Psyllid ID: psy13760

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240--
MVVSGVIASVLVVMVVSARQILASEDSLATRPPKVICHYTDIAFVGKVNKLILAIPTYGRTWVINKDTSRTGIPPLKVEGPGEKGPLVQEEGLLSYGEICSQLASLTDANASPTTLRRVPDTQKRMGTYAFRLPNKQLKQEYGIWVSYEDPETVGVKAAYAKQNGLAGVAMVDLSLDDFKGNCGENDYHIKSLDKELDTDKNKGHELYKQVTALKTSYPDLNIILGVGGFEDQKDKEKYLDL
cccccHHHHHHHEEEcccccccccccccccccHHHHHHHHHHHcccccccEEEccccccccEEEcccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccEEEccccccEEEEEEEcccccccccccEEEEEccHHHHHHHHHHHHHccccEEEEEEccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccc
ccHHHHHHHccEEEEEEEccccccccccccccccccHHHHHHHHHcccccEEEEEEccccEEEEEcccccccccccccccccccccccccccHHEHHHHHHHHcccccccccccccEEEEccccccccEEEEcccccccccccEEEEcccHHHHHHHHHHHHHccccEEEEEEEEcccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccEccc
MVVSGVIASVLVVMVVSARQIlasedslatrppkvichytdiafvGKVNKLILAIptygrtwvinkdtsrtgipplkvegpgekgplvqeegLLSYGEICSQLasltdanaspttlrrvpdtqkrmgtyafrlpnkqlkqeygiwvsyedpetvgVKAAYAKQNGLAGVAMVDLSlddfkgncgendyhiksldkeldtdknkghELYKQVTALktsypdlniilgvggfedqkdkekyldl
MVVSGVIASVLVVMVVSARQILasedslatrppkVICHYTDIAFVGKVNKLILAIPtygrtwvinkdtsrtgipplkvegpgekgPLVQEEGLLSYGEICSQLAsltdanaspttlrrvpdtqkrmgtyafrlpnkqlkqEYGIWVSYEDPETVGVKAAYAKQNGLAGVAMVDLSLDDFKGNCGENDYHIKSLDKELDTDKNKGHELYKQVtalktsypdLNIILgvggfedqkdkekyldl
MvvsgviasvlvvmvvsARQILASEDSLATRPPKVICHYTDIAFVGKVNKLILAIPTYGRTWVINKDTSRTGIPPLKVEGPGEKGPLVQEEGLLSYGEICSQLASLTDANASPTTLRRVPDTQKRMGTYAFRLPNKQLKQEYGIWVSYEDPETVGVKAAYAKQNGLAGVAMVDLSLDDFKGNCGENDYHIKSLDKELDTDKNKGHELYKQVTALKTSYPDLNIILGVGGFEDQKDKEKYLDL
**VSGVIASVLVVMVVSARQILASEDSLATRPPKVICHYTDIAFVGKVNKLILAIPTYGRTWVINKDT**********************EGLLSYGEICSQLASL*******************MGTYAFRLPNKQLKQEYGIWVSYEDPETVGVKAAYAKQNGLAGVAMVDLSLDDFKGNCGENDYHIKSLDK********GHELYKQVTALKTSYPDLNIILGVGGF************
**VSGVIASVLVVMVVSARQILASEDSLATRPPKVICHYTDIAFVGKVNKLILAIPTYGRTWVINKDTSRTGIPPLKVEGPGEKGPLVQEEGLLSYGEICSQLASLTDANASPTTLRRVPDTQKRMGTYAFRLPNKQLKQEYGIWVSYEDPETVGVKAAYAKQNGLAGVAMVDLSLDDFKGNCGENDYHIKSLDKE***************************ILGVGGFEDQKD***YLDL
MVVSGVIASVLVVMVVSARQILASEDSLATRPPKVICHYTDIAFVGKVNKLILAIPTYGRTWVINKDTSRTGIPPLKVEGPGEKGPLVQEEGLLSYGEICSQLASLTDANASPTTLRRVPDTQKRMGTYAFRLPNKQLKQEYGIWVSYEDPETVGVKAAYAKQNGLAGVAMVDLSLDDFKGNCGENDYHIKSLDKELDTDKNKGHELYKQVTALKTSYPDLNIILGVGGFEDQ*********
MVVSGVIASVLVVMVVSARQILASEDSLATRPPKVICHYTDIAFVGKVNKLILAIPTYGRTWVINKDTSRTGIPPLKVEGPGEKGPLVQEEGLLSYGEICSQLASLTDANASPTTLRRVPDTQKRMGTYAFRLPNKQLKQEYGIWVSYEDPETVGVKAAYAKQNGLAGVAMVDLSLDDFKGNCGENDYHIKSLDKELDTDK****************************FEDQKDKE*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVVSGVIASVLVVMVVSARQILASEDSLATRPPKVICHYTDIAFVGKVNKLILAIPTYGRTWVINKDTSRTGIPPLKVEGPGEKGPLVQEEGLLSYGEICSQLASLTDANASPTTLRRVPDTQKRMGTYAFRLPNKQLKQEYGIWVSYEDPETVGVKAAYAKQNGLAGVAMVDLSLDDFKGNCGENDYHIKSLDKELDTDKNKGHELYKQVTALKTSYPDLNIILGVGGFEDQKDKEKYLDL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query242 2.2.26 [Sep-21-2011]
Q9GV28433 Chitinase-like protein EN N/A N/A 0.504 0.281 0.540 3e-31
Q2PQM6440 Chitinase-like protein Id N/A N/A 0.694 0.381 0.382 3e-30
Q2PQM7444 Chitinase-like protein Id N/A N/A 0.582 0.317 0.458 1e-29
Q8MLZ7441 Chitinase-like protein Id yes N/A 0.574 0.315 0.402 1e-27
Q8MX32441 Chitinase-like protein Id N/A N/A 0.553 0.303 0.424 1e-27
Q8MX31441 Chitinase-like protein Id N/A N/A 0.574 0.315 0.402 9e-27
Q9W303442 Chitinase-like protein Id no N/A 0.652 0.357 0.391 2e-26
Q9V3D4440 Chitinase-like protein Id no N/A 0.570 0.313 0.442 2e-26
Q8T0R7444 Chitinase-like protein Id no N/A 0.578 0.315 0.402 8e-23
Q23997452 Chitinase-like protein CG no N/A 0.566 0.303 0.418 9e-23
>sp|Q9GV28|IDGFL_BOMMO Chitinase-like protein EN03 OS=Bombyx mori GN=EN03 PE=1 SV=1 Back     alignment and function desciption
 Score =  135 bits (339), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 81/124 (65%), Gaps = 2/124 (1%)

Query: 67  DTSRTGIPPLKVEGPGEKGPLVQEEGLLSYGEICSQLASLTDANASPTTLRRVPDTQKRM 126
           D+   G+PP+  +GPGE GP V+ EGLLSY E+C +L +          LR+V D  KR 
Sbjct: 304 DSEIAGVPPIHTDGPGEAGPYVKTEGLLSYPEVCGKLINPNQQKGMRPHLRKVTDPSKRF 363

Query: 127 GTYAFRLPNKQLKQEYGIWVSYEDPETVGVKAAYAKQNGLAGVAMVDLSLDDFKGNCGEN 186
           GTYAFRLP+     E GIWVSYEDP+T G KAAY K   L GVA+VDLSLDDF+G C  +
Sbjct: 364 GTYAFRLPDDN--GEGGIWVSYEDPDTAGQKAAYVKSKNLGGVAIVDLSLDDFRGLCTGD 421

Query: 187 DYHI 190
            Y I
Sbjct: 422 KYPI 425

Bombyx mori (taxid: 7091)
>sp|Q2PQM6|IDGF5_GLOMM Chitinase-like protein Idgf5 OS=Glossina morsitans morsitans GN=Idgf5 PE=2 SV=1 Back     alignment and function description
>sp|Q2PQM7|IDGF4_GLOMM Chitinase-like protein Idgf4 OS=Glossina morsitans morsitans GN=Idgf4 PE=2 SV=1 Back     alignment and function description
>sp|Q8MLZ7|IDGF3_DROME Chitinase-like protein Idgf3 OS=Drosophila melanogaster GN=Idgf3 PE=1 SV=3 Back     alignment and function description
>sp|Q8MX32|IDGF3_DROSI Chitinase-like protein Idgf3 OS=Drosophila simulans GN=Idgf3 PE=3 SV=1 Back     alignment and function description
>sp|Q8MX31|IDGF3_DROYA Chitinase-like protein Idgf3 OS=Drosophila yakuba GN=Idgf3 PE=3 SV=1 Back     alignment and function description
>sp|Q9W303|IDGF4_DROME Chitinase-like protein Idgf4 OS=Drosophila melanogaster GN=Idgf4 PE=2 SV=1 Back     alignment and function description
>sp|Q9V3D4|IDGF2_DROME Chitinase-like protein Idgf2 OS=Drosophila melanogaster GN=Idgf2 PE=1 SV=1 Back     alignment and function description
>sp|Q8T0R7|IDGF5_DROME Chitinase-like protein Idgf5 OS=Drosophila melanogaster GN=Idgf5 PE=2 SV=3 Back     alignment and function description
>sp|Q23997|C5210_DROME Chitinase-like protein CG5210 OS=Drosophila melanogaster GN=CG5210 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query242
274327724 442 imaginal disk growth factor precursor [A 0.603 0.330 0.516 1e-36
152061158 434 imaginal disk growth factor [Bombyx mori 0.574 0.320 0.531 1e-35
55978158 442 putative IDGF [Diaprepes abbreviatus] 0.574 0.314 0.521 4e-35
113206046 431 imaginal disc growth factor 4 precursor 0.578 0.324 0.524 1e-34
389608675 393 imaginal disc growth factor 4 [Papilio x 0.574 0.353 0.489 4e-34
85726208 433 imaginal disc growth factor-like protein 0.574 0.321 0.496 4e-34
357625069 434 hemocyte aggregation inhibitor protein p 0.574 0.320 0.496 5e-34
389610773 434 imaginal disc growth factor 4 [Papilio p 0.574 0.320 0.482 1e-33
113206042 439 imaginal disc growth factor 2 precursor 0.574 0.316 0.485 1e-33
47607477 433 imaginal disc growth factor [Pieris rapa 0.578 0.323 0.485 1e-33
>gi|274327724|ref|NP_001162142.1| imaginal disk growth factor precursor [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  159 bits (401), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 77/149 (51%), Positives = 97/149 (65%), Gaps = 3/149 (2%)

Query: 42  IAFVGKVNKLILAIPTYGRTWVINKDTSRTGIPPLKVEGPGEKGPLVQEEGLLSYGEICS 101
           IA      KL+L I TYGRTW ++KD+ ++G  P+  +GPGE+G   + EGLL+Y EIC 
Sbjct: 289 IALKADRGKLVLGISTYGRTWKMDKDSGKSGAAPVTADGPGEEGTYTKTEGLLAYYEICP 348

Query: 102 QLASLTDANASPTTLRRVPDTQKRMGTYAFRLPNKQLKQEYGIWVSYEDPETVGVKAAYA 161
            L   T A  S T  RRVPD  K +GTYAFRLP   +K   GIW+S+E+PET   KA Y 
Sbjct: 349 HLVESTAATTSLTLYRRVPDPSKNLGTYAFRLPKDDVK---GIWISFEEPETAKQKATYV 405

Query: 162 KQNGLAGVAMVDLSLDDFKGNCGENDYHI 190
           KQN L G+A++DLSLDD +G C  N Y I
Sbjct: 406 KQNNLGGIALMDLSLDDARGLCDANKYPI 434

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|152061158|dbj|BAF73623.1| imaginal disk growth factor [Bombyx mori] Back     alignment and taxonomy information
>gi|55978158|gb|AAV68692.1| putative IDGF [Diaprepes abbreviatus] Back     alignment and taxonomy information
>gi|113206046|ref|NP_001038091.1| imaginal disc growth factor 4 precursor [Tribolium castaneum] gi|109895320|gb|ABG47452.1| imaginal disc growth factor 4 [Tribolium castaneum] gi|270007356|gb|EFA03804.1| hypothetical protein TcasGA2_TC013917 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|389608675|dbj|BAM17947.1| imaginal disc growth factor 4 [Papilio xuthus] Back     alignment and taxonomy information
>gi|85726208|gb|ABC79625.1| imaginal disc growth factor-like protein [Mamestra brassicae] Back     alignment and taxonomy information
>gi|357625069|gb|EHJ75621.1| hemocyte aggregation inhibitor protein precursor [Danaus plexippus] Back     alignment and taxonomy information
>gi|389610773|dbj|BAM18997.1| imaginal disc growth factor 4 [Papilio polytes] Back     alignment and taxonomy information
>gi|113206042|ref|NP_001038092.1| imaginal disc growth factor 2 precursor [Tribolium castaneum] gi|109895318|gb|ABG47451.1| imaginal disc growth factor 2 [Tribolium castaneum] gi|270007357|gb|EFA03805.1| hypothetical protein TcasGA2_TC013918 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|47607477|gb|AAT36640.1| imaginal disc growth factor [Pieris rapae] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query242
UNIPROTKB|Q9GV28433 EN03 "Chitinase-like protein E 0.504 0.281 0.540 8.8e-31
FB|FBgn0020414441 Idgf3 "Imaginal disc growth fa 0.561 0.308 0.422 1e-27
UNIPROTKB|Q8MX32441 Idgf3 "Chitinase-like protein 0.549 0.301 0.427 1.3e-27
FB|FBgn0026415442 Idgf4 "Imaginal disc growth fa 0.561 0.307 0.425 3.5e-27
UNIPROTKB|Q8MX31441 Idgf3 "Chitinase-like protein 0.561 0.308 0.422 5.7e-27
FB|FBgn0020415440 Idgf2 "Imaginal disc growth fa 0.570 0.313 0.442 9.4e-27
FB|FBgn0013763452 CG5210 [Drosophila melanogaste 0.578 0.309 0.4 7.5e-24
UNIPROTKB|Q8MX41439 Idgf1 "Chitinase-like protein 0.574 0.316 0.406 3e-23
FB|FBgn0064237444 Idgf5 "Imaginal disc growth fa 0.607 0.331 0.401 7.1e-23
UNIPROTKB|Q8MX40439 Idgf1 "Chitinase-like protein 0.586 0.323 0.402 1.9e-22
UNIPROTKB|Q9GV28 EN03 "Chitinase-like protein EN03" [Bombyx mori (taxid:7091)] Back     alignment and assigned GO terms
 Score = 339 (124.4 bits), Expect = 8.8e-31, P = 8.8e-31
 Identities = 67/124 (54%), Positives = 81/124 (65%)

Query:    67 DTSRTGIPPLKVEGPGEKGPLVQEEGLLSYGEICSQLASLTDANASPTTLRRVPDTQKRM 126
             D+   G+PP+  +GPGE GP V+ EGLLSY E+C +L +          LR+V D  KR 
Sbjct:   304 DSEIAGVPPIHTDGPGEAGPYVKTEGLLSYPEVCGKLINPNQQKGMRPHLRKVTDPSKRF 363

Query:   127 GTYAFRLPNKQLKQEYGIWVSYEDPETVGVKAAYAKQNGLAGVAMVDLSLDDFKGNCGEN 186
             GTYAFRLP+     E GIWVSYEDP+T G KAAY K   L GVA+VDLSLDDF+G C  +
Sbjct:   364 GTYAFRLPDDN--GEGGIWVSYEDPDTAGQKAAYVKSKNLGGVAIVDLSLDDFRGLCTGD 421

Query:   187 DYHI 190
              Y I
Sbjct:   422 KYPI 425
GO:0003674 "molecular_function" evidence=ND
GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
FB|FBgn0020414 Idgf3 "Imaginal disc growth factor 3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q8MX32 Idgf3 "Chitinase-like protein Idgf3" [Drosophila simulans (taxid:7240)] Back     alignment and assigned GO terms
FB|FBgn0026415 Idgf4 "Imaginal disc growth factor 4" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q8MX31 Idgf3 "Chitinase-like protein Idgf3" [Drosophila yakuba (taxid:7245)] Back     alignment and assigned GO terms
FB|FBgn0020415 Idgf2 "Imaginal disc growth factor 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0013763 CG5210 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q8MX41 Idgf1 "Chitinase-like protein Idgf1" [Drosophila simulans (taxid:7240)] Back     alignment and assigned GO terms
FB|FBgn0064237 Idgf5 "Imaginal disc growth factor 5" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q8MX40 Idgf1 "Chitinase-like protein Idgf1" [Drosophila yakuba (taxid:7245)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query242
cd02873413 cd02873, GH18_IDGF, The IDGF's (imaginal disc grow 1e-56
cd02872362 cd02872, GH18_chitolectin_chitotriosidase, This co 1e-28
smart00636334 smart00636, Glyco_18, Glyco_18 domain 3e-20
pfam00704325 pfam00704, Glyco_hydro_18, Glycosyl hydrolases fam 2e-12
cd02873 413 cd02873, GH18_IDGF, The IDGF's (imaginal disc grow 2e-09
COG3325441 COG3325, ChiA, Chitinase [Carbohydrate transport a 9e-07
cd06548322 cd06548, GH18_chitinase, The GH18 (glycosyl hydrol 2e-06
cd02872 362 cd02872, GH18_chitolectin_chitotriosidase, This co 5e-06
cd02879299 cd02879, GH18_plant_chitinase_class_V, The class V 4e-04
cd02875358 cd02875, GH18_chitobiase, Chitobiase (also known a 0.002
>gnl|CDD|119352 cd02873, GH18_IDGF, The IDGF's (imaginal disc growth factors) are a family of growth factors identified in insects that include at least five members, some of which are encoded by genes in a tight cluster Back     alignment and domain information 
 Score =  185 bits (472), Expect = 1e-56
 Identities = 71/143 (49%), Positives = 94/143 (65%), Gaps = 3/143 (2%)

Query: 49  NKLILAIPTYGRTWVINKDTSRTGIPP-LKVEGPGEKGPLVQEEGLLSYGEICSQLASLT 107
           +KL L I TYGR W + KD+  TG+PP L+ +GPG  GP  +  GLLS+ EICS+L +  
Sbjct: 265 SKLNLGIATYGRAWKLTKDSGITGVPPVLETDGPGPAGPQTKTPGLLSWPEICSKLPNPA 324

Query: 108 DANASPTTLRRVPDTQKRMGTYAFRLPNKQLKQEYGIWVSYEDPETVGVKAAYAKQNGLA 167
           +   +   LR+V D  KR G+YA+R  ++    E+GIWVSYEDP+T   KA YAK  GL 
Sbjct: 325 NLKGADAPLRKVGDPTKRFGSYAYRPADEN--GEHGIWVSYEDPDTAANKAGYAKAKGLG 382

Query: 168 GVAMVDLSLDDFKGNCGENDYHI 190
           GVA+ DLSLDDF+G C  + + I
Sbjct: 383 GVALFDLSLDDFRGQCTGDKFPI 405

The IDGF's have an eight-stranded alpha/beta barrel fold and are related to the glycosyl hydrolase family 18 (GH18) chitinases, but they have an amino acid substitution known to abolish chitinase catalytic activity. IDGFs may have evolved from chitinases to gain new functions as growth factors, interacting with cell surface glycoproteins involved in growth-promoting processes. Length = 413
>gnl|CDD|119351 cd02872, GH18_chitolectin_chitotriosidase, This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases Back     alignment and domain information
>gnl|CDD|214753 smart00636, Glyco_18, Glyco_18 domain Back     alignment and domain information
>gnl|CDD|216071 pfam00704, Glyco_hydro_18, Glycosyl hydrolases family 18 Back     alignment and domain information
>gnl|CDD|119352 cd02873, GH18_IDGF, The IDGF's (imaginal disc growth factors) are a family of growth factors identified in insects that include at least five members, some of which are encoded by genes in a tight cluster Back     alignment and domain information
>gnl|CDD|225862 COG3325, ChiA, Chitinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|119365 cd06548, GH18_chitinase, The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites Back     alignment and domain information
>gnl|CDD|119351 cd02872, GH18_chitolectin_chitotriosidase, This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases Back     alignment and domain information
>gnl|CDD|119358 cd02879, GH18_plant_chitinase_class_V, The class V plant chitinases have a glycosyl hydrolase family 18 (GH18) domain, but lack the chitin-binding domain present in other GH18 enzymes Back     alignment and domain information
>gnl|CDD|119354 cd02875, GH18_chitobiase, Chitobiase (also known as di-N-acetylchitobiase) is a lysosomal glycosidase that hydrolyzes the reducing-end N-acetylglucosamine from the chitobiose core of oligosaccharides during the ordered degradation of asparagine-linked glycoproteins in eukaryotes Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 242
cd02873413 GH18_IDGF The IDGF's (imaginal disc growth factors 100.0
cd02872362 GH18_chitolectin_chitotriosidase This conserved do 100.0
KOG2806|consensus432 99.98
cd02878345 GH18_zymocin_alpha Zymocin, alpha subunit. Zymocin 99.96
smart00636334 Glyco_18 Glycosyl hydrolase family 18. 99.96
cd02875358 GH18_chitobiase Chitobiase (also known as di-N-ace 99.96
COG3325441 ChiA Chitinase [Carbohydrate transport and metabol 99.95
cd02879299 GH18_plant_chitinase_class_V The class V plant chi 99.93
cd02874313 GH18_CFLE_spore_hydrolase Cortical fragment-lytic 99.92
PF00704343 Glyco_hydro_18: Glycosyl hydrolases family 18; Int 99.92
cd06548322 GH18_chitinase The GH18 (glycosyl hydrolases, fami 99.92
cd02876318 GH18_SI-CLP Stabilin-1 interacting chitinase-like 99.9
cd06549298 GH18_trifunctional GH18 domain of an uncharacteriz 99.85
COG3858423 Predicted glycosyl hydrolase [General function pre 99.74
cd06545253 GH18_3CO4_chitinase The Bacteroides thetaiotaomicr 99.6
KOG2091|consensus392 98.2
cd00598210 GH18_chitinase-like The GH18 (glycosyl hydrolase, 96.92
cd06544253 GH18_narbonin Narbonin is a plant 2S protein from 95.57
cd06544 253 GH18_narbonin Narbonin is a plant 2S protein from 91.72
cd02873 413 GH18_IDGF The IDGF's (imaginal disc growth factors 87.5
cd06548 322 GH18_chitinase The GH18 (glycosyl hydrolases, fami 83.17
>cd02873 GH18_IDGF The IDGF's (imaginal disc growth factors) are a family of growth factors identified in insects that include at least five members, some of which are encoded by genes in a tight cluster Back     alignment and domain information 
Probab=100.00  E-value=5.9e-39  Score=298.12  Aligned_cols=190  Identities=41%  Similarity=0.705  Sum_probs=154.6

Q ss_pred             hhhhhhhhhhhhhhhhccCCCCC-CCCCCccccc---------------hhhhccCCCCcceEEeeecceeeEEecCCCC
Q psy13760          6 VIASVLVVMVVSARQILASEDSL-ATRPPKVICH---------------YTDIAFVGKVNKLILAIPTYGRTWVINKDTS   69 (242)
Q Consensus         6 ~~~~~l~~~~~~~~d~~g~~~s~-~~g~~a~l~~---------------y~~~~~Gvp~~KLvLGiP~YGr~~~~~~~~~   69 (242)
                      .|+.++|++.+|+||++|+|+.. .+++++||+.               ++ +++|+|++|||||||||||.|+++++..
T Consensus       207 ~l~~~vD~inlMtYD~~g~~~~~~~~~~~apL~~~~~~~~~~~v~~~v~~~-~~~gvp~~KlvlGip~YGr~w~l~~~~~  285 (413)
T cd02873         207 AIANNVDFVNLATFDFLTPERNPEEADYTAPIYELYERNPHHNVDYQVKYW-LNQGTPASKLNLGIATYGRAWKLTKDSG  285 (413)
T ss_pred             HHhhcCCEEEEEEecccCCCCCCCccCcCCccCCCccccccccHHHHHHHH-HHcCCCHHHeEEEEecceeeeEccCCCC
Confidence            58999999999999999998864 6889998752               12 7889999999999999999999987543


Q ss_pred             CCCCCC-CCcCCCCCCCCCCCCCccccHHHHHHHhhcCCCCCCCCCceeEeecCCCCceeEEEeCCCccccCcccEEEEe
Q psy13760         70 RTGIPP-LKVEGPGEKGPLVQEEGLLSYGEICSQLASLTDANASPTTLRRVPDTQKRMGTYAFRLPNKQLKQEYGIWVSY  148 (242)
Q Consensus        70 ~~g~~~-~~~~gp~~~g~~~~~~G~~~y~eI~~~l~~~~~~~g~~~~~~~~~D~~~~~~py~~~~~~~~~~~~~~~wisy  148 (242)
                      ..+.+. +++.||+.+|+++.++|.++|.|||..+.......|+...|++.||++.+.+||+|+..+.+  +++++||+|
T Consensus       286 ~~g~~~~~~~~g~~~~G~~~~~~g~l~y~ei~~~~~~~~~~~g~~~~~~~~~d~~~~~~~y~y~~~d~~--~~~~~wvsy  363 (413)
T cd02873         286 ITGVPPVLETDGPGPAGPQTKTPGLLSWPEICSKLPNPANLKGADAPLRKVGDPTKRFGSYAYRPADEN--GEHGIWVSY  363 (413)
T ss_pred             CcCCCCCccCCCCCCCCCCcCCCccccHHHHHHhhccCccccccccceeEeecccccccceEEeccccC--CCCCeEEEe
Confidence            334432 25688889999999999999999999876532111222346788998765459998743321  345789999


Q ss_pred             CCHHHHHHHHHHHHHcCCCeEEEeeCCCCCCCCCCCCCcccccccccccc
Q psy13760        149 EDPETVGVKAAYAKQNGLAGVAMVDLSLDDFKGNCGENDYHIKSLDKELD  198 (242)
Q Consensus       149 Dd~~Si~~K~~y~~~~gLgGv~vW~l~~Dd~~g~C~~~~~pLl~ai~~~l  198 (242)
                      ||++||+.|++||+++||||+|+|++++|||+|.|+++.+|||++|+..|
T Consensus       364 dd~~Si~~K~~y~~~~gLgGv~~W~l~~DD~~g~c~~~~~pll~~i~~~~  413 (413)
T cd02873         364 EDPDTAANKAGYAKAKGLGGVALFDLSLDDFRGQCTGDKFPILRSAKYRL  413 (413)
T ss_pred             CCHHHHHHHHHHHHhCCCceEEEEeeecCcCCCCcCCCCChHHHHHHhhC
Confidence            99999999999999999999999999999999999878999999998754

The IDGF's have an eight-stranded alpha/beta barrel fold and are related to the glycosyl hydrolase family 18 (GH18) chitinases, but they have an amino acid substitution known to abolish chitinase catalytic activity. IDGFs may have evolved from chitinases to gain new functions as growth factors, interacting with cell surface glycoproteins involved in growth-promoting processes.
>cd02872 GH18_chitolectin_chitotriosidase This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases Back     alignment and domain information
>KOG2806|consensus Back     alignment and domain information
>cd02878 GH18_zymocin_alpha Zymocin, alpha subunit Back     alignment and domain information
>smart00636 Glyco_18 Glycosyl hydrolase family 18 Back     alignment and domain information
>cd02875 GH18_chitobiase Chitobiase (also known as di-N-acetylchitobiase) is a lysosomal glycosidase that hydrolyzes the reducing-end N-acetylglucosamine from the chitobiose core of oligosaccharides during the ordered degradation of asparagine-linked glycoproteins in eukaryotes Back     alignment and domain information
>COG3325 ChiA Chitinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd02879 GH18_plant_chitinase_class_V The class V plant chitinases have a glycosyl hydrolase family 18 (GH18) domain, but lack the chitin-binding domain present in other GH18 enzymes Back     alignment and domain information
>cd02874 GH18_CFLE_spore_hydrolase Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination Back     alignment and domain information
>PF00704 Glyco_hydro_18: Glycosyl hydrolases family 18; InterPro: IPR001223 O-Glycosyl hydrolases 3 Back     alignment and domain information
>cd06548 GH18_chitinase The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites Back     alignment and domain information
>cd02876 GH18_SI-CLP Stabilin-1 interacting chitinase-like protein (SI-CLP) is a eukaryotic chitinase-like protein of unknown function that interacts with the endocytic/sorting transmembrane receptor stabilin-1 and is secreted from the lysosome Back     alignment and domain information
>cd06549 GH18_trifunctional GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain Back     alignment and domain information
>COG3858 Predicted glycosyl hydrolase [General function prediction only] Back     alignment and domain information
>cd06545 GH18_3CO4_chitinase The Bacteroides thetaiotaomicron protein represented by pdb structure 3CO4 is an uncharacterized bacterial member of the family 18 glycosyl hydrolases with homologs found in Flavobacterium, Stigmatella, and Pseudomonas Back     alignment and domain information
>KOG2091|consensus Back     alignment and domain information
>cd00598 GH18_chitinase-like The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods Back     alignment and domain information
>cd06544 GH18_narbonin Narbonin is a plant 2S protein from the globulin fraction of narbon bean (Vicia narbonensis L Back     alignment and domain information
>cd06544 GH18_narbonin Narbonin is a plant 2S protein from the globulin fraction of narbon bean (Vicia narbonensis L Back     alignment and domain information
>cd02873 GH18_IDGF The IDGF's (imaginal disc growth factors) are a family of growth factors identified in insects that include at least five members, some of which are encoded by genes in a tight cluster Back     alignment and domain information
>cd06548 GH18_chitinase The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query242
1jnd_A420 Crystal Structure Of Imaginal Disc Growth Factor-2 2e-27
2esc_A361 Crystal Structure Of A 40 Kda Protective Signalling 1e-16
1sr0_A361 Crystal Structure Of Signalling Protein From Sheep( 1e-15
2pi6_A361 Crystal Structure Of The Sheep Signalling Glycoprot 1e-15
1zbv_A361 Crystal Structure Of The Goat Signalling Protein (S 2e-15
1syt_A361 Crystal Structure Of Signalling Protein From Goat S 3e-15
1ljy_A361 Crystal Structure Of A Novel Regulatory 40 Kda Mamm 3e-15
1xhg_A361 Crystal Structure Of A 40 Kda Signalling Protein Fr 3e-15
1owq_A361 Crystal Structure Of A 40 Kda Signalling Protein (S 4e-15
1tfv_A361 Crystal Structure Of A Buffalo Signaling Glycoprote 1e-14
1hkk_A364 High Resoultion Crystal Structure Of Human Chitinas 2e-14
1hki_A365 Crystal Structure Of Human Chitinase In Complex Wit 2e-14
1lg1_A365 Crystal Structure Of Human Chitotriosidase In Compl 2e-14
1guv_A366 Structure Of Human Chitotriosidase Length = 366 2e-14
1waw_A445 Specificity And Affinity Of Natural Product Cyclope 3e-14
1hjv_A362 Crystal Structure Of Hcgp-39 In Complex With Chitin 2e-12
4ay1_A365 Human Ykl-39 Is A Pseudo-Chitinase With Retained Ch 5e-10
3fxy_A395 Acidic Mammalian Chinase, Catalytic Domain Length = 1e-09
2ybt_A381 Crystal Structure Of Human Acidic Chitinase In Comp 1e-09
1e9l_A377 The Crystal Structure Of Novel Mammalian Lectin Ym1 3e-09
>pdb|1JND|A Chain A, Crystal Structure Of Imaginal Disc Growth Factor-2 Length = 420 Back     alignment and structure 
Iteration: 1

 Score =  119 bits (297), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 65/147 (44%), Positives = 88/147 (59%), Gaps = 9/147 (6%)
Query: 49  NKLILAIPTYGRTWVINKDTSRTGIPPL-KVEGPGEKGPLVQEEGLLSYGEICSQLAS-- 105
           NK+ L + TYG  W + KD+   G+P + +  GP  +G   Q+ GLLSY EIC +L++  
Sbjct: 270 NKINLGVATYGNAWKLTKDSGLEGVPVVPETSGPAPEGFQSQKPGLLSYAEICGKLSNPQ 329
Query: 106 --LTDANASPTTLRRVPDTQKRMGTYAFRLPNKQLKQEYGIWVSYEDPETVGVKAAYAKQ 163
                 N SP  LRRV D  KR G  A+R  + Q+ +  GIWVSY+DP++   KAAYA+ 
Sbjct: 330 NQFLKGNESP--LRRVSDPTKRFGGIAYRPVDGQITE--GIWVSYDDPDSASNKAAYARV 385
Query: 164 NGLAGVAMVDLSLDDFKGNCGENDYHI 190
             L GVA+ DLS DDF+G C  + Y I
Sbjct: 386 KNLGGVALFDLSYDDFRGQCSGDKYPI 412
>pdb|2ESC|A Chain A, Crystal Structure Of A 40 Kda Protective Signalling Protein From Bovine (Spc-40) At 2.1 A Resolution Length = 361 Back     alignment and structure
>pdb|1SR0|A Chain A, Crystal Structure Of Signalling Protein From Sheep(Sps-40) At 3.0a Resolution Using Crystal Grown In The Presence Of Polysaccharides Length = 361 Back     alignment and structure
>pdb|2PI6|A Chain A, Crystal Structure Of The Sheep Signalling Glycoprotein (Sps-40) Complex With 2-Methyl-2-4-Pentanediol At 1.65a Resolution Reveals Specific Binding Characteristics Of Sps-40 Length = 361 Back     alignment and structure
>pdb|1ZBV|A Chain A, Crystal Structure Of The Goat Signalling Protein (Spg-40) Complexed With A Designed Peptide Trp-Pro-Trp At 3.2a Resolution Length = 361 Back     alignment and structure
>pdb|1SYT|A Chain A, Crystal Structure Of Signalling Protein From Goat Spg-40 In The Presense Of N,n',n''-triacetyl-chitotriose At 2.6a Resolution Length = 361 Back     alignment and structure
>pdb|1LJY|A Chain A, Crystal Structure Of A Novel Regulatory 40 Kda Mammary Gland Protein (Mgp-40) Secreted During Involution Length = 361 Back     alignment and structure
>pdb|1XHG|A Chain A, Crystal Structure Of A 40 Kda Signalling Protein From Porcine (spp-40) At 2.89a Resolution Length = 361 Back     alignment and structure
>pdb|1OWQ|A Chain A, Crystal Structure Of A 40 Kda Signalling Protein (Spc-40) Secreted During Involution Length = 361 Back     alignment and structure
>pdb|1TFV|A Chain A, Crystal Structure Of A Buffalo Signaling Glycoprotein (Spb-40) Secreted During Involution Length = 361 Back     alignment and structure
>pdb|1HKK|A Chain A, High Resoultion Crystal Structure Of Human Chitinase In Complex With Allosamidin Length = 364 Back     alignment and structure
>pdb|1HKI|A Chain A, Crystal Structure Of Human Chitinase In Complex With Glucoallosamidin B Length = 365 Back     alignment and structure
>pdb|1LG1|A Chain A, Crystal Structure Of Human Chitotriosidase In Complex With Chitobiose Length = 365 Back     alignment and structure
>pdb|1GUV|A Chain A, Structure Of Human Chitotriosidase Length = 366 Back     alignment and structure
>pdb|1WAW|A Chain A, Specificity And Affinity Of Natural Product Cyclopentapeptide Inhibitor Argadin Against Human Chitinase Length = 445 Back     alignment and structure
>pdb|1HJV|A Chain A, Crystal Structure Of Hcgp-39 In Complex With Chitin Tetramer Length = 362 Back     alignment and structure
>pdb|4AY1|A Chain A, Human Ykl-39 Is A Pseudo-Chitinase With Retained Chitooligosaccharide Binding Properties Length = 365 Back     alignment and structure
>pdb|3FXY|A Chain A, Acidic Mammalian Chinase, Catalytic Domain Length = 395 Back     alignment and structure
>pdb|2YBT|A Chain A, Crystal Structure Of Human Acidic Chitinase In Complex With Bisdionin C Length = 381 Back     alignment and structure
>pdb|1E9L|A Chain A, The Crystal Structure Of Novel Mammalian Lectin Ym1 Suggests A Saccharide Binding Site Length = 377 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query242
1jnd_A420 Imaginal DISC growth factor-2; IDGF, chitinase, in 1e-38
1jnd_A 420 Imaginal DISC growth factor-2; IDGF, chitinase, in 2e-06
4ay1_A365 Chitinase-3-like protein 2; chilectin, lectin, chi 5e-33
2pi6_A361 Chitinase-3-like protein 1; complex, signaling pro 1e-31
2pi6_A 361 Chitinase-3-like protein 1; complex, signaling pro 5e-04
1vf8_A377 YM1, secretory protein; chitinase, CHI-lectin, str 1e-30
1wb0_A445 Chitinase 1, chitotriosidase 1; cyclopentapeptide 4e-30
3fy1_A395 Amcase, TSA1902, acidic mammalian chitinase; struc 7e-29
3alf_A353 Chitinase, class V; hydrolase; 1.20A {Nicotiana ta 2e-25
3aqu_A356 AT4G19810; stress response, TIM barrel, hydrolase, 8e-24
3qok_A420 Putative chitinase II; structural genomics, PSI-bi 2e-22
1goi_A499 Chitinase B; chitin degradation, hydrolase, glycos 4e-21
1goi_A 499 Chitinase B; chitin degradation, hydrolase, glycos 7e-04
1itx_A419 Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) 1e-20
1itx_A 419 Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) 6e-04
3arx_A584 Chitinase A; TIM barrel, inhibitor complex, glycos 2e-20
3oa5_A574 CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yers 3e-19
3oa5_A 574 CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yers 2e-04
3g6m_A406 Chitinase, crchi1; inhibitor, caffeine, glycosidas 4e-19
1ll7_A392 Chitinase 1; beta-alpha barrel, hydrolase; 2.00A { 4e-19
1ll7_A 392 Chitinase 1; beta-alpha barrel, hydrolase; 2.00A { 9e-04
1edq_A540 Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1 7e-19
1edq_A 540 Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1 6e-04
1kfw_A435 Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrob 9e-19
1w9p_A433 Chitinase; peptide inhibitors, argifin, argadin, g 1e-18
1w9p_A 433 Chitinase; peptide inhibitors, argifin, argadin, g 1e-04
3fnd_A312 Chitinase; TIM-barrel, structural genomics, PSI-2, 3e-16
3cz8_A319 Putative sporulation-specific glycosylase YDHD; st 1e-13
3bxw_B393 Chitinase domain-containing protein 1; TIM barrel, 3e-07
>1jnd_A Imaginal DISC growth factor-2; IDGF, chitinase, insulin recep heparin, hormone-growth factor complex; HET: NAG BMA MAN; 1.30A {Drosophila melanogaster} SCOP: c.1.8.5 d.26.3.1 PDB: 1jne_A* Length = 420 Back     alignment and structure
 Score =  138 bits (348), Expect = 1e-38
 Identities = 62/153 (40%), Positives = 89/153 (58%), Gaps = 6/153 (3%)

Query: 49  NKLILAIPTYGRTWVINKDTSRTGIPPL-KVEGPGEKGPLVQEEGLLSYGEICSQL--AS 105
           NK+ L + TYG  W + KD+   G+P + +  GP  +G   Q+ GLLSY EIC +L    
Sbjct: 270 NKINLGVATYGNAWKLTKDSGLEGVPVVPETSGPAPEGFQSQKPGLLSYAEICGKLSNPQ 329

Query: 106 LTDANASPTTLRRVPDTQKRMGTYAFRLPNKQLKQEYGIWVSYEDPETVGVKAAYAKQNG 165
                 + + LRRV D  KR G  A+R  + Q+ +  GIWVSY+DP++   KAAYA+   
Sbjct: 330 NQFLKGNESPLRRVSDPTKRFGGIAYRPVDGQITE--GIWVSYDDPDSASNKAAYARVKN 387

Query: 166 LAGVAMVDLSLDDFKGNCGENDYH-IKSLDKEL 197
           L GVA+ DLS DDF+G C  + Y  ++++   L
Sbjct: 388 LGGVALFDLSYDDFRGQCSGDKYPILRAIKYRL 420
>1jnd_A Imaginal DISC growth factor-2; IDGF, chitinase, insulin recep heparin, hormone-growth factor complex; HET: NAG BMA MAN; 1.30A {Drosophila melanogaster} SCOP: c.1.8.5 d.26.3.1 PDB: 1jne_A* Length = 420 Back     alignment and structure
>4ay1_A Chitinase-3-like protein 2; chilectin, lectin, chitooligosaccharide, pseudochitinase, HY; HET: NAG; 1.95A {Homo sapiens} Length = 365 Back     alignment and structure
>2pi6_A Chitinase-3-like protein 1; complex, signaling protein; HET: NAG MAN; 1.65A {Ovis aries} SCOP: c.1.8.5 d.26.3.1 PDB: 2dpe_A* 1sr0_A* 1zl1_A* 1zbk_A* 2dsu_A* 2dsv_A* 2dsw_A* 2fdm_A* 2g41_A* 2g8z_A* 2dt1_A* 1zbv_A* 1zu8_A* 2aos_A* 2b31_A* 1zbw_A* 2dt0_A* 2dsz_A* 2dt2_A* 2dt3_A* ... Length = 361 Back     alignment and structure
>2pi6_A Chitinase-3-like protein 1; complex, signaling protein; HET: NAG MAN; 1.65A {Ovis aries} SCOP: c.1.8.5 d.26.3.1 PDB: 2dpe_A* 1sr0_A* 1zl1_A* 1zbk_A* 2dsu_A* 2dsv_A* 2dsw_A* 2fdm_A* 2g41_A* 2g8z_A* 2dt1_A* 1zbv_A* 1zu8_A* 2aos_A* 2b31_A* 1zbw_A* 2dt0_A* 2dsz_A* 2dt2_A* 2dt3_A* ... Length = 361 Back     alignment and structure
>1vf8_A YM1, secretory protein; chitinase, CHI-lectin, structural plasticity, functional versatility, immune system; 1.31A {Mus musculus} SCOP: c.1.8.5 d.26.3.1 PDB: 1e9l_A Length = 377 Back     alignment and structure
>1wb0_A Chitinase 1, chitotriosidase 1; cyclopentapeptide inhibitors, chitinase inhibitors, carbohyd metabolism, chitin degradation, chitin-binding; HET: VR0 MEA; 1.65A {Homo sapiens} SCOP: c.1.8.5 d.26.3.1 PDB: 1waw_A* 1guv_A 1lg2_A 1lg1_A 1lq0_A 1hki_A* 1hkj_A* 1hkm_A* 1hkk_A* Length = 445 Back     alignment and structure
>3fy1_A Amcase, TSA1902, acidic mammalian chitinase; structure, crystallography, asthma,inhibitor, chitin degradation, methylallosamidin; HET: NA1 NAA AMI; 1.70A {Homo sapiens} PDB: 3fxy_A* 3rm4_A* 3rm8_A* 3rm9_A* 3rme_A* 2ybt_A* 2ybu_A* Length = 395 Back     alignment and structure
>3alf_A Chitinase, class V; hydrolase; 1.20A {Nicotiana tabacum} PDB: 3alg_A* Length = 353 Back     alignment and structure
>3aqu_A AT4G19810; stress response, TIM barrel, hydrolase, chitin; HET: FLC; 2.01A {Arabidopsis thaliana} Length = 356 Back     alignment and structure
>3qok_A Putative chitinase II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycosyl hydrolases family 18; 2.60A {Klebsiella pneumoniae subsp} Length = 420 Back     alignment and structure
>1goi_A Chitinase B; chitin degradation, hydrolase, glycosidase; 1.45A {Serratia marcescens} SCOP: b.72.2.1 c.1.8.5 d.26.3.1 PDB: 1o6i_A* 1e6r_A* 1e15_A 1gpf_A* 1ur8_A* 1w1p_A* 1w1t_A* 1w1v_A* 1w1y_A* 1e6p_A 1e6n_A 1h0g_A* 1h0i_A* 1ogb_A 1ogg_A* 1e6z_A* 1ur9_A* Length = 499 Back     alignment and structure
>1goi_A Chitinase B; chitin degradation, hydrolase, glycosidase; 1.45A {Serratia marcescens} SCOP: b.72.2.1 c.1.8.5 d.26.3.1 PDB: 1o6i_A* 1e6r_A* 1e15_A 1gpf_A* 1ur8_A* 1w1p_A* 1w1t_A* 1w1v_A* 1w1y_A* 1e6p_A 1e6n_A 1h0g_A* 1h0i_A* 1ogb_A 1ogg_A* 1e6z_A* 1ur9_A* Length = 499 Back     alignment and structure
>1itx_A Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) barrel; 1.10A {Bacillus circulans} SCOP: c.1.8.5 d.26.3.1 Length = 419 Back     alignment and structure
>1itx_A Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) barrel; 1.10A {Bacillus circulans} SCOP: c.1.8.5 d.26.3.1 Length = 419 Back     alignment and structure
>3arx_A Chitinase A; TIM barrel, inhibitor complex, glycosidase, hydrolase, hydro hydrolase inhibitor complex; HET: POY; 1.16A {Vibrio harveyi} PDB: 3aro_A* 3arp_A* 3arr_A* 3arv_A* 3arw_A* 3arq_A* 3ary_A* 3arz_A* 3b8s_A 3b9e_A 3b9a_A* 3b9d_A 3as2_A* 3ars_A* 3art_A* 3as0_A* 3as1_A* 3aru_A* 3as3_A* Length = 584 Back     alignment and structure
>3oa5_A CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yersinia} PDB: 4a5q_A Length = 574 Back     alignment and structure
>3oa5_A CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yersinia} PDB: 4a5q_A Length = 574 Back     alignment and structure
>3g6m_A Chitinase, crchi1; inhibitor, caffeine, glycosidase, hydrolas hydrolase inhibitor complex; HET: CFF; 1.65A {Bionectria ochroleuca} PDB: 3g6l_A* Length = 406 Back     alignment and structure
>1ll7_A Chitinase 1; beta-alpha barrel, hydrolase; 2.00A {Coccidioides immitis} SCOP: c.1.8.5 d.26.3.1 PDB: 1d2k_A 1ll4_A* 1ll6_A Length = 392 Back     alignment and structure
>1ll7_A Chitinase 1; beta-alpha barrel, hydrolase; 2.00A {Coccidioides immitis} SCOP: c.1.8.5 d.26.3.1 PDB: 1d2k_A 1ll4_A* 1ll6_A Length = 392 Back     alignment and structure
>1edq_A Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1.55A {Serratia marcescens} SCOP: b.1.18.2 c.1.8.5 d.26.3.1 PDB: 1ffq_A* 1ffr_A* 1ehn_A* 1ctn_A 1k9t_A* 1eib_A* 2wlz_A* 2wly_A* 2wm0_A* 2wk2_A* 1nh6_A* 1x6l_A 1rd6_A 1x6n_A* Length = 540 Back     alignment and structure
>1edq_A Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1.55A {Serratia marcescens} SCOP: b.1.18.2 c.1.8.5 d.26.3.1 PDB: 1ffq_A* 1ffr_A* 1ehn_A* 1ctn_A 1k9t_A* 1eib_A* 2wlz_A* 2wly_A* 2wm0_A* 2wk2_A* 1nh6_A* 1x6l_A 1rd6_A 1x6n_A* Length = 540 Back     alignment and structure
>1kfw_A Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrobacter SP} SCOP: c.1.8.5 d.26.3.1 Length = 435 Back     alignment and structure
>1w9p_A Chitinase; peptide inhibitors, argifin, argadin, glycosidase, hydrolase; 1.7A {Aspergillus fumigatus} SCOP: c.1.8.5 d.26.3.1 PDB: 1w9u_A* 1w9v_A* 2a3a_A* 2a3b_A* 2a3c_A* 2a3e_A* 2iuz_A* 3ch9_A 3chc_A* 3chd_A* 3che_A* 3chf_A* 1wno_A* Length = 433 Back     alignment and structure
>1w9p_A Chitinase; peptide inhibitors, argifin, argadin, glycosidase, hydrolase; 1.7A {Aspergillus fumigatus} SCOP: c.1.8.5 d.26.3.1 PDB: 1w9u_A* 1w9v_A* 2a3a_A* 2a3b_A* 2a3c_A* 2a3e_A* 2iuz_A* 3ch9_A 3chc_A* 3chd_A* 3che_A* 3chf_A* 1wno_A* Length = 433 Back     alignment and structure
>3fnd_A Chitinase; TIM-barrel, structural genomics, PSI-2, P structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides thetaiotaomicron} PDB: 3co4_A Length = 312 Back     alignment and structure
>3cz8_A Putative sporulation-specific glycosylase YDHD; structural genomics, uncharacterized protein, protein struct initiative, PSI-2; 2.20A {Bacillus subtilis subsp} Length = 319 Back     alignment and structure
>3bxw_B Chitinase domain-containing protein 1; TIM barrel, lysosome, secreted, hydrolase; 2.70A {Homo sapiens} Length = 393 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query242
1jnd_A420 Imaginal DISC growth factor-2; IDGF, chitinase, in 100.0
4ay1_A365 Chitinase-3-like protein 2; chilectin, lectin, chi 100.0
3fy1_A395 Amcase, TSA1902, acidic mammalian chitinase; struc 100.0
1vf8_A377 YM1, secretory protein; chitinase, CHI-lectin, str 100.0
2pi6_A361 Chitinase-3-like protein 1; complex, signaling pro 100.0
1wb0_A445 Chitinase 1, chitotriosidase 1; cyclopentapeptide 100.0
3alf_A353 Chitinase, class V; hydrolase; 1.20A {Nicotiana ta 100.0
3aqu_A356 AT4G19810; stress response, TIM barrel, hydrolase, 100.0
1itx_A419 Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) 100.0
3arx_A584 Chitinase A; TIM barrel, inhibitor complex, glycos 100.0
1edq_A540 Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1 99.98
1goi_A499 Chitinase B; chitin degradation, hydrolase, glycos 99.98
1kfw_A435 Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrob 99.97
3oa5_A574 CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yers 99.97
3g6m_A406 Chitinase, crchi1; inhibitor, caffeine, glycosidas 99.97
1ll7_A392 Chitinase 1; beta-alpha barrel, hydrolase; 2.00A { 99.97
3qok_A420 Putative chitinase II; structural genomics, PSI-bi 99.97
1w9p_A433 Chitinase; peptide inhibitors, argifin, argadin, g 99.96
3cz8_A319 Putative sporulation-specific glycosylase YDHD; st 99.95
3fnd_A312 Chitinase; TIM-barrel, structural genomics, PSI-2, 99.93
3bxw_B393 Chitinase domain-containing protein 1; TIM barrel, 99.92
4axn_A328 Chitinase C1; hydrolase; 1.68A {Serratia marcescen 98.79
1nar_A290 Narbonin; plant SEED protein; 1.80A {Vicia narbone 98.24
3n12_A333 Chitinase A, chinctu2; zinc atoms, complex, hydrol 97.56
3ian_A321 Chitinase; structural genomics, hydrolase, glycosi 97.34
3sim_A275 Protein, family 18 chitinase; family 18 plant chit 97.29
2y8v_A290 CHIC, class III chitinase, putative; afchic, hydro 96.57
3ebv_A302 Chinitase A; chitinase A, CHIA, glycosidase, struc 96.5
1eok_A290 Endo-beta-N-acetylglucosaminidase F3; alpha/beta-b 95.51
2hvm_A273 Hevamine; hydrolase, chitinase/lysozyme; 1.80A {He 95.06
2uy2_A294 Endochitinase; carbohydrate metabolism, polysaccha 92.65
2xtk_A310 CHIA1, class III chitinase CHIA1; hydrolase, GH18; 91.84
2gsj_A271 Protein PPL-2; mimosoideae, chimerolectin, endochi 91.04
4ac1_X283 Endo-N-acetyl-beta-D-glucosaminidase; hydrolase, g 89.77
3sim_A 275 Protein, family 18 chitinase; family 18 plant chit 88.22
4ay1_A 365 Chitinase-3-like protein 2; chilectin, lectin, chi 87.94
1jnd_A 420 Imaginal DISC growth factor-2; IDGF, chitinase, in 86.6
1edt_A271 Endo-beta-N-acetylglucosaminidase H, endo H; hydro 86.1
3oa5_A 574 CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yers 85.81
1itx_A 419 Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) 85.67
1kfw_A 435 Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrob 84.7
1nar_A 290 Narbonin; plant SEED protein; 1.80A {Vicia narbone 84.31
3fy1_A 395 Amcase, TSA1902, acidic mammalian chitinase; struc 82.41
1edq_A 540 Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1 82.29
1cnv_A299 Concanavalin B; plant chitinase, chitin binding pr 81.68
2dsk_A311 Chitinase; catalytic domain, active domain, crysta 81.38
3arx_A 584 Chitinase A; TIM barrel, inhibitor complex, glycos 81.01
>1jnd_A Imaginal DISC growth factor-2; IDGF, chitinase, insulin recep heparin, hormone-growth factor complex; HET: NAG BMA MAN; 1.30A {Drosophila melanogaster} SCOP: c.1.8.5 d.26.3.1 PDB: 1jne_A* Back     alignment and structure
Probab=100.00  E-value=1.9e-39  Score=300.53  Aligned_cols=190  Identities=35%  Similarity=0.605  Sum_probs=154.9

Q ss_pred             hhhhhhhhhhhhhhhhccCCCC-CCCCCCccccc------------------hhhhccCCCCcceEEeeecceeeEEecC
Q psy13760          6 VIASVLVVMVVSARQILASEDS-LATRPPKVICH------------------YTDIAFVGKVNKLILAIPTYGRTWVINK   66 (242)
Q Consensus         6 ~~~~~l~~~~~~~~d~~g~~~s-~~~g~~a~l~~------------------y~~~~~Gvp~~KLvLGiP~YGr~~~~~~   66 (242)
                      .|+.+||++.+|+||++|+|+. ..+||+|||+.                  |+ +++|+|++|||||||||||+|++++
T Consensus       209 ~l~~~vD~inlMtYD~~g~~~~~~~~g~~apl~~~~~~~~~~~~~~v~~~v~~~-~~~gvp~~KlvlGip~YGr~w~~~~  287 (420)
T 1jnd_A          209 ALNGLVDFVNLATFDFLTPARNPEEADYSAPIYHPDGSKDRLAHLNADFQVEYW-LSQGFPSNKINLGVATYGNAWKLTK  287 (420)
T ss_dssp             HHHTTCSEEEECCCCSSCTTTCTTCBCCSSCSSCCTTSTTCCTTCSHHHHHHHH-HHTTCCGGGEEEEEESEEEEEECCG
T ss_pred             HHHhhCcEEEEeeeecCCCcCCCCccccCCcccCCccccCccccccHHHHHHHH-HHcCCCHHHEEEEecccceeeEecC
Confidence            5889999999999999999864 57899999753                  12 7889999999999999999999987


Q ss_pred             CCCCCCCCCC-CcCCCCCCCCCCCCCccccHHHHHHHhhcCCCC--CCCCCceeEeecCCCCceeEEEeCCCccccCccc
Q psy13760         67 DTSRTGIPPL-KVEGPGEKGPLVQEEGLLSYGEICSQLASLTDA--NASPTTLRRVPDTQKRMGTYAFRLPNKQLKQEYG  143 (242)
Q Consensus        67 ~~~~~g~~~~-~~~gp~~~g~~~~~~G~~~y~eI~~~l~~~~~~--~g~~~~~~~~~D~~~~~~py~~~~~~~~~~~~~~  143 (242)
                      ..+..|.+.+ .+.||+.+|+++.++|+++|.|||+.+...+..  .+++..|+.+||++...++|+|+..+.  +++++
T Consensus       288 ~~~~~g~~~~~~~~g~~~~g~~t~~~G~~~y~ei~~~~~~~~~~~~~g~~~~~~~~~D~~~~~~~y~y~~~d~--~~~~~  365 (420)
T 1jnd_A          288 DSGLEGVPVVPETSGPAPEGFQSQKPGLLSYAEICGKLSNPQNQFLKGNESPLRRVSDPTKRFGGIAYRPVDG--QITEG  365 (420)
T ss_dssp             GGCSCCSSCBCSCCSBCCCCTTTCCTTEEEHHHHHHHBCCTTTTTCCGGGSCBEEECCTTCCSCEEEEECSBT--TBCCC
T ss_pred             CCCCCCCCcccccCCCCCCCCCCCCCceeeHHHHHHhhcccCcccccccccceeEEechhhccceeEEEeccc--CCCCC
Confidence            5444455432 257888899999999999999999987653211  111123678999964347999975321  13468


Q ss_pred             EEEEeCCHHHHHHHHHHHHHcCCCeEEEeeCCCCCCCCCCCCCcccccccccccc
Q psy13760        144 IWVSYEDPETVGVKAAYAKQNGLAGVAMVDLSLDDFKGNCGENDYHIKSLDKELD  198 (242)
Q Consensus       144 ~wisyDd~~Si~~K~~y~~~~gLgGv~vW~l~~Dd~~g~C~~~~~pLl~ai~~~l  198 (242)
                      +||+|||++||++|++||+++||||+|+|+|++||++|.|++++||||++|+..|
T Consensus       366 ~wvsydd~~Si~~K~~y~~~~gLgGv~~W~l~~Dd~~g~c~~~~~pll~ai~~~l  420 (420)
T 1jnd_A          366 IWVSYDDPDSASNKAAYARVKNLGGVALFDLSYDDFRGQCSGDKYPILRAIKYRL  420 (420)
T ss_dssp             EEEEECCHHHHHHHHHHHHHTTCSEEEEECGGGSCTTCTTTSCSSHHHHHHHHHC
T ss_pred             EEEEcCCHHHHHHHHHHHHhCCCceEEEEeeccCCCCCccCCCCChHHHHHHhhC
Confidence            9999999999999999999999999999999999999999989999999998764
>4ay1_A Chitinase-3-like protein 2; chilectin, lectin, chitooligosaccharide, pseudochitinase, HY; HET: NAG; 1.95A {Homo sapiens} Back     alignment and structure
>3fy1_A Amcase, TSA1902, acidic mammalian chitinase; structure, crystallography, asthma,inhibitor, chitin degradation, methylallosamidin; HET: NA1 NAA AMI; 1.70A {Homo sapiens} PDB: 3fxy_A* 3rm4_A* 3rm8_A* 3rm9_A* 3rme_A* 2ybt_A* 2ybu_A* Back     alignment and structure
>1vf8_A YM1, secretory protein; chitinase, CHI-lectin, structural plasticity, functional versatility, immune system; 1.31A {Mus musculus} SCOP: c.1.8.5 d.26.3.1 PDB: 1e9l_A Back     alignment and structure
>2pi6_A Chitinase-3-like protein 1; complex, signaling protein; HET: NAG MAN; 1.65A {Ovis aries} SCOP: c.1.8.5 d.26.3.1 PDB: 2dpe_A* 1sr0_A* 1zl1_A* 1zbk_A* 2dsu_A* 2dsv_A* 2dsw_A* 2fdm_A* 2g41_A* 2g8z_A* 2dt1_A* 1zbv_A* 1zu8_A* 2aos_A* 2b31_A* 1zbw_A* 2dt0_A* 2dsz_A* 2dt2_A* 2dt3_A* ... Back     alignment and structure
>1wb0_A Chitinase 1, chitotriosidase 1; cyclopentapeptide inhibitors, chitinase inhibitors, carbohyd metabolism, chitin degradation, chitin-binding; HET: VR0 MEA; 1.65A {Homo sapiens} SCOP: c.1.8.5 d.26.3.1 PDB: 1waw_A* 1guv_A 1lg2_A 1lg1_A 1lq0_A 1hki_A* 1hkj_A* 1hkm_A* 1hkk_A* Back     alignment and structure
>3alf_A Chitinase, class V; hydrolase; 1.20A {Nicotiana tabacum} PDB: 3alg_A* Back     alignment and structure
>3aqu_A AT4G19810; stress response, TIM barrel, hydrolase, chitin; HET: FLC; 2.01A {Arabidopsis thaliana} Back     alignment and structure
>1itx_A Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) barrel; 1.10A {Bacillus circulans} SCOP: c.1.8.5 d.26.3.1 Back     alignment and structure
>3arx_A Chitinase A; TIM barrel, inhibitor complex, glycosidase, hydrolase, hydro hydrolase inhibitor complex; HET: POY; 1.16A {Vibrio harveyi} PDB: 3aro_A* 3arp_A* 3arr_A* 3arv_A* 3arw_A* 3arq_A* 3ary_A* 3arz_A* 3b8s_A 3b9e_A 3b9a_A* 3b9d_A 3as2_A* 3ars_A* 3art_A* 3as0_A* 3as1_A* 3aru_A* 3as3_A* Back     alignment and structure
>1edq_A Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1.55A {Serratia marcescens} SCOP: b.1.18.2 c.1.8.5 d.26.3.1 PDB: 1ffq_A* 1ffr_A* 1ehn_A* 1ctn_A 1k9t_A* 1eib_A* 2wlz_A* 2wly_A* 2wm0_A* 2wk2_A* 1nh6_A* 1x6l_A 1rd6_A 1x6n_A* Back     alignment and structure
>1goi_A Chitinase B; chitin degradation, hydrolase, glycosidase; 1.45A {Serratia marcescens} SCOP: b.72.2.1 c.1.8.5 d.26.3.1 PDB: 1o6i_A* 1e6r_A* 1e15_A 1gpf_A* 1ur8_A* 1w1p_A* 1w1t_A* 1w1v_A* 1w1y_A* 1e6p_A 1e6n_A 1h0g_A* 1h0i_A* 1ogb_A 1ogg_A* 1e6z_A* 1ur9_A* Back     alignment and structure
>1kfw_A Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrobacter SP} SCOP: c.1.8.5 d.26.3.1 Back     alignment and structure
>3oa5_A CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yersinia} PDB: 4a5q_A Back     alignment and structure
>3g6m_A Chitinase, crchi1; inhibitor, caffeine, glycosidase, hydrolas hydrolase inhibitor complex; HET: CFF; 1.65A {Bionectria ochroleuca} PDB: 3g6l_A* Back     alignment and structure
>1ll7_A Chitinase 1; beta-alpha barrel, hydrolase; 2.00A {Coccidioides immitis} SCOP: c.1.8.5 d.26.3.1 PDB: 1d2k_A 1ll4_A* 1ll6_A Back     alignment and structure
>3qok_A Putative chitinase II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycosyl hydrolases family 18; 2.60A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1w9p_A Chitinase; peptide inhibitors, argifin, argadin, glycosidase, hydrolase; 1.7A {Aspergillus fumigatus} SCOP: c.1.8.5 d.26.3.1 PDB: 1w9u_A* 1w9v_A* 2a3a_A* 2a3b_A* 2a3c_A* 2a3e_A* 2iuz_A* 3ch9_A 3chc_A* 3chd_A* 3che_A* 3chf_A* 1wno_A* Back     alignment and structure
>3cz8_A Putative sporulation-specific glycosylase YDHD; structural genomics, uncharacterized protein, protein struct initiative, PSI-2; 2.20A {Bacillus subtilis subsp} Back     alignment and structure
>3fnd_A Chitinase; TIM-barrel, structural genomics, PSI-2, P structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides thetaiotaomicron} PDB: 3co4_A Back     alignment and structure
>3bxw_B Chitinase domain-containing protein 1; TIM barrel, lysosome, secreted, hydrolase; 2.70A {Homo sapiens} Back     alignment and structure
>4axn_A Chitinase C1; hydrolase; 1.68A {Serratia marcescens} Back     alignment and structure
>1nar_A Narbonin; plant SEED protein; 1.80A {Vicia narbonensis} SCOP: c.1.8.5 Back     alignment and structure
>3n12_A Chitinase A, chinctu2; zinc atoms, complex, hydrolase; 1.20A {Bacillus cereus} PDB: 3n11_A 3n15_A* 3n13_A* 3n17_A* 3n18_A* 3n1a_A* Back     alignment and structure
>3ian_A Chitinase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 1.75A {Lactococcus lactis subsp} Back     alignment and structure
>3sim_A Protein, family 18 chitinase; family 18 plant chitinase, TIM barrel, chitin binding, glyco hydrolase, hydrolase; 2.10A {Crocus vernus} Back     alignment and structure
>2y8v_A CHIC, class III chitinase, putative; afchic, hydrolase; 1.99A {Aspergillus fumigatus} Back     alignment and structure
>3ebv_A Chinitase A; chitinase A, CHIA, glycosidase, structural genomics, unknown function, hydrolase, PSI-2, protein structure initiative; 1.50A {Streptomyces coelicolor} Back     alignment and structure
>1eok_A Endo-beta-N-acetylglucosaminidase F3; alpha/beta-barrel, hydrolase; 1.80A {Elizabethkingia meningoseptica} SCOP: c.1.8.5 PDB: 1eom_A* Back     alignment and structure
>2hvm_A Hevamine; hydrolase, chitinase/lysozyme; 1.80A {Hevea brasiliensis} SCOP: c.1.8.5 PDB: 1hvq_A* 1llo_A 1kr0_A* 1kr1_A* 1kqy_A* 1kqz_A* Back     alignment and structure
>2uy2_A Endochitinase; carbohydrate metabolism, polysaccharide degradation, glycopr chitin-binding, chitin degradation, CAZY, hydrolase; 1.60A {Saccharomyces cerevisiae} PDB: 2uy3_A* 2uy4_A* 2uy5_A* Back     alignment and structure
>2xtk_A CHIA1, class III chitinase CHIA1; hydrolase, GH18; HET: AZM; 2.00A {Aspergillus fumigatus} PDB: 2xuc_A 2xvp_A 2xvn_A* Back     alignment and structure
>2gsj_A Protein PPL-2; mimosoideae, chimerolectin, endochitinase, glycosyl hydrolase family 18, equilibrium sedimentation, X-RAY; 1.73A {Parkia platycephala} Back     alignment and structure
>4ac1_X Endo-N-acetyl-beta-D-glucosaminidase; hydrolase, glycoside hydrolase family 18, deglycosylation; HET: NAG; 1.30A {Hypocrea jecorina} Back     alignment and structure
>3sim_A Protein, family 18 chitinase; family 18 plant chitinase, TIM barrel, chitin binding, glyco hydrolase, hydrolase; 2.10A {Crocus vernus} Back     alignment and structure
>4ay1_A Chitinase-3-like protein 2; chilectin, lectin, chitooligosaccharide, pseudochitinase, HY; HET: NAG; 1.95A {Homo sapiens} Back     alignment and structure
>1jnd_A Imaginal DISC growth factor-2; IDGF, chitinase, insulin recep heparin, hormone-growth factor complex; HET: NAG BMA MAN; 1.30A {Drosophila melanogaster} SCOP: c.1.8.5 d.26.3.1 PDB: 1jne_A* Back     alignment and structure
>1edt_A Endo-beta-N-acetylglucosaminidase H, endo H; hydrolase (glucosidase); 1.90A {Streptomyces plicatus} SCOP: c.1.8.5 PDB: 1c90_A 1c8x_A 1c91_A 1c3f_A 1c92_A 1c8y_A 1c93_A Back     alignment and structure
>3oa5_A CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yersinia} PDB: 4a5q_A Back     alignment and structure
>1itx_A Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) barrel; 1.10A {Bacillus circulans} SCOP: c.1.8.5 d.26.3.1 Back     alignment and structure
>1kfw_A Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrobacter SP} SCOP: c.1.8.5 d.26.3.1 Back     alignment and structure
>1nar_A Narbonin; plant SEED protein; 1.80A {Vicia narbonensis} SCOP: c.1.8.5 Back     alignment and structure
>3fy1_A Amcase, TSA1902, acidic mammalian chitinase; structure, crystallography, asthma,inhibitor, chitin degradation, methylallosamidin; HET: NA1 NAA AMI; 1.70A {Homo sapiens} PDB: 3fxy_A* 3rm4_A* 3rm8_A* 3rm9_A* 3rme_A* 2ybt_A* 2ybu_A* Back     alignment and structure
>1edq_A Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1.55A {Serratia marcescens} SCOP: b.1.18.2 c.1.8.5 d.26.3.1 PDB: 1ffq_A* 1ffr_A* 1ehn_A* 1ctn_A 1k9t_A* 1eib_A* 2wlz_A* 2wly_A* 2wm0_A* 2wk2_A* 1nh6_A* 1x6l_A 1rd6_A 1x6n_A* Back     alignment and structure
>1cnv_A Concanavalin B; plant chitinase, chitin binding protein, SEED protein; 1.65A {Canavalia ensiformis} SCOP: c.1.8.5 Back     alignment and structure
>2dsk_A Chitinase; catalytic domain, active domain, crystalline CHIT barrel, hydrolase; 1.50A {Pyrococcus furiosus} PDB: 3a4w_A* 3a4x_A* 3afb_A Back     alignment and structure
>3arx_A Chitinase A; TIM barrel, inhibitor complex, glycosidase, hydrolase, hydro hydrolase inhibitor complex; HET: POY; 1.16A {Vibrio harveyi} PDB: 3aro_A* 3arp_A* 3arr_A* 3arv_A* 3arw_A* 3arq_A* 3ary_A* 3arz_A* 3b8s_A 3b9e_A 3b9a_A* 3b9d_A 3as2_A* 3ars_A* 3art_A* 3as0_A* 3as1_A* 3aru_A* 3as3_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 242
d1jnda292 d.26.3.1 (A:279-370) Imaginal disc growth factor-2 1e-23
d1jnda1327 c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth f 2e-14
d1jnda1 327 c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth f 6e-05
d1wb0a1297 c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Huma 2e-12
d2pi6a1292 c.1.8.5 (A:1-239,A:308-361) Signal processing prot 3e-12
d1goia2356 c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic 4e-11
d1goia2 356 c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic 4e-04
d1vf8a1302 c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin 4e-10
d1itxa1347 c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillu 2e-07
d1itxa1 347 c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillu 0.001
d2pi6a268 d.26.3.1 (A:240-307) Signal processing protein (SP 2e-07
d1vf8a270 d.26.3.1 (A:246-315) Chitinase-like lectin ym1 {Mo 1e-06
d1wb0a268 d.26.3.1 (A:267-336) Chitotriosidase {Human (Homo 2e-06
d1kfwa1374 c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitina 2e-06
d1ll7a1330 c.1.8.5 (A:36-292,A:355-427) Chitinase 1 {Fungus ( 1e-05
d1edqa2 358 c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalyt 0.001
d1w9pa1333 c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergil 0.003
>d1jnda2 d.26.3.1 (A:279-370) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 92 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: FKBP-like
superfamily: Chitinase insertion domain
family: Chitinase insertion domain
domain: Imaginal disc growth factor-2
species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]

 Score = 88.9 bits (220), Expect = 1e-23
 Identities = 36/94 (38%), Positives = 50/94 (53%), Gaps = 5/94 (5%)

Query: 58  YGRTWVINKDTSRTGIPPL-KVEGPGEKGPLVQEEGLLSYGEICSQLA--SLTDANASPT 114
           YG  W + KD+   G+P + +  GP  +G   Q+ GLLSY EIC +L+         + +
Sbjct: 1   YGNAWKLTKDSGLEGVPVVPETSGPAPEGFQSQKPGLLSYAEICGKLSNPQNQFLKGNES 60

Query: 115 TLRRVPDTQKRMGTYAFRLPNKQLKQEYGIWVSY 148
            LRRV D  KR G  A+R  +   +   GIWVSY
Sbjct: 61  PLRRVSDPTKRFGGIAYRPVDG--QITEGIWVSY 92
>d1jnda1 c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 327 Back     information, alignment and structure
>d1jnda1 c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 327 Back     information, alignment and structure
>d1wb0a1 c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} Length = 297 Back     information, alignment and structure
>d2pi6a1 c.1.8.5 (A:1-239,A:308-361) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} Length = 292 Back     information, alignment and structure
>d1goia2 c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic domain {Serratia marcescens [TaxId: 615]} Length = 356 Back     information, alignment and structure
>d1goia2 c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic domain {Serratia marcescens [TaxId: 615]} Length = 356 Back     information, alignment and structure
>d1vf8a1 c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin ym1, saccharide binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 302 Back     information, alignment and structure
>d1itxa1 c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillus circulans [TaxId: 1397]} Length = 347 Back     information, alignment and structure
>d1itxa1 c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillus circulans [TaxId: 1397]} Length = 347 Back     information, alignment and structure
>d2pi6a2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} Length = 68 Back     information, alignment and structure
>d1vf8a2 d.26.3.1 (A:246-315) Chitinase-like lectin ym1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 70 Back     information, alignment and structure
>d1wb0a2 d.26.3.1 (A:267-336) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1kfwa1 c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} Length = 374 Back     information, alignment and structure
>d1ll7a1 c.1.8.5 (A:36-292,A:355-427) Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 5501]} Length = 330 Back     information, alignment and structure
>d1edqa2 c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalytic domain {Serratia marcescens [TaxId: 615]} Length = 358 Back     information, alignment and structure
>d1w9pa1 c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} Length = 333 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query242
d1jnda1327 Imaginal disc growth factor-2 {Fruit fly (Drosophi 99.87
d2pi6a1292 Signal processing protein (SPC-40, MGP-40) {Sheep 99.86
d1wb0a1297 Chitotriosidase {Human (Homo sapiens) [TaxId: 9606 99.85
d1vf8a1302 Chitinase-like lectin ym1, saccharide binding doma 99.83
d1goia2356 Chitinase B, catalytic domain {Serratia marcescens 99.83
d1kfwa1374 Psychrophilic chitinase B {Arthrobacter sp., tad20 99.69
d1itxa1347 Chitinase A1 {Bacillus circulans [TaxId: 1397]} 99.66
d1edqa2358 Chitinase A, catalytic domain {Serratia marcescens 99.63
d1w9pa1333 Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} 99.61
d1jnda292 Imaginal disc growth factor-2 {Fruit fly (Drosophi 99.55
d1vf8a270 Chitinase-like lectin ym1 {Mouse (Mus musculus) [T 99.55
d1ll7a1330 Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 99.52
d2pi6a268 Signal processing protein (SPC-40, MGP-40) {Sheep 99.48
d1wb0a268 Chitotriosidase {Human (Homo sapiens) [TaxId: 9606 99.46
d1itxa272 Chitinase A1 {Bacillus circulans [TaxId: 1397]} 99.32
d1edqa373 Chitinase A {Serratia marcescens [TaxId: 615]} 99.3
d1kfwa261 Psychrophilic chitinase B {Arthrobacter sp., tad20 98.86
d1goia388 Chitinase B {Serratia marcescens [TaxId: 615]} 98.69
d1nara_289 Seed storage protein {Vicia narbonensis, Narbonin 98.34
d1ll7a262 Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 98.27
d1w9pa262 Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} 98.26
d2hvma_273 Hevamine A (chitinase/lysozyme) {Para rubber tree 96.39
d1edqa2 358 Chitinase A, catalytic domain {Serratia marcescens 92.34
d1jnda1 327 Imaginal disc growth factor-2 {Fruit fly (Drosophi 92.3
d1kfwa1 374 Psychrophilic chitinase B {Arthrobacter sp., tad20 92.15
d1goia2 356 Chitinase B, catalytic domain {Serratia marcescens 91.62
d1itxa1 347 Chitinase A1 {Bacillus circulans [TaxId: 1397]} 90.0
d1nara_ 289 Seed storage protein {Vicia narbonensis, Narbonin 88.2
d1wb0a1 297 Chitotriosidase {Human (Homo sapiens) [TaxId: 9606 87.51
d1w9pa1 333 Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} 87.28
d1ll7a1 330 Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 86.24
d2pi6a1 292 Signal processing protein (SPC-40, MGP-40) {Sheep 85.76
d1vf8a1 302 Chitinase-like lectin ym1, saccharide binding doma 85.65
d1cnva_283 Seed storage protein {Jack bean (Canavalia ensifor 83.95
d1ta3a_274 Xylanase inhibitor protein I, XIP-I {Wheat (Tritic 83.75
>d1jnda1 c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Type II chitinase
domain: Imaginal disc growth factor-2
species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]

Probab=99.87  E-value=3.6e-23  Score=183.23  Aligned_cols=56  Identities=41%  Similarity=0.646  Sum_probs=53.4

Q ss_pred             cEEEEeCCHHHHHHHHHHHHHcCCCeEEEeeCCCCCCCCCCCCCcccccccccccc
Q psy13760        143 GIWVSYEDPETVGVKAAYAKQNGLAGVAMVDLSLDDFKGNCGENDYHIKSLDKELD  198 (242)
Q Consensus       143 ~~wisyDd~~Si~~K~~y~~~~gLgGv~vW~l~~Dd~~g~C~~~~~pLl~ai~~~l  198 (242)
                      ..||+|||++||++|++|++++||||||+|++++|||+|.|++++||||+||++.|
T Consensus       272 ~lGi~ydd~~Si~~K~~~~~~~~lgGv~~W~l~~DDf~G~C~~~~~pLl~ai~~~l  327 (327)
T d1jnda1         272 NLGVATDDPDSASNKAAYARVKNLGGVALFDLSYDDFRGQCSGDKYPILRAIKYRL  327 (327)
T ss_dssp             EEEEESCCHHHHHHHHHHHHHTTCSEEEEECGGGSCTTCTTTSCSSHHHHHHHHHC
T ss_pred             EEEEcCCCHHHHHHHHHHHHhcCCCEEEEEeccCCCCCCccCCCCChHHHHHHhhC
Confidence            47899999999999999999999999999999999999999889999999999865
>d2pi6a1 c.1.8.5 (A:1-239,A:308-361) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1wb0a1 c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vf8a1 c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin ym1, saccharide binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1goia2 c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic domain {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1kfwa1 c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} Back     information, alignment and structure
>d1itxa1 c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillus circulans [TaxId: 1397]} Back     information, alignment and structure
>d1edqa2 c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalytic domain {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1w9pa1 c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} Back     information, alignment and structure
>d1jnda2 d.26.3.1 (A:279-370) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1vf8a2 d.26.3.1 (A:246-315) Chitinase-like lectin ym1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ll7a1 c.1.8.5 (A:36-292,A:355-427) Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 5501]} Back     information, alignment and structure
>d2pi6a2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1wb0a2 d.26.3.1 (A:267-336) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1itxa2 d.26.3.1 (A:338-409) Chitinase A1 {Bacillus circulans [TaxId: 1397]} Back     information, alignment and structure
>d1edqa3 d.26.3.1 (A:444-516) Chitinase A {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1kfwa2 d.26.3.1 (A:328-388) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} Back     information, alignment and structure
>d1goia3 d.26.3.1 (A:292-379) Chitinase B {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1nara_ c.1.8.5 (A:) Seed storage protein {Vicia narbonensis, Narbonin [TaxId: 3912]} Back     information, alignment and structure
>d1ll7a2 d.26.3.1 (A:293-354) Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 5501]} Back     information, alignment and structure
>d1w9pa2 d.26.3.1 (A:299-360) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} Back     information, alignment and structure
>d2hvma_ c.1.8.5 (A:) Hevamine A (chitinase/lysozyme) {Para rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d1edqa2 c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalytic domain {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1jnda1 c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1kfwa1 c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} Back     information, alignment and structure
>d1goia2 c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic domain {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1itxa1 c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillus circulans [TaxId: 1397]} Back     information, alignment and structure
>d1nara_ c.1.8.5 (A:) Seed storage protein {Vicia narbonensis, Narbonin [TaxId: 3912]} Back     information, alignment and structure
>d1wb0a1 c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w9pa1 c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} Back     information, alignment and structure
>d1ll7a1 c.1.8.5 (A:36-292,A:355-427) Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 5501]} Back     information, alignment and structure
>d2pi6a1 c.1.8.5 (A:1-239,A:308-361) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1vf8a1 c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin ym1, saccharide binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cnva_ c.1.8.5 (A:) Seed storage protein {Jack bean (Canavalia ensiformis), Concanavalin B [TaxId: 3823]} Back     information, alignment and structure
>d1ta3a_ c.1.8.5 (A:) Xylanase inhibitor protein I, XIP-I {Wheat (Triticum aestivum) [TaxId: 4565]} Back     information, alignment and structure