genomics, PSI; HET: COA; 1.90A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>3ey5_A Acetyltransferase-like, GNAT family; structural genomics, APC60148, GNAT famil protein structure initiative; 2.15A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3e0k_A Amino-acid acetyltransferase; N-acetylglutamate synthase, structu genomics, PSI-2, protein structure initiative; HET: MSE; 2.52A {Vibrio parahaemolyticus} Back     alignment and structure
>3bln_A Acetyltransferase GNAT family; NP_981174.1, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE MRD GOL; 1.31A {Bacillus cereus} Back     alignment and structure
>3fnc_A Protein LIN0611, putative acetyltransferase; GNAT, RIMI, structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.75A {Listeria innocua} SCOP: d.108.1.0 Back     alignment and structure
>3exn_A Probable acetyltransferase; GCN5-related N-acetyltransferase, MCSG, P structural genomics, protein structure initiative; HET: ACO; 1.80A {Thermus thermophilus} Back     alignment and structure
>3pp9_A Putative streptothricin acetyltransferase; toxin production resistance, infectious diseases, structural genomics; HET: MSE ACO; 1.60A {Bacillus anthracis} Back     alignment and structure
>2jdc_A Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1.6A {Bacillus licheniformis} SCOP: d.108.1.1 PDB: 2bsw_A* 2jdd_A* Back     alignment and structure
>2pdo_A Acetyltransferase YPEA; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 2.00A {Shigella flexneri 2A} Back     alignment and structure
>3s6f_A Hypothetical acetyltransferase; acyl-COA N-acyltransferases, structural genomics, joint CENT structural genomics, JCSG; HET: MSE COA; 1.19A {Deinococcus radiodurans} Back     alignment and structure
>2ozh_A Hypothetical protein XCC2953; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.40A {Xanthomonas campestris PV} Back     alignment and structure
>1yvk_A Hypothetical protein BSU33890; ALPHS-beta protein, structural genomics, PSI, protein structure initiative; HET: COA; 3.01A {Bacillus subtilis subsp} SCOP: d.108.1.1 Back     alignment and structure
>3mgd_A Predicted acetyltransferase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; HET: ACO; 1.90A {Clostridium acetobutylicum} Back     alignment and structure
>4ag7_A Glucosamine-6-phosphate N-acetyltransferase; HET: COA; 1.55A {Caenorhabditis elegans} PDB: 4ag9_A* Back     alignment and structure
>2r7h_A Putative D-alanine N-acetyltransferase of GNAT FA; putative acetyltransferase of the GNAT family; 1.85A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>1q2y_A Protein YJCF, similar to hypothetical proteins; GCN5-related N-acetyltransferase superfamily fold, NYSGXRC, PSI, protein structure initiative; 2.00A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>1y9k_A IAA acetyltransferase; structural genomics, midwest center for structural genomics bacillus cereus ATCC 14579, PSI; 2.39A {Bacillus cereus atcc 14579} SCOP: d.108.1.1 Back     alignment and structure
>1cjw_A Protein (serotonin N-acetyltransferase); HET: COT; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1b6b_A Back     alignment and structure
>1qsm_A HPA2 histone acetyltransferase; protein-acetyl coenzyme A complex; HET: ACO; 2.40A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1qso_A Back     alignment and structure
>2cy2_A TTHA1209, probable acetyltransferase; structural genomics, unknown function, NPPSFA; HET: ACO; 2.00A {Thermus thermophilus} SCOP: d.108.1.1 PDB: 1wk4_A* Back     alignment and structure
>1xeb_A Hypothetical protein PA0115; midwest center for structural genomics, MCSG, structural GEN protein structure initiative, PSI, APC22065; 2.35A {Pseudomonas aeruginosa} SCOP: d.108.1.1 Back     alignment and structure
>3owc_A Probable acetyltransferase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; HET: COA; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>3jvn_A Acetyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.61A {Vibrio fischeri} Back     alignment and structure
>3d8p_A Acetyltransferase of GNAT family; NP_373092.1, structural GE joint center for structural genomics, JCSG, protein structu initiative; 2.20A {Staphylococcus aureus subsp} Back     alignment and structure
>1bo4_A Protein (serratia marcescens aminoglycoside-3-N- acetyltransferase); eubacterial aminoglyco resistance, GCN5-related N-acetyltransferase; HET: SPD COA; 2.30A {Serratia marcescens} SCOP: d.108.1.1 Back     alignment and structure
>1z4e_A Transcriptional regulator; nysgxrc target T2017, GNAT fold, structural genomics, PSI, P structure initiative; 2.00A {Bacillus halodurans} SCOP: d.108.1.1 Back     alignment and structure
>2dxq_A AGR_C_4057P, acetyltransferase; structural genomics, PSI-2, protein struc initiative, midwest center for structural genomics, MCSG; 1.80A {Agrobacterium tumefaciens str} Back     alignment and structure
>2q0y_A GCN5-related N-acetyltransferase; YP_295895.1, acetyltransferase (GNAT) family, structural genomics, joint center for ST genomics; HET: MSE; 1.80A {Ralstonia eutropha JMP134} Back     alignment and structure
>4e0a_A BH1408 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, transferase; 1.80A {Bacillus halodurans} PDB: 4f6a_A* Back     alignment and structure
>3t9y_A Acetyltransferase, GNAT family; PSI-biology, structural genomics, midwest center for structu genomics, MCSG; HET: PGE; 2.00A {Staphylococcus aureus} Back     alignment and structure
>1y9w_A Acetyltransferase; structural genomics, Pro structure initiative, PSI, midwest center for structural GE MCSG; 1.90A {Bacillus cereus} SCOP: d.108.1.1 Back     alignment and structure
>1yx0_A Hypothetical protein YSNE; NESG, GFT structral genomics, SR220, structural genomics, PSI, protein structure initiative; NMR {Bacillus subtilis subsp} SCOP: d.108.1.1 Back     alignment and structure
>2fl4_A Spermine/spermidine acetyltransferase; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>1s3z_A Aminoglycoside 6'-N-acetyltransferase; GNAT, aminoglycoside ribostamycin; HET: COA RIO; 2.00A {Salmonella enteritidis} SCOP: d.108.1.1 PDB: 1s5k_A* 1s60_A* 2vbq_A* Back     alignment and structure
>1ufh_A YYCN protein; alpha and beta, fold, acetyltransferase, structural genomics, PSI, protein structure initiative; 2.20A {Bacillus subtilis subsp} SCOP: d.108.1.1 Back     alignment and structure
>3t90_A Glucose-6-phosphate acetyltransferase 1; GNAT fold, glcnac biosynthesis, alpha/beta protein; HET: EPE; 1.50A {Arabidopsis thaliana} Back     alignment and structure
>2aj6_A Hypothetical protein MW0638; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL; 1.63A {Staphylococcus aureus subsp} SCOP: d.108.1.1 Back     alignment and structure
>1wwz_A Hypothetical protein PH1933; structural genomics, pyrococcus horikoshii OT3, riken struct genomics/proteomics initiative, RSGI; HET: ACO; 1.75A {Pyrococcus horikoshii} SCOP: d.108.1.1 Back     alignment and structure
>3i9s_A Integron cassette protein; oyster POND, woods HOLE, acetyltransferase, structural genomics, PSI-2, protein structure initiative; 2.20A {Vibrio cholerae} Back     alignment and structure
>3i3g_A N-acetyltransferase; malaria, structural genomics, structural genomics consortium, SGC,; 1.86A {Trypanosoma brucei} PDB: 3fb3_A Back     alignment and structure
>2gan_A 182AA long hypothetical protein; alpha-beta protein., structural genomics, PSI, protein struc initiative; 2.10A {Pyrococcus horikoshii} SCOP: d.108.1.1 Back     alignment and structure
>3dsb_A Putative acetyltransferase; APC60368.2, ST genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 1.48A {Clostridium difficile} Back     alignment and structure
>2cnt_A Modification of 30S ribosomal subunit protein S18; N-alpha acetylation, GCN5-N-acetyltransferase, ribosomal Pro acetyltransferase, GNAT; HET: COA; 2.4A {Salmonella typhimurium} PDB: 2cnm_A* 2cns_A* Back     alignment and structure
>1z4r_A General control of amino acid synthesis protein 5-like 2; GCN5, acetyltransferase, SGC, structural genomics, structural genomics consortium; HET: ACO; 1.74A {Homo sapiens} SCOP: d.108.1.1 PDB: 1cm0_B* Back     alignment and structure
>1mk4_A Hypothetical protein YQJY; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>4evy_A Aminoglycoside N(6')-acetyltransferase type 1; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases; HET: TOY; 1.77A {Acinetobacter haemolyticus} PDB: 4f0y_A 4e8o_A Back     alignment and structure
>3kkw_A Putative uncharacterized protein; acetyltransferase, GNAT family, structural genomics, PSI, protein structure initiative; 1.41A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3dr6_A YNCA; acetyltransferase, csgid target, essential gene, IDP00086, structural genomics, center for STRU genomics of infectious diseases; HET: MSE; 1.75A {Salmonella typhimurium} SCOP: d.108.1.1 PDB: 3dr8_A* Back     alignment and structure
>3fyn_A Integron gene cassette protein HFX_CASS3; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.45A {Uncultured bacterium} Back     alignment and structure
>1ghe_A Acetyltransferase; acyl coenzyme A complex; HET: ACO; 1.55A {Pseudomonas syringae PV} SCOP: d.108.1.1 PDB: 1j4j_A* Back     alignment and structure
>1qst_A TGCN5 histone acetyl transferase; GCN5-related N-acetyltransferase, COA binding protein; HET: EPE; 1.70A {Tetrahymena thermophila} SCOP: d.108.1.1 PDB: 1m1d_A* 1pu9_A* 1pua_A* 5gcn_A* 1qsr_A* 1q2d_A* 1q2c_A* 1qsn_A* Back     alignment and structure
>3fix_A N-acetyltransferase; termoplasma acidophilum, structural GEN PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 2.30A {Thermoplasma acidophilum} PDB: 3f0a_A* 3k9u_A* 3ne7_A* Back     alignment and structure
>1u6m_A Acetyltransferase, GNAT family; structural genomics, PSI, protein structure initiative; 2.40A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>1vkc_A Putative acetyl transferase; structural genomics, pyrococcus furiosus southeast collaboratory for structural genomics, secsg; 1.89A {Pyrococcus furiosus} SCOP: d.108.1.1 Back     alignment and structure
>1ygh_A ADA4, protein (transcriptional activator GCN5); transcriptional regulation, histone acetylation; 1.90A {Saccharomyces cerevisiae} SCOP: d.108.1.1 Back     alignment and structure
>1i12_A Glucosamine-phosphate N-acetyltransferase; GNAT, alpha/beta; HET: ACO; 1.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1i1d_A* 1i21_A Back     alignment and structure
>3ld2_A SMU.2055, putative acetyltransferase; HET: COA; 2.50A {Streptococcus mutans} Back     alignment and structure
>2x7b_A N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulfolobus solfataricus} Back     alignment and structure
>3d3s_A L-2,4-diaminobutyric acid acetyltransferase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 1.87A {Bordetella parapertussis 12822} Back     alignment and structure
>2bei_A Diamine acetyltransferase 2; SSAT2, BC011751, AAH11751, thialysine N-acetyltransferase, structural genomics, protein structure initiative, PSI; HET: ACO; 1.84A {Homo sapiens} SCOP: d.108.1.1 PDB: 2q4v_A* Back     alignment and structure
>2fe7_A Probable N-acetyltransferase; structural genomics, pseudomonas aerugi PSI, protein structure initiative; 2.00A {Pseudomonas aeruginosa ucbpp-pa14} SCOP: d.108.1.1 Back     alignment and structure
>2fia_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 2.60A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>3f5b_A Aminoglycoside N(6')acetyltransferase; APC60744, legionella pneumophila subsp. pneumophila, structural genomics, PSI-2; HET: MSE; 2.00A {Legionella pneumophila subsp} Back     alignment and structure
>2qec_A Histone acetyltransferase HPA2 and related acetyltransferases; NP_600742.1, acetyltransferase (GNAT) family; 1.90A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2bue_A AAC(6')-IB; GNAT, transferase, aminoglycoside, fluoroquinolone, acetyltransferase, antibiotic resistance; HET: COA RIO; 1.7A {Escherichia coli} PDB: 1v0c_A* 2vqy_A* 2prb_A* 2qir_A* 2pr8_A* Back     alignment and structure
>1on0_A YYCN protein; structural genomics, alpha-beta protein with anti-parallel B strands, PSI, protein structure initiative; 2.20A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>2oh1_A Acetyltransferase, GNAT family; YP_013287.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE UNL; 1.46A {Listeria monocytogenes str} Back     alignment and structure
>2i6c_A Putative acetyltransferase; GNAT family, structural genomic, structur genomics, PSI-2, protein structure initiative; HET: MSE EPE; 1.30A {Pseudomonas aeruginosa} SCOP: d.108.1.1 PDB: 3pgp_A* Back     alignment and structure
>3frm_A Uncharacterized conserved protein; APC61048, staphylococcus epidermidis ATCC structural genomics, PSI-2, protein structure initiative; HET: MES; 2.32A {Staphylococcus epidermidis} Back     alignment and structure
>2g3a_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 1.90A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Back     alignment and structure
>1kux_A Aralkylamine, serotonin N-acetyltransferase; enzyme-inhibitor complex, bisubstrate analog, alternate conformations; HET: CA3; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1kuv_A* 1kuy_A* 1l0c_A* 1ib1_E* Back     alignment and structure
>2fiw_A GCN5-related N-acetyltransferase:aminotransferase II; alpha-beta-alpha sandwich, GCN4-related acetyltransferase, S genomics, PSI; HET: ACO; 2.35A {Rhodopseudomonas palustris} SCOP: d.108.1.1 Back     alignment and structure
>2eui_A Probable acetyltransferase; dimer, structural genomics, PSI, protein structure initiative; 2.80A {Pseudomonas aeruginosa PAO1} SCOP: d.108.1.1 Back     alignment and structure
>2q7b_A Acetyltransferase, GNAT family; NP_689019.1, structural GEN joint center for structural genomics, JCSG; HET: MSE FLC; 2.00A {Streptococcus agalactiae 2603V} Back     alignment and structure
>2b5g_A Diamine acetyltransferase 1; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: ALY; 1.70A {Homo sapiens} SCOP: d.108.1.1 PDB: 2b4d_A* 2jev_A* 2g3t_A 2f5i_A 2b3u_A 2b3v_A* 2b4b_A* 2b58_A* 2fxf_A* 3bj7_A* 3bj8_A* Back     alignment and structure
>2vez_A Putative glucosamine 6-phosphate acetyltransferase; acyltransferase; HET: ACO G6P; 1.45A {Aspergillus fumigatus} PDB: 2vxk_A* Back     alignment and structure
>3eg7_A Spermidine N1-acetyltransferase; structural genomics, IDP016 transferase, center for structural genomics of infectious D csgid; HET: MSE; 2.38A {Vibrio cholerae} SCOP: d.108.1.0 Back     alignment and structure
>1n71_A AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, antibiotic resistance, coenzyme A; HET: COA; 1.80A {Enterococcus faecium} SCOP: d.108.1.1 PDB: 2a4n_A* 1b87_A* Back     alignment and structure
>2ob0_A Human MAK3 homolog; acetyltransferase, structural genomics consortium, SGC; HET: ACO; 1.80A {Homo sapiens} PDB: 2psw_A* 3tfy_A* Back     alignment and structure
>2pc1_A Acetyltransferase, GNAT family; NP_688560.1, structural genom joint center for structural genomics, JCSG; HET: MSE; 1.28A {Streptococcus agalactiae 2603V} Back     alignment and structure
>2q04_A Acetoin utilization protein; ZP_00540088.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE; 2.33A {Exiguobacterium sibiricum} Back     alignment and structure
>2ree_A CURA; GNAT, S-acetyltransferase, decarboxylase, polyketid synthase, loading, phosphopantetheine, transferase, lyase; HET: SO4; 1.95A {Lyngbya majuscula} PDB: 2ref_A* Back     alignment and structure
>2kcw_A Uncharacterized acetyltransferase YJAB; GNAT fold, acyltransferase; NMR {Escherichia coli} Back     alignment and structure
>3tth_A Spermidine N1-acetyltransferase; central intermediary metabolism; 3.30A {Coxiella burnetii} Back     alignment and structure
>2o28_A Glucosamine 6-phosphate N-acetyltransferase; structural genomics, structural genomics consortium, SGC; HET: 16G COA; 1.80A {Homo sapiens} PDB: 2huz_A* 3cxq_A* 3cxs_A 3cxp_A Back     alignment and structure
>2pr1_A Uncharacterized N-acetyltransferase YLBP; YIBP protein, coenzyme A, structural GE PSI-2, protein structure initiative; HET: SUC COA; 3.20A {Bacillus subtilis} Back     alignment and structure
>3ddd_A Putative acetyltransferase; NP_142035.1, structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: COA; 2.25A {Pyrococcus horikoshii} Back     alignment and structure
>2ge3_A Probable acetyltransferase; structural GEN PSI, protein structure initiative, midwest center for struc genomics, MCSG; HET: ACO; 2.25A {Agrobacterium tumefaciens} SCOP: d.108.1.1 Back     alignment and structure
>2i79_A Acetyltransferase, GNAT family; acetyl coenzyme *A, structur genomics, PSI-2, protein structure initiative; HET: ACO; 2.10A {Streptococcus pneumoniae} Back     alignment and structure
>1s7k_A Acetyl transferase; GNAT; 1.80A {Salmonella typhimurium} SCOP: d.108.1.1 PDB: 1s7l_A* 1s7n_A* 1s7f_A 1z9u_A Back     alignment and structure
>1nsl_A Probable acetyltransferase; structural genomics, hexamer, alpha-beta, PSI, protein struc initiative, midwest center for structural genomics; 2.70A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>3igr_A Ribosomal-protein-S5-alanine N-acetyltransferase; fisch MCSG, structural genomics, midwest center for structural GE protein structure initiative; HET: MSE; 2.00A {Vibrio fischeri} SCOP: d.108.1.0 Back     alignment and structure
>3f8k_A Protein acetyltransferase; GCN5-related N-acetyltransferase; HET: COA; 1.84A {Sulfolobus solfataricus P2} Back     alignment and structure
>3juw_A Probable GNAT-family acetyltransferase; structural genomics, APC60242, acetyltransferas protein structure initiative; HET: MSE; 2.11A {Bordetella pertussis} Back     alignment and structure
>3ec4_A Putative acetyltransferase from the GNAT family; YP_497011.1, joint center for structural genomics; 1.80A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} Back     alignment and structure
>1yre_A Hypothetical protein PA3270; APC5563, midwest center for structural genomics, MSC protein structure initiative, PSI, MCSG; HET: COA; 2.15A {Pseudomonas aeruginosa} SCOP: d.108.1.1 Back     alignment and structure
>1vhs_A Similar to phosphinothricin acetyltransferase; structural genomics, unknown function; 1.80A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>1m4i_A Aminoglycoside 2'-N-acetyltransferase; COA binding motif; HET: COA KAN PAP; 1.50A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1m4d_A* 1m4g_A* 1m44_A* Back     alignment and structure
>3iwg_A Acetyltransferase, GNAT family; structural genomics, APC, PSI-2, protein structure initiativ midwest center for structural genomics; HET: MSE; 2.30A {Colwellia psychrerythraea} Back     alignment and structure
>4h89_A GCN5-related N-acetyltransferase; N-acyltransferase superfamily, structural genomics, PSI-BIOL midwest center for structural genomics, MCSG; 1.37A {Kribbella flavida} Back     alignment and structure
>3eo4_A Uncharacterized protein MJ1062; APC60792.2,MJ_1062,methanocaldococcus jannaschii DSM 2661, S genomics, PSI-2; HET: MES PG6; 2.19A {Methanocaldococcus jannaschii} Back     alignment and structure
>2j8m_A Acetyltransferase PA4866 from P. aeruginosa; GCN5 family, phosphinothricin, methionine sulfone, methionine sulfoximine; 1.44A {Pseudomonas aeruginosa} PDB: 2bl1_A 2j8n_A 2j8r_A* 1yvo_A Back     alignment and structure
>3c26_A Putative acetyltransferase TA0821; NP_394282.1, A putative acetyltransferase, acetyltransferase family, structural genomics; 2.00A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>3fbu_A Acetyltransferase, GNAT family; structur genomics, PSI2, MCSG, protein structure initiative, midwest for structural genomics; HET: COA; 1.80A {Bacillus anthracis str} Back     alignment and structure
>1yr0_A AGR_C_1654P, phosphinothricin acetyltransferase; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.00A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Back     alignment and structure
>2ae6_A Acetyltransferase, GNAT family; GCN5-related N-acetyltransferase (GNAT), alpha-beta, structu genomics, PSI, protein structure initiative; HET: GOL; 2.19A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>3g8w_A Lactococcal prophage PS3 protein 05; APC61042, acetyltransferase, staphylococcus epidermidis ATCC structural genomics; HET: NHE FLC; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>2jlm_A Putative phosphinothricin N-acetyltransferase; methionine sulfoximine; 2.35A {Acinetobacter baylyi} Back     alignment and structure
>3r9f_A MCCE protein; microcin C7, acetyltransferase, SELF immunity, resistance, A coenzyme A, transferase; HET: COA GSU; 1.20A {Escherichia coli} PDB: 3r95_A* 3r96_A* 3r9e_A* 3r9g_A* Back     alignment and structure
>2vi7_A Acetyltransferase PA1377; GNAT, GCN5 family, N-acetyltransferase, hypothetical protein; 2.25A {Pseudomonas aeruginosa} Back     alignment and structure
>1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A* Back     alignment and structure
>2z10_A Ribosomal-protein-alanine acetyltransferase; alpha/beta protein, acyltransferase, structural genomics, NPPSFA; HET: IYR; 1.77A {Thermus thermophilus} PDB: 2z0z_A* 2z11_A* 2zxv_A* Back     alignment and structure
>3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus} Back     alignment and structure
>4fd4_A Arylalkylamine N-acetyltransferase like 5B; GNAT; 1.95A {Aedes aegypti} Back     alignment and structure
>1xmt_A Putative acetyltransferase; structural genomics, protein structure initiative, CESG, AT1G77540, center for eukaryotic structural genomics; 1.15A {Arabidopsis thaliana} SCOP: d.108.1.1 PDB: 2q44_A 2evn_A 2il4_A* 2q4y_A* Back     alignment and structure
>4fd5_A Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A {Aedes aegypti} PDB: 4fd6_A Back     alignment and structure
>2fsr_A Acetyltransferase; alpha-beta-sandwich, structural genomics, PSI, protein struc initiative, midwest center for structural genomics; HET: PEG; 1.52A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Back     alignment and structure
>3d2m_A Putative acetylglutamate synthase; protein-COA-Glu ternary complex, transferase; HET: COA GLU; 2.21A {Neisseria gonorrhoeae} PDB: 2r8v_A* 3b8g_A* 2r98_A* 3d2p_A* Back     alignment and structure
>3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus} Back     alignment and structure
>3pzj_A Probable acetyltransferases; MCSG, PSI-2, structural genomics, protein structure initiati midwest center for structural genomics; HET: MSE; 1.85A {Chromobacterium violaceum} Back     alignment and structure
>3qb8_A A654L protein; GNAT N-acetyltransferase, acetyltransferase, COA, spermine, spermidine, transferase; HET: COA; 1.50A {Paramecium bursaria chlorella virus 1} Back     alignment and structure
>2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* Back     alignment and structure
>1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A* Back     alignment and structure
>2hv2_A Hypothetical protein; PSI, protein structure initiative, midwest center for struct genomics, MCSG, structural genomics, unknown function; HET: EPE PG4; 2.40A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 Back     alignment and structure
>2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* Back     alignment and structure
>2fck_A Ribosomal-protein-serine acetyltransferase, putat; ribosomal-protein structural genomics, PSI, protein structure initiative; HET: MSE; 1.70A {Vibrio cholerae o1 biovar eltor} SCOP: d.108.1.1 Back     alignment and structure
>2r1i_A GCN5-related N-acetyltransferase; YP_831484.1, putative acetyltransferase, arthrobacter SP. FB acetyltransferase (GNAT) family; HET: MSE; 1.65A {Arthrobacter SP} Back     alignment and structure
>3g3s_A GCN5-related N-acetyltransferase; ZP_00874857.1, acetyltransferase (GNAT) family, structural joint center for structural genomics, JCSG; HET: MSE; 1.80A {Streptococcus suis} Back     alignment and structure
>2qml_A BH2621 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; HET: MSE; 1.55A {Bacillus halodurans} Back     alignment and structure
>4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* Back     alignment and structure
>3r1k_A Enhanced intracellular surviVal protein; GNAT, acetyltransferase, transferase; HET: COA; 1.95A {Mycobacterium tuberculosis} PDB: 3sxo_A 3ryo_A 3uy5_A Back     alignment and structure
>2vzy_A RV0802C; transferase, GCN5-related N-acetyltransferase, succinyltransferase; HET: FLC; 2.00A {Mycobacterium tuberculosis} PDB: 2vzz_A* Back     alignment and structure
>3tcv_A GCN5-related N-acetyltransferase; GRAM negative coccobacillus, brucellosis, acyl CO-A, arylami transferase; 1.75A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} Back     alignment and structure
>2ozg_A GCN5-related N-acetyltransferase; YP_325469.1, acetyltransfe (GNAT) family, structural genomics, joint center for struct genomics, JCSG; HET: COA; 2.00A {Anabaena variabilis} SCOP: d.106.1.4 d.108.1.10 Back     alignment and structure
>3n7z_A Acetyltransferase, GNAT family; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.75A {Bacillus anthracis} Back     alignment and structure
>3sxn_A Enhanced intracellular surviVal protein; GNAT fold, acetyltransferase, acetyl COA binding, transferas; HET: COA; 2.03A {Mycobacterium smegmatis} Back     alignment and structure
>2i00_A Acetyltransferase, GNAT family; structural genomics, PSI-2, structure initiative, midwest center for structural genomic transferase; 2.30A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 Back     alignment and structure
>3te4_A GH12636P, dopamine N acetyltransferase, isoform A; dopamine/acetyl COA, N-acetyltransferase domain; HET: ACO; 1.46A {Drosophila melanogaster} PDB: 3v8i_A* Back     alignment and structure
>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} Back     alignment and structure
>3h4q_A Putative acetyltransferase; NP_371943.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE P33; 2.50A {Staphylococcus aureus subsp} Back     alignment and structure
>4fd7_A Putative arylalkylamine N-acetyltransferase 7; GNAT, COA binding; 1.80A {Aedes aegypti} Back     alignment and structure
>1sqh_A Hypothetical protein CG14615-PA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Drosophila melanogaster} SCOP: d.108.1.5 Back     alignment and structure
>2g0b_A FEEM; N-acyl transferase, environmental DNA, protein-product compl antibiotic synthase, transferase; HET: NLT; 3.00A {Uncultured bacterium} Back     alignment and structure
>2zw5_A Bleomycin acetyltransferase; dimer, two domains; HET: COA; 2.40A {Streptomyces verticillus} PDB: 2zw4_A* 2zw6_A 2zw7_A* Back     alignment and structure
>1yk3_A Hypothetical protein RV1347C/MT1389; acyltransferase, GCN5-related fold, structural genomics, PSI, protein structure initiative; HET: BOG; 2.20A {Mycobacterium tuberculosis} SCOP: d.108.1.1 Back     alignment and structure
>2ft0_A TDP-fucosamine acetyltransferase; GNAT fold acetyltransferase, structural genomics, montreal-K bacterial structural genomics initiative, BSGI; HET: ACO; 1.66A {Escherichia coli} PDB: 2fs5_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 125
d2ozua1 270 d.108.1.1 (A:507-776) Histone acetyltransferase MY 3e-39
d1fy7a_ 273 d.108.1.1 (A:) Histone acetyltransferase ESA1 {Bak 6e-39
d2giva1 271 d.108.1.1 (A:4-274) Probable histone acetyltransfe 4e-38
d1boba_315 d.108.1.1 (A:) Histone acetyltransferase HAT1 {Bak 1e-04
>d2ozua1 d.108.1.1 (A:507-776) Histone acetyltransferase MYST3 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Acyl-CoA N-acyltransferases (Nat)
superfamily: Acyl-CoA N-acyltransferases (Nat)
family: N-acetyl transferase, NAT
domain: Histone acetyltransferase MYST3
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  130 bits (328), Expect = 3e-39
 Identities = 49/80 (61%), Positives = 61/80 (76%)

Query: 7   MIKCNLKHPPGNEIYRKDSISFFEIDGRKNKNYAQNLCLLAKLFLDHKTLHYDTDPFLFY 66
           M KC   HPP NEIYRK++IS FE+DG  +  Y QNLCLLAKLFLDHKTL+YD +PFLFY
Sbjct: 51  MKKCGWFHPPANEIYRKNNISVFEVDGNVSTIYCQNLCLLAKLFLDHKTLYYDVEPFLFY 110

Query: 67  IMTEQDSRGFHIVGIRKNDK 86
           ++T+ D +G H+VG    +K
Sbjct: 111 VLTQNDVKGCHLVGYFSKEK 130
>d1fy7a_ d.108.1.1 (A:) Histone acetyltransferase ESA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 273 Back     information, alignment and structure
>d2giva1 d.108.1.1 (A:4-274) Probable histone acetyltransferase MYST1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1boba_ d.108.1.1 (A:) Histone acetyltransferase HAT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 315 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query125
d2giva1 271 Probable histone acetyltransferase MYST1 {Human (H 100.0
d2ozua1 270 Histone acetyltransferase MYST3 {Human (Homo sapie 100.0
d1fy7a_ 273 Histone acetyltransferase ESA1 {Baker's yeast (Sac 100.0
d1boba_315 Histone acetyltransferase HAT1 {Baker's yeast (Sac 99.76
d2aj6a1118 Hypothetical protein MW0638 {Staphylococcus aureus 97.88
d2atra1137 Probable acetyltransferase SP0256 {Streptococcus p 97.74
d1yvka1152 Hypothetical protein YvbK (BSu33890) {Bacillus sub 97.62
d1n71a_180 Aminoglycoside 6'-N-acetyltransferase {Enterococcu 97.58
d1y9wa1140 Probable acetyltransferase BC2806 {Bacillus cereus 97.57
d2fiwa1156 Probable N-acetyltransferase RPA1999 {Rhodopseudom 97.51
d1y9ka1152 IAA acetyltransferase {Bacillus cereus [TaxId: 139 97.5
d1y7ra1133 Hypothetical protein SA2161 {Staphylococcus aureus 97.46
d1ygha_164 Catalytic domain of GCN5 histone acetyltransferase 97.43
d2fl4a1146 Probable spermine/spermidine acetyltransferase EF1 97.28
d1qsra_162 Catalytic domain of GCN5 histone acetyltransferase 97.25
d2gana1182 Hypothetical protein PH0736 {Pyrococcus horikoshii 97.24
d1yvoa1169 Hypothetical protein PA4866 {Pseudomonas aeruginos 97.22
d1tiqa_173 Protease synthase and sporulation negative regulat 97.19
d1z4ra1162 Catalytic domain of GCN5 histone acetyltransferase 97.16
d2jdca1145 Probable acetyltransferase YitI {Bacillus lichenif 97.12
d2g3aa1137 Probable acetyltransferase Atu2258 {Agrobacterium 97.1
d1q2ya_140 Probable acetyltransferase YjcF {Bacillus subtilis 97.08
d1yx0a1151 Hypothetical protein YsnE {Bacillus subtilis [TaxI 97.05
d1xeba_149 Hypothetical protein PA0115 {Pseudomonas aeruginos 97.05
d2fiaa1157 Probable acetyltransferase EF1919 {Enterococcus fa 97.04
d1vkca_149 Putative acetyltransferase PF0028 {Pyrococcus furi 97.0
d1s3za_147 Aminoglycoside N-acetyltransferase AAC(6')-IY {Sal 96.98
d1r57a_102 Hypothetical protein SA2309 {Staphylococcus aureus 96.98
d1ufha_155 Putative acetyltransferase YycN {Bacillus subtilis 96.96
d1z4ea1150 Transcriptional regulator BH1968 {Bacillus halodur 96.94
d1bo4a_137 Aminoglycoside 3-N-acetyltransferase {Serratia mar 96.92
d2i6ca1160 Putative acetyltransferase PA4794 {Pseudomonas aer 96.9
d1wwza1157 Hypothetical protein PH1933 {Pyrococcus horikoshii 96.88
d1ghea_170 Tabtoxin resistance protein {Pseudomonas syringae 96.83
d2fe7a1156 Probable N-acetyltransferase PA0478 {Pseudomonas a 96.74
d1yr0a1163 Phosphinothricin acetyltransferase {Agrobacterium 96.72
d1cjwa_166 Serotonin N-acetyltranferase {Sheep (Ovis aries) [ 96.66
d1vhsa_165 Putative phosphinothricin acetyltransferase YwnH { 96.53
d2ae6a1161 Putative acetyltransferase EF0244 {Enterococcus fa 96.46
d1mk4a_157 Hypothetical protein YqiY {Bacillus subtilis [TaxI 96.45
d2cy2a1174 Probable acetyltransferase TTHA1209 {Thermus therm 96.14
d1u6ma_189 Putative acetyltransferase EF0945 {Enterococcus fa 96.05
d1qsma_150 Histone acetyltransferase HPA2 {Baker's yeast (Sac 95.99
d2ge3a1164 Probable acetyltransferase Atu2290 {Agrobacterium 95.85
d1p0ha_308 Mycothiol synthase MshD {Mycobacterium tuberculosi 95.75
d1i12a_157 Glucosamine-phosphate N-acetyltransferase GNA1 {Ba 95.75
d1p0ha_ 308 Mycothiol synthase MshD {Mycobacterium tuberculosi 95.46
d2beia1167 Diamine acetyltransferase 2 {Human (Homo sapiens) 95.45
d2ozga2 283 Putative acetyltransferase Ava4977 {Anabaena varia 95.36
d2hv2a2 285 Hypothetical protein EF1021 {Enterococcus faecalis 95.24
d1m4ia_181 Aminoglycoside 2'-N-acetyltransferase {Mycobacteri 94.91
d1nsla_180 Probable acetyltransferase YdaF {Bacillus subtilis 93.76
d2euia1153 Probable acetyltransferase PA4026 {Pseudomonas aer 93.72
d2b5ga1167 Diamine acetyltransferase 1 {Human (Homo sapiens) 93.68
d1sqha_297 Hypothetical protein cg14615-pa {Fruit fly (Drosop 92.46
d2i00a2 291 Putative acetyltransferase EF2353 {Enterococcus fa 92.14
d1s7ka1174 L7/L12-Ribosomal-protein-serine acetyltransferase 90.05
d1yrea1183 Hypothetical protein PA3270 {Pseudomonas aeruginos 85.06
d2fcka1178 Putative ribosomal-protein-serine acetyltransferas 84.26
d2fsra1164 Probable acetyltranferase Atu2435 {Agrobacterium t 83.53
d1m36a_33 Monocytic leukemia zinc finger protein Moz {Human 81.08
>d2giva1 d.108.1.1 (A:4-274) Probable histone acetyltransferase MYST1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Acyl-CoA N-acyltransferases (Nat)
superfamily: Acyl-CoA N-acyltransferases (Nat)
family: N-acetyl transferase, NAT
domain: Probable histone acetyltransferase MYST1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=4.8e-64  Score=407.08  Aligned_cols=113  Identities=49%  Similarity=0.853  Sum_probs=111.2

Q ss_pred             chHHHHhhCCccCCCcceEEecCCeEEEEEeCCCChhhhhhhhHhhhhcccceeeeeeCCCceEEEEEEeCCCCcEEEEE
Q psy13714          2 TSRDVMIKCNLKHPPGNEIYRKDSISFFEIDGRKNKNYAQNLCLLAKLFLDHKTLHYDTDPFLFYIMTEQDSRGFHIVGI   81 (125)
Q Consensus         2 t~~~H~~~C~~~~PPG~eiYr~~~~si~EVdG~~~~~ycqnLcLlaKlFLd~Ktl~~dv~~F~FYVl~e~D~~G~h~vGy   81 (125)
                      ++++|+++|+++||||+||||++++|||||||+++++||||||||||||||||||||||+||+||||||.|+.|+|+|||
T Consensus        46 ~~~~H~~~C~~~~PPG~eIYr~~~~si~EVDG~~~~~yCqnLcLlaKLFLdhKtl~ydV~~F~FYVl~e~d~~g~h~vGY  125 (271)
T d2giva1          46 SYRFHLGQCQWRQPPGKEIYRKSNISVHEVDGKDHKIYCQNLCLLAKLFLDHKTLYFDVEPFVFYILTEVDRQGAHIVGY  125 (271)
T ss_dssp             HHHHHHHHCCCCSCSSEEEEEETTEEEEEEETTTSHHHHHHHHHHHHTTCSCCSCTTCCTTEEEEEEEEECSSCEEEEEE
T ss_pred             HHHHHHHhCCCcCCCcceEeecCCEEEEEeeCccchhhhhHHHHHHHHhcccceeeecCCceEEEEEEEecCCCceEEEe
Confidence            58899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EecchhhHHHHhhhhcCCCceeeEEEEEcCCCCCCCccccccc
Q psy13714         82 RKNDKTLAAQLLLLWSSSESVYIAWIVRLPWFDPRPRVDFILN  124 (125)
Q Consensus        82 FSkEk~~~~~~~~~~ss~~~~nLacI~vLP~yQ~kGyG~~LI~  124 (125)
                      |||||.          |+++||||||+|||+|||||||++||+
T Consensus       126 FSKEk~----------s~~~~NLsCIltlP~yQrkGyG~lLI~  158 (271)
T d2giva1         126 FSKEKE----------SPDGNNVACILTLPPYQRRGYGKFLIA  158 (271)
T ss_dssp             EEEESS----------CTTCEEESCEEECGGGCSSSHHHHHHH
T ss_pred             eeeEec----------cCCCceeeeeeccCHHHhcCHhHhHHh
Confidence            999999          889999999999999999999999996
>d2ozua1 d.108.1.1 (A:507-776) Histone acetyltransferase MYST3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fy7a_ d.108.1.1 (A:) Histone acetyltransferase ESA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1boba_ d.108.1.1 (A:) Histone acetyltransferase HAT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2aj6a1 d.108.1.1 (A:1-118) Hypothetical protein MW0638 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2atra1 d.108.1.1 (A:1-137) Probable acetyltransferase SP0256 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1yvka1 d.108.1.1 (A:5-156) Hypothetical protein YvbK (BSu33890) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1n71a_ d.108.1.1 (A:) Aminoglycoside 6'-N-acetyltransferase {Enterococcus faecium [TaxId: 1352]} Back     information, alignment and structure
>d1y9wa1 d.108.1.1 (A:1-140) Probable acetyltransferase BC2806 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2fiwa1 d.108.1.1 (A:2-157) Probable N-acetyltransferase RPA1999 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d1y9ka1 d.108.1.1 (A:1-152) IAA acetyltransferase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1y7ra1 d.108.1.1 (A:1-133) Hypothetical protein SA2161 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1ygha_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fl4a1 d.108.1.1 (A:1-146) Probable spermine/spermidine acetyltransferase EF1086 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1qsra_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Tetrahymena thermophila [TaxId: 5911]} Back     information, alignment and structure
>d2gana1 d.108.1.1 (A:1-182) Hypothetical protein PH0736 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1yvoa1 d.108.1.1 (A:4-172) Hypothetical protein PA4866 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1tiqa_ d.108.1.1 (A:) Protease synthase and sporulation negative regulatory protein PaiA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1z4ra1 d.108.1.1 (A:497-658) Catalytic domain of GCN5 histone acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jdca1 d.108.1.1 (A:2-146) Probable acetyltransferase YitI {Bacillus licheniformis [TaxId: 1402]} Back     information, alignment and structure
>d2g3aa1 d.108.1.1 (A:1-137) Probable acetyltransferase Atu2258 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1q2ya_ d.108.1.1 (A:) Probable acetyltransferase YjcF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1yx0a1 d.108.1.1 (A:1-151) Hypothetical protein YsnE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xeba_ d.108.1.1 (A:) Hypothetical protein PA0115 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2fiaa1 d.108.1.1 (A:1-157) Probable acetyltransferase EF1919 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1vkca_ d.108.1.1 (A:) Putative acetyltransferase PF0028 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1s3za_ d.108.1.1 (A:) Aminoglycoside N-acetyltransferase AAC(6')-IY {Salmonella enteritidis [TaxId: 149539]} Back     information, alignment and structure
>d1r57a_ d.108.1.1 (A:) Hypothetical protein SA2309 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1ufha_ d.108.1.1 (A:) Putative acetyltransferase YycN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1z4ea1 d.108.1.1 (A:4-153) Transcriptional regulator BH1968 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1bo4a_ d.108.1.1 (A:) Aminoglycoside 3-N-acetyltransferase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d2i6ca1 d.108.1.1 (A:1001-1160) Putative acetyltransferase PA4794 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1wwza1 d.108.1.1 (A:1-157) Hypothetical protein PH1933 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ghea_ d.108.1.1 (A:) Tabtoxin resistance protein {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d2fe7a1 d.108.1.1 (A:3-158) Probable N-acetyltransferase PA0478 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1yr0a1 d.108.1.1 (A:4-166) Phosphinothricin acetyltransferase {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1cjwa_ d.108.1.1 (A:) Serotonin N-acetyltranferase {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1vhsa_ d.108.1.1 (A:) Putative phosphinothricin acetyltransferase YwnH {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ae6a1 d.108.1.1 (A:1-161) Putative acetyltransferase EF0244 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1mk4a_ d.108.1.1 (A:) Hypothetical protein YqiY {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2cy2a1 d.108.1.1 (A:1-174) Probable acetyltransferase TTHA1209 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1u6ma_ d.108.1.1 (A:) Putative acetyltransferase EF0945 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1qsma_ d.108.1.1 (A:) Histone acetyltransferase HPA2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ge3a1 d.108.1.1 (A:6-169) Probable acetyltransferase Atu2290 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1i12a_ d.108.1.1 (A:) Glucosamine-phosphate N-acetyltransferase GNA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2beia1 d.108.1.1 (A:3-169) Diamine acetyltransferase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozga2 d.108.1.10 (A:8-290) Putative acetyltransferase Ava4977 {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d2hv2a2 d.108.1.10 (A:2-286) Hypothetical protein EF1021 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1m4ia_ d.108.1.1 (A:) Aminoglycoside 2'-N-acetyltransferase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nsla_ d.108.1.1 (A:) Probable acetyltransferase YdaF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2euia1 d.108.1.1 (A:1-153) Probable acetyltransferase PA4026 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2b5ga1 d.108.1.1 (A:3-169) Diamine acetyltransferase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sqha_ d.108.1.5 (A:) Hypothetical protein cg14615-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2i00a2 d.108.1.10 (A:10-300) Putative acetyltransferase EF2353 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1s7ka1 d.108.1.1 (A:3-176) L7/L12-Ribosomal-protein-serine acetyltransferase RimL {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1yrea1 d.108.1.1 (A:11-193) Hypothetical protein PA3270 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2fcka1 d.108.1.1 (A:1-178) Putative ribosomal-protein-serine acetyltransferase VC1889 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2fsra1 d.108.1.1 (A:4-167) Probable acetyltranferase Atu2435 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1m36a_ g.37.1.2 (A:) Monocytic leukemia zinc finger protein Moz {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure