Psyllid ID: psy13767

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-

MVANQKPPSADYKVVKAQLQEQKFLKKMLADRQHSMSSLFQMGNEVAANADPAERKAIERQLNELMNRFDNLNEGASQRMDALEQAMAVAKQFQDKLTGILDWLDKSEKKIKDMELIPTDEEKIQQRIREHDALHKEILRKKPDFTELTDIASSLMGLVGEDEAAGVADKLQDTADRYGALVEASDNLGQYAFLYNQLILSPRFSSVTDIKKKLERLNGLWNEVQKATNDRGRSLEEALALAEKFWSELQSVMATLRDLQDNLNSQEPPAVEPKAIQQQQYALKEIKAEIDQTKPEVEQCRASGQKLMKICGEPDKPEVKKHIEDLDSAWDNVTALFAKREENLIHAMEKAMEFHETLQRKGEQGTITALFAKREENLIHAMEKAMEFHETLQQNRDDCKKADCNADAVQTFVNSLPEDDQEARTQLAEHEKFLRELAEKEIEKDATIGLAQRILVKSHPDGATVIKHWITIIQSRWEEVSSWAKQREERLRNHLRSLQDLDSLLEELLEWLAKCESHLLNLEAEPLPDDIPTVERLIEEHKEFMEATSKRQHEVDSVRASPSREKLNDNLPHYGPRFPPKGSKGAEPQFRNPRCRLLWDTWRNVWLLAWERQRRLQERLNYLIELEKVKNFSWDDWRKRFLRFMNHKKSRLTDLFRKMDKNNDGLIPREDFVDGIIKTKFETSKLEMGAVADMFDHDYNPGLIDWKEFIAALRPDWEEKKPNTESEKIHDEVKRLVQLCTCRQKFRVFQVGEGKYRFGDSQKLRLVRILRSTVMVRVGGGWVALDEFLIKNDPCRDNVCQ

cccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHccccccccccccccccccccHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHccHHHHHHHHHHcccccccccccccHHHHHHHHcccccccccccccccHHHHHHHHHHcccccccccccEEcccccccccccHHHHHHHHccccEEEEcccccHHHHHHHHcccccccccc

cccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcHHHHHHHHHHHcccccccccHHHHHHHHHHcccccccEHHHHHHHHHccccccccEEHHHHHHHHccccccccccccHHHHHHHHHHHHHHccccccEEEEEEcccccccccHHHHHHHHHHHcEEEEEEccHHHHHHHHHHccccccccccc

mvanqkppsadYKVVKAQLQEQKFLKKMLADRQHSMSSLFQMGnevaanadpAERKAIERQLNELMNRFDNLNEGASQRMDALEQAMAVAKQFQDKLTGILDWLDKSEKKikdmeliptDEEKIQQRIREHDALHKEILrkkpdfteLTDIASSLMglvgedeaagVADKLQDTADRYGALVEASDNLGQYAFLYNQLilsprfssvtDIKKKLERLNGLWNEVQKATNDRGRSLEEALALAEKFWSELQSVMATLRDLQdnlnsqeppavepkAIQQQQYALKEIKAEIDQTKPEVEQCRASGQKLMkicgepdkpevKKHIEDLDSAWDNVTALFAKREENLIHAMEKAMEFHETLQRKGEQGTITALFAKREENLIHAMEKAMEFHETLQQnrddckkadcnADAVQTFVNSLPEDDQEARTQLAEHEKFLRELAEKEIEKDATIGLAQRILvkshpdgatVIKHWITIIQSRWEEVSSWAKQREERLRNHLRSLQDLDSLLEELLEWLAKCESHLLnleaeplpddipTVERLIEEHKEFMEATSkrqhevdsvraspsreklndnlphygprfppkgskgaepqfrnprcrLLWDTWRNVWLLAWERQRRLQERLNYLIELEKVKNFSWDDWRKRFLRFMNHKKSRLTDLFRKmdknndglipredfvDGIIKTKfetsklemgavadmfdhdynpgliDWKEFIAALrpdweekkpntesekIHDEVKRLVQLCTCrqkfrvfqvgegkyrfgdsqKLRLVRILRSTVMVRVGGGWVALdeflikndpcrdnvcq

mvanqkppsadykvVKAQLQEQKFLKKMLADRQHSMSSLFQMGNEVAANADPAERKAIERQLNELMNRFDNLNEGASQRMDALEQAMAVAKQFQDKLTGILDWLDKSekkikdmeliptdeekIQQRIREHDALHKeilrkkpdfteLTDIASSLMGLVGEDEAAGVADKLQDTADRYGALVEASDNLGQYAFLYNQLILSPRFSSVTDIKKKLERLNGLWNEVQKATNDRGRSLEEALALAEKFWSELQSVMATLRDLQDNLNSQEPPAVEPKAIQQQQYALKEIKAEIDQTKPEVEQCRASGQKLMKICGEPDKPEVKKHIEDLDSAWDNVTALFAKREENLIHAMEKAMEFHETLQRKGEQGTITALFAKREENLIHAMEKAMEFHETLQQNRDDCKKADCNADAVQTFVNSLPEDDQEARTQLAEHEKFLRELAEKEIEKDATIGLAQRILvkshpdgatvIKHWITIIQSRWEEVSSWAKQREERLRNHLRSLQDLDSLLEELLEWLAKCESHLLNleaeplpddIPTVERLIEEHKEFmeatskrqhevdsvraspsreklndnlphygprfppkgskgaepqfRNPRCRLLWDTWRNVWLLAWERQRRLQERLNYLIelekvknfswddwRKRFLRfmnhkksrltdlfrkmdknndglipredfvdgIIKTKFETSKLEMGAVADMFDHDYNPGLIDWKEFIAALRPDWEEKkpntesekihdEVKRLVQLCTCRQKFrvfqvgegkyrfgdsqklrlVRILRSTVMVRVGGGWvaldeflikndpcrdnvcq

MVANQKPPSADYKVVKAQLQEQKFLKKMLADRQHSMSSLFQMGNEVAANADPAERKAIERQLNELMNRFDNLNEGASQRMDALEQAMAVAKQFQDKLTGILDWLDKSEKKIKDMELIPTDEEKIQQRIREHDALHKEILRKKPDFTELTDIASSLMGLVGEDEAAGVADKLQDTADRYGALVEASDNLGQYAFLYNQLILSPRFSSVTDIKKKLERLNGLWNEVQKATNDRGRSLEEALALAEKFWSELQSVMATLRDLQDNLNSQEPPAVEPKAIQQQQYALKEIKAEIDQTKPEVEQCRASGQKLMKICGEPDKPEVKKHIEDLDSAWDNVTALFAKREENLIHAMEKAMEFHETLQRKGEQGTITALFAKREENLIHAMEKAMEFHETLQQNRddckkadcnadaVQTFVNSLPEDDQEARTQLAEHEKFLRELAEKEIEKDATIGLAQRILVKSHPDGATVIKHWITIIQSRWEEVSSWAKQREERLRNHlrslqdldslleellewlAKCESHLLNLEAEPLPDDIPTVERLIEEHKEFMEATSKRQHEVDSVRASPSREKLNDNLPHYGPRFPPKGSKGAEPQFRNPRCRLLWDTWRNVWLLAWERQRRLQERLNYLIELEKVKNFSWDDWRKRFLRFMNHKKSRLTDLFRKMDKNNDGLIPREDFVDGIIKTKFETSKLEMGAVADMFDHDYNPGLIDWKEFIAALRPDWEEKKPNTESEKIHDEVKRLVQLCTCRQKFRVFQVGEGKYRFGDSQKLRLVRILRSTVMVRVGGGWVALDEFLIKNDPCRDNVCQ

***************************************************************************************AVAKQFQDKLTGILDWLDK*******************************ILR**PDFTELTDIASSLMGLVGEDEAAGVADKLQDTADRYGALVEASDNLGQYAFLYNQLILSPRFSSVTDIKKKLERLNGLWNEVQKA*******LEEALALAEKFWSELQSVMATL******************************************************************IEDLDSAWDNVTALFAKREENLIHAMEKAMEFHETL*****QGTITALFAKREENLIHAME************************AVQTF****************************EIEKDATIGLAQRILVKSHPDGATVIKHWITIIQSRWEEVSSWAKQR**RLRNHLRSLQDLDSLLEELLEWLAKCESHLLNLEAE*******************************************************************PRCRLLWDTWRNVWLLAWERQRRLQERLNYLIELEKVKNFSWDDWRKRFLRFMNHKKSRLTDLFRKMDKNNDGLIPREDFVDGIIKTKFETSKLEMGAVADMFDHDYNPGLIDWKEFIAALRPDW************HDEVKRLVQLCTCRQKFRVFQVGEGKYRFGDSQKLRLVRILRSTVMVRVGGGWVALDEFLIKNDPC******

M*****PPSADYKVVKAQLQEQKFLKKMLADRQHSMSSLFQM*****************RQLNELMNRFDNLNEGASQRMDALEQAMAVAKQFQDKLTGILDWLDK********************RIREHDALHKEILRKKPDFTELTDIASSLMG***********DKLQDTADRYGALVEASDNLGQYAFLYNQLI**************LERLNGLWNEVQKATNDRGRSLEEALALAEKFWSELQSVMATLRDLQ*****************QQQYALKEIKAEIDQTKPEVEQCRAS***********************DSAWDNVTALF************KAMEFHETLQRKGEQGTITALFAKR*E***********FHETLQQNRDDCKKADCNA***************************************ATIGL*****************HWITIIQSRWEEVSSWAKQREERLRNHLRSLQDLDSLLEELLEWLAKC*********************LIEEHKEFMEATSKRQHEVDS**************************************RLLWDTWRNVWLLAWERQRRLQERLNYLIELEKVKNFSWDDWRKRFLRFMNH*************************V*****************VADM**HDYN***IDWKEFIA*****************IHDEVKRLVQLCTCRQKFRVFQVGEGKYRFGDSQKLRLVRILRSTVMVRVGGGWVALDEFLIKNDPCRD****

***********YKVVKAQLQEQKFLKKMLADRQHSMSSLFQMGNEVAANADPAERKAIERQLNELMNRFDNLNEGASQRMDALEQAMAVAKQFQDKLTGILDWLDKSEKKIKDMELIPTDEEKIQQRIREHDALHKEILRKKPDFTELTDIASSLMGLVGEDEAAGVADKLQDTADRYGALVEASDNLGQYAFLYNQLILSPRFSSVTDIKKKLERLNGLWNEVQKATNDRGRSLEEALALAEKFWSELQSVMATLRDLQDNLNSQEPPAVEPKAIQQQQYALKEIKAEIDQTKPEVEQCRASGQKLMKICGEPDKPEVKKHIEDLDSAWDNVTALFAKREENLIHAMEKAMEFHETLQRKGEQGTITALFAKREENLIHAMEKAMEFHETLQQNRDDCKKADCNADAVQTFVNSLPEDDQEARTQLAEHEKFLRELAEKEIEKDATIGLAQRILVKSHPDGATVIKHWITIIQSRWEEVSSWAKQREERLRNHLRSLQDLDSLLEELLEWLAKCESHLLNLEAEPLPDDIPTVERLIEEHKEFM*******************EKLNDNLPHYGPRFPPKGSKGAEPQFRNPRCRLLWDTWRNVWLLAWERQRRLQERLNYLIELEKVKNFSWDDWRKRFLRFMNHKKSRLTDLFRKMDKNNDGLIPREDFVDGIIKTKFETSKLEMGAVADMFDHDYNPGLIDWKEFIAALRPDWEE*********IHDEVKRLVQLCTCRQKFRVFQVGEGKYRFGDSQKLRLVRILRSTVMVRVGGGWVALDEFLIKNDPCRDNVCQ

*****KPPSADYKVVKAQLQEQKFLKKMLADRQHSMSSLFQMGNEVAANADPAERKAIERQLNELMNRFDNLNEGASQRMDALEQAMAVAKQFQDKLTGILDWLDKSEKKIKDMELIPTDEEKIQQRIREHDALHKEILRKKPDFTELTDIASSLMGLVGEDEAAGVADKLQDTADRYGALVEASDNLGQYAFLYNQLILSPRFSSVTDIKKKLERLNGLWNEVQKATNDRGRSLEEALALAEKFWSELQSVMATLRDLQDNLNSQEPPAVEPKAIQQQQYALKEIKAEIDQTKPEVEQCRASGQKLMKICGEPDKPEVKKHIEDLDSAWDNVTALFAKREENLIHAMEKAMEFHETLQRKGEQGTITALFAKREENLIHAMEKAMEFHETLQQNRDDCKKADCNADAVQTFVNSLPEDDQEARTQLAEHEKFLRELAEKEIEKDATIGLAQRILVKSHPDGATVIKHWITIIQSRWEEVSSWAKQREERLRNHLRSLQDLDSLLEELLEWLAKCESHLLNLEAEPLPDDIPTVERLIEEHKEFMEATSKRQHEVDSVRASPSREKLNDNLPHYGPRFPPKGSKGAEPQFRNPRCRLLWDTWRNVWLLAWERQRRLQERLNYLIELEKVKNFSWDDWRKRFLRFMNHKKSRLTDLFRKMDKNNDGLIPREDFVDGIIKTKFETSKLEMGAVADMFDHDYNPGLIDWKEFIAALRPDWEEKKPNTESEKIHDEVKRLVQLCTCRQKFRVFQVGEGKYRFGDSQKLRLVRILRSTVMVRVGGGWVALDEFLIKNDPCR*****

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MVANQKPPSADYKVVKAQLQEQKFLKKMLADRQHSMSSLFQMGNEVAANADPAExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxMAVAKQFQDKLTGILDWLDKSEKKIKDMELIPTDEEKIQQRIREHDALHKEILRKKPDFTELTDIASSLMGLVGEDEAAGVADKLQDTADRYGALVEASDNLGQYAFLYNQLILSPRFSSVTDIKKKLERLNGLWNEVQKATNDRGRSLEEALALAEKFWSELQSVMATLRDLQDNLNSQEPPAVEPKAIQQQQYALKEIKAEIDQTKPEVEQCRASGQKLMKICGEPDKPEVKKHIEDLDSAWDNVTALFAKREENLIHAMEKAMEFHETLQRKGEQGTITALFAKREENLIHAMEKAMEFHETLQQNRDDCKKADCNADAVQTFVNSLPEDDQEARTQLAEHEKFLRELAEKEIEKDATIGLAQRILVKSHPDGATVIKHWITIIQSRWEEVSSWAKQREERLRNHLRSLQDLDSLLEELLEWLAKCESHLLNLEAEPLPDDIPTVERLIEEHKEFMEATSKRQHEVDSVRASPSREKLNDNLPHYGPRFPPKGSKGAEPQFRNPRCRLLWDTWRNVWLLAWERQRRLQERLNYLIELEKVKNFSWDDWRKRFLRFMNHKKSRLTDLFRKMDKNNDGLIPREDFVDGIIKTKFETSKLEMGAVADMFDHDYNPGLIDWKEFIAALRPDWEEKKPNTESEKIHDEVKRLVQLCTCRQKFRVFQVGEGKYRFGDSQKLRLVRILRSTVMVRVGGGWVALDEFLIKNDPCRDNVCQ

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		801	2.2.26 [Sep-21-2011]
D3ZHV2		5430	Microtubule-actin cross-l	yes	N/A	0.872	0.128	0.340	1e-120
Q9UPN3		7388	Microtubule-actin cross-l	yes	N/A	0.877	0.095	0.339	1e-118
Q9QXZ0		7354	Microtubule-actin cross-l	yes	N/A	0.877	0.095	0.337	1e-117
Q91ZU6		7389	Dystonin OS=Mus musculus	no	N/A	0.878	0.095	0.332	1e-112
Q03001		7570	Dystonin OS=Homo sapiens	no	N/A	0.873	0.092	0.332	1e-110
Q5SSG4		860	GAS2-like protein 2 OS=Mu	no	N/A	0.079	0.074	0.578	1e-15
Q8JZP9		678	GAS2-like protein 1 OS=Mu	no	N/A	0.079	0.094	0.562	4e-15
Q8NHY3		880	GAS2-like protein 2 OS=Ho	no	N/A	0.079	0.072	0.578	5e-15
Q99501		681	GAS2-like protein 1 OS=Ho	no	N/A	0.079	0.093	0.562	7e-15
Q86XJ1		694	GAS2-like protein 3 OS=Ho	no	N/A	0.084	0.097	0.452	1e-11

>sp\|D3ZHV2\|MACF1_RAT Microtubule-actin cross-linking factor 1 OS=Rattus norvegicus GN=Macf1 PE=1 SV=1	Back alignment and function desciption

 Score =  434 bits (1115), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 276/811 (34%), Positives = 433/811 (53%), Gaps = 112/811 (13%)

Query: 7    PPSADYKVVKAQLQEQKFLKKMLADRQHSMSSLFQMGNEVAANADPAERKAIERQLNELM 66
            PPS     V +Q++E K     +   +  +  L Q GN++   +   +   I+  L  + 
Sbjct: 4512 PPSLILNTVLSQIEEHKVFANEVNAHRDQIIELDQTGNQLKFLSQKQDVVLIKNLLVSVQ 4571

Query: 67   NRFDNLNEGASQRMDALEQAMAVAKQFQDKLTGILDWLDKSEKKIKDMEL-IPTDEEKIQ 125
            +R++ + + + +R  +L+ A   AKQF +    ++DWL+ +E  + D EL I  D +KI+
Sbjct: 4572 SRWEKVVQRSIERGRSLDDARKRAKQFHEAWKKLIDWLEDAESHL-DSELEISNDPDKIK 4630

Query: 126  QRIREHDALHKEILRKKPDFTELTDIASSLMGLVGEDEAAGVADKLQDTADRYG-ALVEA 184
             ++ +H    K +  K+P +                           DT  R G AL E 
Sbjct: 4631 LQLSKHKEFQKTLGGKQPVY---------------------------DTTIRTGRALKEK 4663

Query: 185  SDNLGQYAFLYNQLILSPRFSSVTDIKKKLERLNG----LWNEVQKATNDRGRSLEEALA 240
            +                     + D  +KL+ L G     W+ V   + +R   LEEAL 
Sbjct: 4664 T--------------------LLADDAQKLDNLLGEVRDKWDTVCGKSVERQHKLEEALL 4703

Query: 241  LAEKFWSELQSVMATLRDLQDNLNSQEPPAVEPKAIQQQQYALKEIKAEIDQTKPEVEQC 300
             + +F   LQ+++  L  ++  L   +P   +   +     A K  + E+ +    V+  
Sbjct: 4704 FSGQFMDALQALVDWLYKVEPQLAEDQPVHGDLDLVMNLMDAHKVFQKELGKRTGTVQVL 4763

Query: 301  RASGQKLMKICGEPDKPEVKKHIEDLDSAWDNVTALFAKREENLIHAMEKAMEFHETLQR 360
            + SG++L++     D   VK  +++L + WD V  L   ++  L  A+++A EF +T+  
Sbjct: 4764 KRSGRELIE-SSRDDTTWVKGQLQELSTRWDTVCKLSVSKQSRLEQALKQAEEFRDTVHM 4822

Query: 361  KGEQGTITALFAKREENLIHAMEKAMEFHETLQQNRDDCKKADCNADAVQTFVNSLPEDD 420
                                 +E   E  +TL+                  F  +LP+D 
Sbjct: 4823 --------------------LLEWLSEAEQTLR------------------FRGALPDDT 4844

Query: 421  QEARTQLAEHEKFLRELAEKEIEKDATIGLAQRILVKSHPDGATVIKHWITIIQSRWEEV 480
            +  ++ +  H++F++++ EK ++ +A + + + IL   HPD  T IKHWITII++R+EEV
Sbjct: 4845 EALQSLIDTHKEFMKKVEEKRVDVNAAVAMGEVILAVCHPDCITTIKHWITIIRARFEEV 4904

Query: 481  SSWAKQREERLRNHLRSLQDLDSLLEELLEWLAKCESHLLNLEAEPLPDDIPTVERLIEE 540
             +WAKQ ++RL   L  L     LLEELL W+   E+ L+  + EP+P +I  V+ LI E
Sbjct: 4905 LTWAKQHQQRLETALSELVANAELLEELLAWIQWAETTLIQRDQEPIPQNIDRVKALITE 4964

Query: 541  HKEFMEATSKRQHEVDSVRASPSREKLNDNLPHYGPRF---------------PPKGSKG 585
            H+ FME  +++Q +VD V  +  R+ +    P + P                 PP     
Sbjct: 4965 HQSFMEEMTRKQPDVDRVTKTYKRKNIE---PTHAPFIEKSRSGSRKSLNQPTPPPMPIL 5021

Query: 586  AEPQFRNPRCRLLWDTWRNVWLLAWERQRRLQERLNYLIELEKVKNFSWDDWRKRFLRFM 645
            ++ + +NPR   L   W+ VWLLA ERQR+L + L+ L EL++  NF +D WRK+++R+M
Sbjct: 5022 SQSEAKNPRINQLSARWQQVWLLALERQRKLNDALDRLEELKEFANFDFDVWRKKYMRWM 5081

Query: 646  NHKKSRLTDLFRKMDKNNDGLIPREDFVDGIIKTKFETSKLEMGAVADMFDHDYNPGLID 705
            NHKKSR+ D FR++DK+ DG I R++F+DGI+ +KF T+KLEM AVAD+FD D + G ID
Sbjct: 5082 NHKKSRVMDFFRRIDKDQDGKITRQEFIDGILASKFPTTKLEMTAVADIFDRDGD-GYID 5140

Query: 706  WKEFIAALRPDWEEKKPNTESEKIHDEVKRLVQLCTCRQKFRVFQVGEGKYRFGDSQKLR 765
            + EF+AAL P+ +  +P T+++KI DEV R V  C C ++F+V Q+GE KYRFGDSQ+LR
Sbjct: 5141 YYEFVAALHPNKDAYRPTTDADKIEDEVTRQVAQCKCAKRFQVEQIGENKYRFGDSQQLR 5200

Query: 766  LVRILRSTVMVRVGGGWVALDEFLIKNDPCR 796
            LVRILRSTVMVRVGGGW+ALDEFL+KNDPCR
Sbjct: 5201 LVRILRSTVMVRVGGGWMALDEFLVKNDPCR 5231

F-actin-binding protein which may play a role in cross-linking actin to other cytoskeletal proteins and also binds to microtubules. Plays an important role in ERBB2-dependent stabilization of microtubules at the cell cortex. Acts as a positive regulator of Wnt receptor signaling pathway and is involved in the translocation of AXIN1 and its associated complex (composed of APC, CTNNB1 and GSK3B) from the cytoplasm to the cell membrane. Has actin-regulated ATPase activity and is essential for controlling focal adhesions (FAs) assembly and dynamics. May play role in delivery of transport vesicles containing GPI-linked proteins from the trans-Golgi network through its interaction with GOLGA4. Plays a key role in wound healing and epidermal cell migration. Required for efficient upward migration of bulge cells in response to wounding and this function is primarily rooted in its ability to coordinate MT dynamics and polarize hair follicle stem cells.
Rattus norvegicus (taxid: 10116)

>sp\|Q9UPN3\|MACF1_HUMAN Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens GN=MACF1 PE=1 SV=4	Back alignment and function description

>sp\|Q9QXZ0\|MACF1_MOUSE Microtubule-actin cross-linking factor 1 OS=Mus musculus GN=Macf1 PE=1 SV=2	Back alignment and function description

>sp\|Q91ZU6\|DYST_MOUSE Dystonin OS=Mus musculus GN=Dst PE=1 SV=1	Back alignment and function description

>sp\|Q03001\|DYST_HUMAN Dystonin OS=Homo sapiens GN=DST PE=1 SV=4	Back alignment and function description

>sp\|Q5SSG4\|GA2L2_MOUSE GAS2-like protein 2 OS=Mus musculus GN=Gas2l2 PE=2 SV=1	Back alignment and function description

>sp\|Q8JZP9\|GA2L1_MOUSE GAS2-like protein 1 OS=Mus musculus GN=Gas2l1 PE=2 SV=1	Back alignment and function description

>sp\|Q8NHY3\|GA2L2_HUMAN GAS2-like protein 2 OS=Homo sapiens GN=GAS2L2 PE=2 SV=1	Back alignment and function description

>sp\|Q99501\|GA2L1_HUMAN GAS2-like protein 1 OS=Homo sapiens GN=GAS2L1 PE=1 SV=2	Back alignment and function description

>sp\|Q86XJ1\|GA2L3_HUMAN GAS2-like protein 3 OS=Homo sapiens GN=GAS2L3 PE=1 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		801
328713962		5583	PREDICTED: microtubule-actin cross-linki	0.890	0.127	0.446	0.0
328713964		5304	PREDICTED: microtubule-actin cross-linki	0.890	0.134	0.446	0.0
328713960		5312	PREDICTED: microtubule-actin cross-linki	0.890	0.134	0.446	0.0
328713958		5303	PREDICTED: microtubule-actin cross-linki	0.890	0.134	0.446	0.0
328713956		5324	PREDICTED: microtubule-actin cross-linki	0.890	0.133	0.446	0.0
328713966		5295	PREDICTED: microtubule-actin cross-linki	0.890	0.134	0.446	0.0
350403208		3562	PREDICTED: microtubule-actin cross-linki	0.891	0.200	0.455	0.0
340728301		3568	PREDICTED: microtubule-actin cross-linki	0.891	0.200	0.455	0.0
383850429		8596	PREDICTED: LOW QUALITY PROTEIN: microtub	0.885	0.082	0.446	1e-179
345487070		8247	PREDICTED: microtubule-actin cross-linki	0.890	0.086	0.429	1e-177

>gi\|328713962\|ref\|XP_001943041.2\| PREDICTED: microtubule-actin cross-linking factor 1, isoforms 1/2/3/5-like isoform 1 [Acyrthosiphon pisum]	Back alignment and taxonomy information

 Score =  676 bits (1745), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/840 (44%), Positives = 498/840 (59%), Gaps = 127/840 (15%)

Query: 2    VANQKPPSADYKVVKAQLQEQKFLKKMLADRQHSMSSLFQMGNEVAANADPAERKAIERQ 61
            ++N KP S     +  Q+++ K  +K ++  +  M  L + G  +   +   +   I+  
Sbjct: 4591 LSNLKPVSRILATILTQIEDHKTFQKDVSSHREIMLHLDKKGTHLKYFSQKQDVILIKNL 4650

Query: 62   LNELMNRFDNLNEGASQRMDALEQAMAVAKQFQDKLTGILDWLDKSEKKIKDME---LIP 118
            L  + +RF+ +   +++R  AL+     A++F +  + ++DWL  +EK + ++     + 
Sbjct: 4651 LISVQHRFERVVSKSAERTRALDHGYKEAREFNEAWSSLMDWLATAEKNLDELTQDASVG 4710

Query: 119  TDEEKIQQRIREHDALHKEILRKKPDFTELTDIASSLMGLVGEDEAAGVADKLQDTADRY 178
             D E+I+QR+ +H  + + +  K+  +     +  +L       E A  +D+        
Sbjct: 4711 NDPERIKQRLAKHRDVQQALSGKQATYDSTMRMGKAL------KEKAPKSDE-------- 4756

Query: 179  GALVEASDNLGQYAFLYNQLILSPRFSSVTDIKKKLERLNGLWNEVQKATNDRGRSLEEA 238
                                   P    + ++K+K       WN V   + DR R LEEA
Sbjct: 4757 ----------------------QPLNKMINELKEK-------WNMVCTKSVDRQRKLEEA 4787

Query: 239  LALAEKFWSELQSVMATLRDLQDNLNSQEPPAVEPKAIQQQQYALKEIKAEIDQTKPEVE 298
            L    +F   +++++  LR  +  L    P   +   +       K  +  + +   +++
Sbjct: 4788 LLYCGQFKDAMEALLEWLRKTEKRLTDDGPVHGDLDTVMALVEQHKTFEETLSKRYEQMK 4847

Query: 299  QCRASGQKLMKICGEPDKPEVKKHIEDLDSAWDNVTALFAKREENLIHAMEKAMEFHETL 358
              R +G+ LM      D+  ++  ++DL+  W+  + L  KR E L  A+ +A + H++ 
Sbjct: 4848 TVRQTGKDLMSKANNADRAVIQNQLDDLEGLWNRTSQLCEKRTERLEDALRQAEQLHKS- 4906

Query: 359  QRKGEQGTITALFAKREENLIHAMEKAMEFHETLQQNRDDCKKADCNADAVQTFVNSLPE 418
                                +H + + +                  +A+    F+  LP+
Sbjct: 4907 --------------------VHLLLEWL-----------------SDAEMKLRFIGPLPD 4929

Query: 419  DDQEARTQLAEHEKFLRELAEKEIEKDATIGLAQRILVKSHPDGATVIKHWITIIQSRWE 478
            ++QE R QL EH KF+ E+++KE EKD+T+ LAQRIL K+HPD   VIKHWITIIQSRWE
Sbjct: 4930 NEQETRNQLNEHRKFIEEMSDKEHEKDSTVTLAQRILEKAHPDAVGVIKHWITIIQSRWE 4989

Query: 479  EVSSWAKQREERLRNHLRSLQDLDSLLEELLEWLAKCESHLLNLEAEPLPDDIPTVERLI 538
            EV +WAKQRE+RL  HL+SLQDLDSLLEEL  WL + E+ LL+LE+EPLPD +  VE+LI
Sbjct: 4990 EVWTWAKQREQRLVEHLQSLQDLDSLLEELFSWLTRLENRLLDLESEPLPDSVEVVEKLI 5049

Query: 539  EEHKEFMEATSKRQHEVDSV----------RASPS------------------------- 563
            EEH+EFME+TSKRQ EVD+V             PS                         
Sbjct: 5050 EEHREFMESTSKRQTEVDTVCKVKQPTAPVGRKPSAKKISAISREDLAGSSHDLSDQRRQ 5109

Query: 564  -------REKLNDNLPHYGPRFPPKGSKGAEPQFRNPRCRLLWDTWRNVWLLAWERQRRL 616
                   R+K  D+LPH GPRFP KGSK  EP  RN RCR LWD W  VWL+AWERQRRL
Sbjct: 5110 SRGSQIIRDKSMDHLPHIGPRFPAKGSKVEEPLLRNSRCRQLWDKWHTVWLMAWERQRRL 5169

Query: 617  QERLNYLIELEKVKNFSWDDWRKRFLRFMNHKKSRLTDLFRKMDKNNDGLIPREDFVDGI 676
            QERLNYL E+EKV+NFSWD WRKRFL+FMNHKKSRLTDLFRKMDKNNDGLIPR+DF+DGI
Sbjct: 5170 QERLNYLREVEKVRNFSWDLWRKRFLKFMNHKKSRLTDLFRKMDKNNDGLIPRDDFIDGI 5229

Query: 677  IKTKFETSKLEMGAVADMFDHDYNPGLIDWKEFIAALRPDWEEKKPNTESEKIHDEVKRL 736
            +KTKF+TSKLEM AVADMFDHD   GLIDWKEFIAALRPDWEEKKP+TESEKIHDEVKRL
Sbjct: 5230 MKTKFDTSKLEMNAVADMFDHD-KLGLIDWKEFIAALRPDWEEKKPDTESEKIHDEVKRL 5288

Query: 737  VQLCTCRQKFRVFQVGEGKYRFGDSQKLRLVRILRSTVMVRVGGGWVALDEFLIKNDPCR 796
            V LCTCRQKFRVFQVGEGKYRFGDSQKLRLVRILRSTVMVRVGGGWVALDEFL+KNDPCR
Sbjct: 5289 VMLCTCRQKFRVFQVGEGKYRFGDSQKLRLVRILRSTVMVRVGGGWVALDEFLVKNDPCR 5348

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi\|328713964\|ref\|XP_003245225.1\| PREDICTED: microtubule-actin cross-linking factor 1, isoforms 1/2/3/5-like isoform 5 [Acyrthosiphon pisum]	Back alignment and taxonomy information

>gi\|328713960\|ref\|XP_003245224.1\| PREDICTED: microtubule-actin cross-linking factor 1, isoforms 1/2/3/5-like isoform 4 [Acyrthosiphon pisum]	Back alignment and taxonomy information

>gi\|328713958\|ref\|XP_003245223.1\| PREDICTED: microtubule-actin cross-linking factor 1, isoforms 1/2/3/5-like isoform 3 [Acyrthosiphon pisum]	Back alignment and taxonomy information

>gi\|328713956\|ref\|XP_003245222.1\| PREDICTED: microtubule-actin cross-linking factor 1, isoforms 1/2/3/5-like isoform 2 [Acyrthosiphon pisum]	Back alignment and taxonomy information

>gi\|328713966\|ref\|XP_003245226.1\| PREDICTED: microtubule-actin cross-linking factor 1, isoforms 1/2/3/5-like isoform 6 [Acyrthosiphon pisum]	Back alignment and taxonomy information

>gi\|350403208\|ref\|XP_003486732.1\| PREDICTED: microtubule-actin cross-linking factor 1-like [Bombus impatiens]	Back alignment and taxonomy information

>gi\|340728301\|ref\|XP_003402464.1\| PREDICTED: microtubule-actin cross-linking factor 1-like [Bombus terrestris]	Back alignment and taxonomy information

>gi\|383850429\|ref\|XP_003700798.1\| PREDICTED: LOW QUALITY PROTEIN: microtubule-actin cross-linking factor 1-like [Megachile rotundata]	Back alignment and taxonomy information

>gi\|345487070\|ref\|XP_001602426.2\| PREDICTED: microtubule-actin cross-linking factor 1-like [Nasonia vitripennis]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		801
FB\|FBgn0013733		8805	shot "short stop" [Drosophila	0.294	0.026	0.736	1.2e-196
UNIPROTKB\|F1M0Y4		7321	F1M0Y4 "Uncharacterized protei	0.719	0.078	0.375	1.3e-127
UNIPROTKB\|F1LU52		5328	F1LU52 "Uncharacterized protei	0.719	0.108	0.371	6e-126
UNIPROTKB\|F1LWC9		7319	F1LWC9 "Uncharacterized protei	0.719	0.078	0.371	1.3e-125
UNIPROTKB\|F1M118		7327	F1M118 "Uncharacterized protei	0.719	0.078	0.371	1.3e-125
RGD\|1306057		5430	Macf1 "microtubule-actin cross	0.719	0.106	0.359	2.2e-121
UNIPROTKB\|F1RZU8		7500	DST "Uncharacterized protein"	0.715	0.076	0.371	2.2e-118
UNIPROTKB\|J9PAW7		7437	MACF1 "Uncharacterized protein	0.719	0.077	0.350	9.3e-118
MGI\|MGI:108559		7354	Macf1 "microtubule-actin cross	0.671	0.073	0.317	6.1e-97
UNIPROTKB\|F1PUS9		5177	DST "Uncharacterized protein"	0.717	0.111	0.366	1.3e-111

FB\|FBgn0013733 shot "short stop" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

 Score = 963 (344.1 bits), Expect = 1.2e-196, Sum P(4) = 1.2e-196
 Identities = 176/239 (73%), Positives = 207/239 (86%)

Query:   559 RASPSREKLN-DNLPHYGPRFPPKGSKGAEPQFRNPRCRLLWDTWRNVWLLAWERQRRLQ 617
             R +P+R+  + D LPHYGPRF P  S G E +FR+PR +LLW  WR+VW+L+WERQR L 
Sbjct:  8283 RITPTRDTPDRDRLPHYGPRFSPSTS-GPELEFRSPRAKLLWTKWRDVWMLSWERQRLLN 8341

Query:   618 ERLNYLIELEKVKNFSWDDWRKRFLRFMNHKKSRLTDLFRKMDKNNDGLIPREDFVDGII 677
             + L YL ++E+ +NFSWDDWRKRFL++MNHKKSRLTDLFRKMDK+N+G+IPR+ F+DGI+
Sbjct:  8342 DHLLYLKDVERARNFSWDDWRKRFLKYMNHKKSRLTDLFRKMDKDNNGMIPRDVFIDGIL 8401

Query:   678 KTKFETSKLEMGAVADMFDHDYNPGLIDWKEFIAALRPDWEEKKPNTESEKIHDEVKRLV 737
              TKF+TS LEM AVAD+FD +   GLIDW+EFIAALRPDW+E+KP  +S+KIHDEVKRLV
Sbjct:  8402 NTKFDTSGLEMKAVADLFDRN-GEGLIDWQEFIAALRPDWQERKPANDSDKIHDEVKRLV 8460

Query:   738 QLCTCRQKFRVFQVGEGKYRFGDSQKLRLVRILRSTVMVRVGGGWVALDEFLIKNDPCR 796
              LCTCRQKFRVFQVGEGKYRFGDSQKLRLVRILRSTVMVRVGGGWVALDEFL KNDPCR
Sbjct:  8461 MLCTCRQKFRVFQVGEGKYRFGDSQKLRLVRILRSTVMVRVGGGWVALDEFLQKNDPCR 8519

GO:0016203 "muscle attachment" evidence=NAS;TAS

GO:0007517 "muscle organ development" evidence=NAS

GO:0007017 "microtubule-based process" evidence=ISS;NAS

GO:0008017 "microtubule binding" evidence=ISS;TAS

GO:0003779 "actin binding" evidence=ISS;TAS

GO:0016204 "determination of muscle attachment site" evidence=TAS

GO:0048813 "dendrite morphogenesis" evidence=IMP;TAS

GO:0005856 "cytoskeleton" evidence=NAS

GO:0008092 "cytoskeletal protein binding" evidence=ISS

GO:0030516 "regulation of axon extension" evidence=IMP

GO:0035147 "branch fusion, open tracheal system" evidence=IEP;IMP;TAS

GO:0007424 "open tracheal system development" evidence=IMP;TAS

GO:0035149 "lumen formation, open tracheal system" evidence=IMP

GO:0007423 "sensory organ development" evidence=TAS

GO:0007409 "axonogenesis" evidence=TAS

GO:0005874 "microtubule" evidence=IDA;TAS

GO:0007475 "apposition of dorsal and ventral imaginal disc-derived wing surfaces" evidence=TAS

GO:0016319 "mushroom body development" evidence=IMP

GO:0000226 "microtubule cytoskeleton organization" evidence=IMP;TAS

GO:0030036 "actin cytoskeleton organization" evidence=TAS

GO:0007026 "negative regulation of microtubule depolymerization" evidence=IMP

GO:0030716 "oocyte fate determination" evidence=IMP

GO:0045169 "fusome" evidence=IDA

GO:0005912 "adherens junction" evidence=IDA;TAS

GO:0007050 "cell cycle arrest" evidence=IEA

GO:0005509 "calcium ion binding" evidence=IEA

GO:0000235 "astral microtubule" evidence=IDA

GO:0005515 "protein binding" evidence=IPI

GO:0016199 "axon midline choice point recognition" evidence=IMP

GO:0030426 "growth cone" evidence=IDA

UNIPROTKB\|F1M0Y4 F1M0Y4 "Uncharacterized protein" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|F1LU52 F1LU52 "Uncharacterized protein" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|F1LWC9 F1LWC9 "Uncharacterized protein" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|F1M118 F1M118 "Uncharacterized protein" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

RGD\|1306057 Macf1 "microtubule-actin crosslinking factor 1" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|F1RZU8 DST "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|J9PAW7 MACF1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

MGI\|MGI:108559 Macf1 "microtubule-actin crosslinking factor 1" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

UNIPROTKB\|F1PUS9 DST "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		801
pfam02187		73	pfam02187, GAS2, Growth-Arrest-Specific Protein 2	4e-38
smart00243		73	smart00243, GAS2, Growth-Arrest-Specific Protein 2	6e-38
cd00176		213	cd00176, SPEC, Spectrin repeats, found in several	5e-19
cd00176		213	cd00176, SPEC, Spectrin repeats, found in several	5e-16
cd00176		213	cd00176, SPEC, Spectrin repeats, found in several	1e-15
cd00176		213	cd00176, SPEC, Spectrin repeats, found in several	4e-14
smart00150		101	smart00150, SPEC, Spectrin repeats	9e-09
smart00150		101	smart00150, SPEC, Spectrin repeats	2e-06
smart00150		101	smart00150, SPEC, Spectrin repeats	8e-06
cd00176		213	cd00176, SPEC, Spectrin repeats, found in several	1e-05
pfam00435		105	pfam00435, Spectrin, Spectrin repeat	6e-05
smart00150		101	smart00150, SPEC, Spectrin repeats	1e-04
COG0419		908	COG0419, SbcC, ATPase involved in DNA repair [DNA	1e-04
COG0419		908	COG0419, SbcC, ATPase involved in DNA repair [DNA	2e-04
pfam00435		105	pfam00435, Spectrin, Spectrin repeat	0.001
pfam13499		60	pfam13499, EF_hand_5, EF-hand domain pair	0.001
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	0.002
cd00051		63	cd00051, EFh, EF-hand, calcium binding motif; A di	0.003
pfam00435		105	pfam00435, Spectrin, Spectrin repeat	0.004

>gnl\|CDD\|111117 pfam02187, GAS2, Growth-Arrest-Specific Protein 2 Domain	Back alignment and domain information

 Score =  135 bits (342), Expect = 4e-38
 Identities = 50/70 (71%), Positives = 57/70 (81%)

Query: 727 EKIHDEVKRLVQLCTCRQKFRVFQVGEGKYRFGDSQKLRLVRILRSTVMVRVGGGWVALD 786
           +K+ DEVKR+V+ C C  KF V QV EGKYR GDSQ LRLVRILRS VMVRVGGGW  LD
Sbjct: 1   DKLDDEVKRIVEDCKCPDKFCVEQVSEGKYRVGDSQILRLVRILRSHVMVRVGGGWETLD 60

Query: 787 EFLIKNDPCR 796
           E+L+K+DPCR
Sbjct: 61  EYLLKHDPCR 70

Length = 73

>gnl\|CDD\|128539 smart00243, GAS2, Growth-Arrest-Specific Protein 2 Domain	Back alignment and domain information

>gnl|CDD|238103 cd00176, SPEC, Spectrin repeats, found in several proteins involved in cytoskeletal structure; family members include spectrin, alpha-actinin and dystrophin; the spectrin repeat forms a three helix bundle with the second helix interrupted by proline in some sequences; the repeats are independent folding units; tandem repeats are found in differing numbers and arrange in an antiparallel manner to form dimers; the repeats are defined by a characteristic tryptophan (W) residue in helix A and a leucine (L) at the carboxyl end of helix C and separated by a linker of 5 residues; two copies of the repeat are present here

Back alignment and domain information

>gnl\|CDD\|197544 smart00150, SPEC, Spectrin repeats	Back alignment and domain information

>gnl\|CDD\|197544 smart00150, SPEC, Spectrin repeats	Back alignment and domain information

>gnl\|CDD\|197544 smart00150, SPEC, Spectrin repeats	Back alignment and domain information

Back alignment and domain information

>gnl\|CDD\|215918 pfam00435, Spectrin, Spectrin repeat	Back alignment and domain information

>gnl\|CDD\|197544 smart00150, SPEC, Spectrin repeats	Back alignment and domain information

>gnl\|CDD\|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|215918 pfam00435, Spectrin, Spectrin repeat	Back alignment and domain information

>gnl\|CDD\|222177 pfam13499, EF_hand_5, EF-hand domain pair	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands	Back alignment and domain information

>gnl\|CDD\|215918 pfam00435, Spectrin, Spectrin repeat	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		801
KOG0517\|consensus		2473		100.0
KOG0517\|consensus		2473		100.0
KOG0040\|consensus		2399		100.0
KOG0040\|consensus		2399		100.0
smart00243		73	GAS2 Growth-Arrest-Specific Protein 2 Domain. GROW	100.0
PF02187		73	GAS2: Growth-Arrest-Specific Protein 2 Domain; Int	99.97
cd00176		213	SPEC Spectrin repeats, found in several proteins i	99.81
cd00176		213	SPEC Spectrin repeats, found in several proteins i	99.78
KOG4286\|consensus		966		99.65
KOG4286\|consensus		966		99.64
PF00435		105	Spectrin: Spectrin repeat; InterPro: IPR002017 Spe	99.19
smart00150		101	SPEC Spectrin repeats.	99.19
cd05022		89	S-100A13 S-100A13: S-100A13 domain found in protei	99.09
COG5126		160	FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S	99.07
smart00150		101	SPEC Spectrin repeats.	99.06
PF00435		105	Spectrin: Spectrin repeat; InterPro: IPR002017 Spe	99.04
cd05027		88	S-100B S-100B: S-100B domain found in proteins sim	99.02
PF13499		66	EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A	99.02
KOG0027\|consensus		151		98.98
KOG0027\|consensus		151		98.97
KOG0028\|consensus		172		98.94
COG5126		160	FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S	98.91
KOG0028\|consensus		172		98.87
cd05026		93	S-100Z S-100Z: S-100Z domain found in proteins sim	98.86
cd05031		94	S-100A10_like S-100A10_like: S-100A10 domain found	98.81
cd05025		92	S-100A1 S-100A1: S-100A1 domain found in proteins	98.8
cd05029		88	S-100A6 S-100A6: S-100A6 domain found in proteins	98.79
cd00052		67	EH Eps15 homology domain; found in proteins implic	98.69
smart00027		96	EH Eps15 homology domain. Pair of EF hand motifs t	98.68
cd00213		88	S-100 S-100: S-100 domain, which represents the la	98.63
PF14658		66	EF-hand_9: EF-hand domain	98.61
cd05023		89	S-100A11 S-100A11: S-100A11 domain found in protei	98.58
PF13833		54	EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A	98.55
PTZ00184		149	calmodulin; Provisional	98.49
KOG0030\|consensus		152		98.48
cd00051		63	EFh EF-hand, calcium binding motif; A diverse supe	98.44
cd00252		116	SPARC_EC SPARC_EC; extracellular Ca2+ binding doma	98.44
PTZ00183		158	centrin; Provisional	98.44
PTZ00183		158	centrin; Provisional	98.41
PTZ00184		149	calmodulin; Provisional	98.38
KOG0037\|consensus		221		98.32
cd05030		88	calgranulins Calgranulins: S-100 domain found in p	98.28
KOG0031\|consensus		171		98.2
KOG0031\|consensus		171		98.12
KOG0034\|consensus		187		98.12
KOG0044\|consensus		193		98.03
KOG0036\|consensus		463		98.02
KOG0044\|consensus		193		98.01
PF12128		1201	DUF3584: Protein of unknown function (DUF3584); In	98.0
KOG0030\|consensus		152		97.97
PF00036		29	EF-hand_1: EF hand; InterPro: IPR018248 Many calci	97.93
KOG0377\|consensus		631		97.93
KOG0041\|consensus		244		97.85
PF00036		29	EF-hand_1: EF hand; InterPro: IPR018248 Many calci	97.85
PF13405		31	EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J	97.72
cd05024		91	S-100A10 S-100A10: A subgroup of the S-100A10 doma	97.67
PLN02964		644	phosphatidylserine decarboxylase	97.62
PLN02964		644	phosphatidylserine decarboxylase	97.59
PRK04863		1486	mukB cell division protein MukB; Provisional	97.55
KOG0038\|consensus		189		97.45
PRK12309		391	transaldolase/EF-hand domain-containing protein; P	97.43
KOG0994\|consensus		1758		97.37
KOG4065\|consensus		144		97.3
PF13202		25	EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ	97.25
KOG0036\|consensus		463		97.2
KOG0035\|consensus		890		97.2
PF12763		104	EF-hand_4: Cytoskeletal-regulatory complex EF hand	96.97
KOG4240\|consensus		1025		96.95
KOG0994\|consensus		1758		96.78
PF13202		25	EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ	96.65
KOG0034\|consensus		187		96.58
PF06160		560	EzrA: Septation ring formation regulator, EzrA ; I	96.53
KOG4223\|consensus		325		96.39
KOG0037\|consensus		221		96.39
KOG4240\|consensus		1025		96.25
PRK04778		569	septation ring formation regulator EzrA; Provision	96.2
PF10591		113	SPARC_Ca_bdg: Secreted protein acidic and rich in	96.19
PF13405		31	EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J	96.18
KOG0046\|consensus		627		96.11
PF12128		1201	DUF3584: Protein of unknown function (DUF3584); In	95.99
PF06008		264	Laminin_I: Laminin Domain I; InterPro: IPR009254 L	95.98
PF06160		560	EzrA: Septation ring formation regulator, EzrA ; I	95.83
KOG4223\|consensus		325		95.81
PRK04863		1486	mukB cell division protein MukB; Provisional	95.77
PRK04778		569	septation ring formation regulator EzrA; Provision	95.69
KOG0377\|consensus		631		95.45
PF14788		51	EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA	95.34
PF13514		1111	AAA_27: AAA domain	95.24
KOG4251\|consensus		362		95.22
PRK03918		880	chromosome segregation protein; Provisional	94.57
TIGR00606		1311	rad50 rad50. This family is based on the phylogeno	94.5
KOG0516\|consensus		1047		94.5
smart00054		29	EFh EF-hand, calcium binding motif. EF-hands are c	94.37
PRK02224		880	chromosome segregation protein; Provisional	94.21
TIGR02169		1164	SMC_prok_A chromosome segregation protein SMC, pri	94.13
KOG2643\|consensus		489		93.77
KOG4251\|consensus		362		93.72
TIGR00606		1311	rad50 rad50. This family is based on the phylogeno	93.7
smart00054		29	EFh EF-hand, calcium binding motif. EF-hands are c	93.62
PF13833		54	EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A	93.53
PF08580		683	KAR9: Yeast cortical protein KAR9; InterPro: IPR01	92.99
PRK02224		880	chromosome segregation protein; Provisional	92.82
PF13499		66	EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A	92.79
PF14788		51	EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA	91.71
KOG2643\|consensus		489		91.05
PF09279		83	EF-hand_like: Phosphoinositide-specific phospholip	90.69
TIGR02169		1164	SMC_prok_A chromosome segregation protein SMC, pri	90.44
KOG0161\|consensus		1930		90.28
KOG0161\|consensus		1930		89.7
PF05042		174	Caleosin: Caleosin related protein; InterPro: IPR0	89.62
smart00027		96	EH Eps15 homology domain. Pair of EF hand motifs t	88.7
cd05022		89	S-100A13 S-100A13: S-100A13 domain found in protei	88.57
cd05026		93	S-100Z S-100Z: S-100Z domain found in proteins sim	88.47
PRK03918		880	chromosome segregation protein; Provisional	87.94
COG4477		570	EzrA Negative regulator of septation ring formatio	87.81
KOG3866\|consensus		442		87.55
cd05027		88	S-100B S-100B: S-100B domain found in proteins sim	87.49
cd00252		116	SPARC_EC SPARC_EC; extracellular Ca2+ binding doma	85.98
cd00052		67	EH Eps15 homology domain; found in proteins implic	84.94
cd05030		88	calgranulins Calgranulins: S-100 domain found in p	84.66
cd00213		88	S-100 S-100: S-100 domain, which represents the la	84.42
KOG2243\|consensus		5019		83.99
TIGR02168		1179	SMC_prok_B chromosome segregation protein SMC, com	83.94
KOG2562\|consensus		493		83.91
PF08580		683	KAR9: Yeast cortical protein KAR9; InterPro: IPR01	83.74
KOG3555\|consensus		434		83.12
cd05025		92	S-100A1 S-100A1: S-100A1 domain found in proteins	82.99
PF13514		1111	AAA_27: AAA domain	82.69
cd05023		89	S-100A11 S-100A11: S-100A11 domain found in protei	82.42
PF11802		268	CENP-K: Centromere-associated protein K; InterPro:	82.09
KOG1029\|consensus		1118		81.7
cd05031		94	S-100A10_like S-100A10_like: S-100A10 domain found	80.85
KOG1955\|consensus		737		80.75
cd05029		88	S-100A6 S-100A6: S-100A6 domain found in proteins	80.66

>KOG0517\|consensus	Back alignment and domain information

Probab=100.00  E-value=8.7e-48  Score=435.15  Aligned_cols=575  Identities=16%  Similarity=0.282  Sum_probs=511.6

Q ss_pred             CCCCCCCCCCChHHHHHHHHHHHHHHHHHHHhhHHHHHHHHhHHHHhhhCChhhHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy13767          1 MVANQKPPSADYKVVKAQLQEQKFLKKMLADRQHSMSSLFQMGNEVAANADPAERKAIERQLNELMNRFDNLNEGASQRM   80 (801)
Q Consensus         1 ~~~~~~~~~~d~~~v~~~l~~~~~l~~el~~~~~~v~~l~~~g~~L~~~~~~~~~~~i~~~l~~L~~rw~~L~~~~~~r~   80 (801)
                      |+..+..+..++.++...+.+|++|+.||.++++.++.|...|..|+...+ .-.+.|+.++..|+.+|..|...+.++.
T Consensus      1290 ~l~a~Desy~~~~nl~~k~~kHqAFeaELaank~~l~~i~~eG~~L~~ekp-e~~~~V~~kl~~L~~~W~~Le~~t~~Kg 1368 (2473)
T KOG0517|consen 1290 MLMAQDESYRDARNLHSKWLKHQAFEAELAANKEWLEKIEKEGQELVSEKP-ELKALVEKKLRELHKQWDELEKTTQEKG 1368 (2473)
T ss_pred             hhhccccchhhhhHHHHHHHHHHHHHHHHHhChHHHHHHHHHHHHHHhcCC-ccchhHHHHHHHHHHHHHHHHHHHHHHH
Confidence            566778889999999999999999999999999999999999999998764 4479999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCCCCCHHHHHHHHHHHHHHHHHHHccCccHHHHHHHHHHhhcccC
Q psy13767         81 DALEQAMAVAKQFQDKLTGILDWLDKSEKKIKDMELIPTDEEKIQQRIREHDALHKEILRKKPDFTELTDIASSLMGLVG  160 (801)
Q Consensus        81 ~~Le~~~~~~~~f~~~~~~l~~WL~~~e~~l~~~~~~~~d~~~v~~~l~~~~~l~~el~~~~~~~~~l~~~~~~L~~~~~  160 (801)
                      ..|.++-.. ..|...+.++..||.+.|..|.+ .+.|.|+.+++.++++|+.++.++..+...|..|.+.+..+.. .+
T Consensus      1369 ~~L~qA~~q-~~~~qs~~D~~~~l~~le~qL~S-~D~G~DL~Svn~llkKqq~lEsem~~~~~kv~el~s~~~~ma~-~~ 1445 (2473)
T KOG0517|consen 1369 RKLFQANRQ-ELLLQSLADAKKKLDELESQLQS-DDTGKDLTSVNDLLKKQQVLESEMEVRAQKVAELQSQAKAMAE-EG 1445 (2473)
T ss_pred             HHHHHHHhH-HHHHHHHHHHHHHHHHHHHHhcC-CCCCcCcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHhhhc-cC
Confidence            999999884 88999999999999999999976 5679999999999999999999999999999999999999986 44


Q ss_pred             hhhhhhHhhhHHhHHHHHHHHHHHHhhhhhhh------------------h-----------hhh-cc------------
Q psy13767        161 EDEAAGVADKLQDTADRYGALVEASDNLGQYA------------------F-----------LYN-QL------------  198 (801)
Q Consensus       161 ~~~~~~i~~~~~~l~~r~~~l~~~~~~r~~~L------------------W-----------~~~-~l------------  198 (801)
                      | ++..|.....++..||..|..++..|+..|                  |           .|+ .+            
T Consensus      1446 ~-~a~~I~~~~~~v~~Rf~~L~~Pl~~R~~~Le~S~e~hQf~~dvddE~~WV~ErlP~A~s~d~G~~L~~~q~l~KK~q~ 1524 (2473)
T KOG0517|consen 1446 H-SAENIEETTLAVLERFEDLLGPLQERRKQLEASKELHQFVRDVDDELLWVAERLPLASSTDYGENLQTVQSLHKKNQT 1524 (2473)
T ss_pred             c-chhhHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHhhCccCCchhhccChHHHHHHHHHhHH
Confidence            4 889999999999999999999999999888                  5           010 11            


Q ss_pred             ---------------------ccCCCCCchHHHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHH
Q psy13767        199 ---------------------ILSPRFSSVTDIKKKLERLNGLWNEVQKATNDRGRSLEEALALAEKFWSELQSVMATLR  257 (801)
Q Consensus       199 ---------------------~Ls~~~~~~~~i~~~l~~L~~~w~~l~~~~~~r~~~L~~~~~~~~~f~~~~~~l~~Wl~  257 (801)
                                           ..+++++.+..|..++.+|...|..|...+..|.+.|+++... ++|+-++.++++||.
T Consensus      1525 Lq~EI~~H~prI~~vl~~gq~Li~~~h~~a~~i~~~~~eLe~aW~eL~~a~e~R~~~L~~a~ka-QQY~fDaaE~EaWm~ 1603 (2473)
T KOG0517|consen 1525 LQAEIKGHQPRINDVLERGQSLIDSGHPEAEAIEEKLQELESAWQELKEACELRRQRLDEAVKA-QQYYFDAAEAEAWMG 1603 (2473)
T ss_pred             HHHHHHhcchHHHHHHHHhHHHHhcCCccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHhhHHHHHHHHh
Confidence                                 0125688999999999999999999999999999999999998 999999999999999


Q ss_pred             HHHHhhhcCCCCCCChHHHHHHHHHHHHHHHHHhccchhHHHHHHHHHHHHHHcCCCChhHHHHHHHHHHHHHHHHHHHH
Q psy13767        258 DLQDNLNSQEPPAVEPKAIQQQQYALKEIKAEIDQTKPEVEQCRASGQKLMKICGEPDKPEVKKHIEDLDSAWDNVTALF  337 (801)
Q Consensus       258 ~~e~~l~~~~~~~~d~~~~~~~l~~~~~l~~el~~~~~~~~~l~~~~~~L~~~~~~~~~~~i~~~l~~l~~~w~~l~~~~  337 (801)
                      +.+..+.+.+ .|.|..+...++++|+.++.++..|...|..|...|+.|+. .++|+++.|..+...|...|..|..++
T Consensus      1604 Eqel~m~see-~gkDE~sa~~llkKH~~Le~~v~~Y~~~i~qL~~~~~~lv~-~~hP~~eri~~rQ~qldkly~~Lk~LA 1681 (2473)
T KOG0517|consen 1604 EQELYMMSEE-YGKDEDSALKLLKKHQALEQEVEDYAQTIEQLAQKAQALVE-ANHPESERISRRQSQLDKLYAGLKDLA 1681 (2473)
T ss_pred             hhHHHHhhhh-ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhc-CCCChHHHHHHHHHHHHHHHHHHHHHH
Confidence            9999998876 88999999999999999999999999999999999999999 699999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHhhcCCcCcHHHHHHHhHHHHHHHHHHHHHHHHHHHHhHHhhhhhccchHHHhhhhcCCc
Q psy13767        338 AKREENLIHAMEKAMEFHETLQRKGEQGTITALFAKREENLIHAMEKAMEFHETLQQNRDDCKKADCNADAVQTFVNSLP  417 (801)
Q Consensus       338 ~~r~~~L~~~l~~~~~~~~~~~~l~~~~ti~~l~~kr~~wl~~a~~~a~~~~~~L~~~~edlk~~l~~~e~~~r~~~~~~  417 (801)
                      .+|+.+|++++    .++.+.+++++                        ++.|+.+     +..+.       .+.+++
T Consensus      1682 ~eRr~~Lee~l----~L~el~RE~dD------------------------LeqWIae-----~e~vA-------gS~elG 1721 (2473)
T KOG0517|consen 1682 EERRRRLEETL----RLYELSREVDD------------------------LEQWIAE-----KEVVA-------GSEELG 1721 (2473)
T ss_pred             HHHHHHHHHHH----HHHHHHHHHHH------------------------HHHHHHH-----HHHHh-------cChhhc
Confidence            99999999999    67778777643                        3334433     22222       245789


Q ss_pred             ccHHHHHHHHHHHHHHHHHHH-HhhHhHHHHHHHHHHHHhhcCcchhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy13767        418 EDDQEARTQLAEHEKFLRELA-EKEIEKDATIGLAQRILVKSHPDGATVIKHWITIIQSRWEEVSSWAKQREERLRNHLR  496 (801)
Q Consensus       418 ~d~~~l~~~l~~~~~~~~~l~-~~~~~v~~l~~~~~~Ll~~~~p~~~~~i~~~~~~l~~rw~~l~~~~~~r~~~L~~~~~  496 (801)
                      .|++++..+..+|.+|..++. ....+|++++.+++.||..+||++. .|..|-+.|++.|.+|+..+..|.+.|..+..
T Consensus      1722 qD~EHv~~Lq~KF~eFa~~te~iG~eRv~~~n~la~~LI~~ghs~a~-tvaewkd~LneaW~~LlELi~tR~q~Laas~e 1800 (2473)
T KOG0517|consen 1722 QDFEHVTLLQEKFREFARDTEAIGSERVAACNLLADELIERGHSAAA-TVAEWKDGLNEAWADLLELIDTRGQKLAASRE 1800 (2473)
T ss_pred             CChHHHHHHHHHHHHHHHHHhhhhHHHHHHHHHHHHHHHhcCCcchh-hHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            999999999999999999999 6778999999999999999999875 89999999999999999999999999999988


Q ss_pred             hHHHHHHHHHHHHHHHHHHHhhhhhccCCCCCCChhHHHHHHHHHHHHHHHHHhhhhhhhhhhccCccccccCCCCCCCC
Q psy13767        497 SLQDLDSLLEELLEWLAKCESHLLNLEAEPLPDDIPTVERLIEEHKEFMEATSKRQHEVDSVRASPSREKLNDNLPHYGP  576 (801)
Q Consensus       497 ~~~~f~~~~~el~~Wl~~~e~~l~~~~~~~~~~d~~~~~~~l~~hk~~~~ei~~~~~~~~~l~~~~~~~~~~~~L~~~~~  576 (801)
                      .++ |..++.++..||.++-..|    +..++.|+..++.+++.|..|+.||....++|..|.+.+.+      |..   
T Consensus      1801 lhr-f~~D~~E~l~riqeK~~~l----p~~lgRD~~s~~al~R~H~~fe~dl~~l~~Qvqql~e~a~r------Lq~--- 1866 (2473)
T KOG0517|consen 1801 LHR-FHRDAREVLGRIQEKQAAL----PDDLGRDLNSAEALQRKHEAFEHDLVALEPQVQQLQEDAAR------LQK--- 1866 (2473)
T ss_pred             HHH-HHhhHHHHHHHHHHHHhhC----chhhCCCcchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH------HHH---
Confidence            855 8888999999999988777    46799999999999999999999999999999999999987      543   


Q ss_pred             CCCCCCCCCCCCCccChhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcCCHHHHHHHHHHHHhHHHHHH
Q psy13767        577 RFPPKGSKGAEPQFRNPRCRLLWDTWRNVWLLAWERQRRLQERLNYLIELEKVKNFSWDDWRKRFLRFMNHKKSRL  652 (801)
Q Consensus       577 ~~~~~~~~~~~~~~i~~~~~~L~~~W~~L~~~~~~r~~~L~~~l~~l~e~~~~~~f~f~~~~~~~l~~~~~~~~~~  652 (801)
                      .+     .|+.++.|..+-..+...|..|...|..|+..|..+.+.         |.|.+....++.||...+..+
T Consensus      1867 ~Y-----aG~kA~aI~~reqeV~qaW~~L~~~~~~Rr~~L~~t~Dl---------~rF~~~VRDllsWmd~v~~qi 1928 (2473)
T KOG0517|consen 1867 AY-----AGDKAEAIQQREQEVLQAWAELQGACEARRDRLADTSDL---------FRFFSMVRDLLSWMDEVIRQI 1928 (2473)
T ss_pred             cc-----CCccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---------HHHHHHHHHHHHHHHHHHHHh
Confidence            22     236778999999999999999999999999999998875         344443333888987554444

>KOG0517\|consensus	Back alignment and domain information

>KOG0040\|consensus	Back alignment and domain information

>KOG0040\|consensus	Back alignment and domain information

>smart00243 GAS2 Growth-Arrest-Specific Protein 2 Domain	Back alignment and domain information

>PF02187 GAS2: Growth-Arrest-Specific Protein 2 Domain; InterPro: IPR003108 The growth-arrest-specific protein 2 domain is found associated with the spectrin repeat, calponin homology domain and EF hand in many proteins	Back alignment and domain information

>cd00176 SPEC Spectrin repeats, found in several proteins involved in cytoskeletal structure; family members include spectrin, alpha-actinin and dystrophin; the spectrin repeat forms a three helix bundle with the second helix interrupted by proline in some sequences; the repeats are independent folding units; tandem repeats are found in differing numbers and arrange in an antiparallel manner to form dimers; the repeats are defined by a characteristic tryptophan (W) residue in helix A and a leucine (L) at the carboxyl end of helix C and separated by a linker of 5 residues; two copies of the repeat are present here

Back alignment and domain information

>KOG4286\|consensus	Back alignment and domain information

>KOG4286\|consensus	Back alignment and domain information

>PF00435 Spectrin: Spectrin repeat; InterPro: IPR002017 Spectrin repeats [] are found in several proteins involved in cytoskeletal structure	Back alignment and domain information

>smart00150 SPEC Spectrin repeats	Back alignment and domain information

>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13	Back alignment and domain information

>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only]	Back alignment and domain information

>smart00150 SPEC Spectrin repeats	Back alignment and domain information

>PF00435 Spectrin: Spectrin repeat; InterPro: IPR002017 Spectrin repeats [] are found in several proteins involved in cytoskeletal structure	Back alignment and domain information

>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B	Back alignment and domain information

>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E	Back alignment and domain information

>KOG0027\|consensus	Back alignment and domain information

>KOG0027\|consensus	Back alignment and domain information

>KOG0028\|consensus	Back alignment and domain information

>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only]	Back alignment and domain information

>KOG0028\|consensus	Back alignment and domain information

>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z	Back alignment and domain information

>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10	Back alignment and domain information

>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1	Back alignment and domain information

>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6	Back alignment and domain information

>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction	Back alignment and domain information

>smart00027 EH Eps15 homology domain	Back alignment and domain information

>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif	Back alignment and domain information

>PF14658 EF-hand_9: EF-hand domain	Back alignment and domain information

>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11	Back alignment and domain information

>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A	Back alignment and domain information

>PTZ00184 calmodulin; Provisional	Back alignment and domain information

>KOG0030\|consensus	Back alignment and domain information

>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands	Back alignment and domain information

>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP)	Back alignment and domain information

>PTZ00183 centrin; Provisional	Back alignment and domain information

>PTZ00183 centrin; Provisional	Back alignment and domain information

>PTZ00184 calmodulin; Provisional	Back alignment and domain information

>KOG0037\|consensus	Back alignment and domain information

>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12	Back alignment and domain information

>KOG0031\|consensus	Back alignment and domain information

>KOG0031\|consensus	Back alignment and domain information

>KOG0034\|consensus	Back alignment and domain information

>KOG0044\|consensus	Back alignment and domain information

>KOG0036\|consensus	Back alignment and domain information

>KOG0044\|consensus	Back alignment and domain information

>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins	Back alignment and domain information

>KOG0030\|consensus	Back alignment and domain information

>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand	Back alignment and domain information

>KOG0377\|consensus	Back alignment and domain information

>KOG0041\|consensus	Back alignment and domain information

>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand	Back alignment and domain information

>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B	Back alignment and domain information

>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10	Back alignment and domain information

>PLN02964 phosphatidylserine decarboxylase	Back alignment and domain information

>PLN02964 phosphatidylserine decarboxylase	Back alignment and domain information

>PRK04863 mukB cell division protein MukB; Provisional	Back alignment and domain information

>KOG0038\|consensus	Back alignment and domain information

>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional	Back alignment and domain information

>KOG0994\|consensus	Back alignment and domain information

>KOG4065\|consensus	Back alignment and domain information

>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A	Back alignment and domain information

>KOG0036\|consensus	Back alignment and domain information

>KOG0035\|consensus	Back alignment and domain information

>PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A	Back alignment and domain information

>KOG4240\|consensus	Back alignment and domain information

>KOG0994\|consensus	Back alignment and domain information

>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A	Back alignment and domain information

>KOG0034\|consensus	Back alignment and domain information

>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site	Back alignment and domain information

>KOG4223\|consensus	Back alignment and domain information

>KOG0037\|consensus	Back alignment and domain information

>KOG4240\|consensus	Back alignment and domain information

>PRK04778 septation ring formation regulator EzrA; Provisional	Back alignment and domain information

>PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins	Back alignment and domain information

>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B	Back alignment and domain information

>KOG0046\|consensus	Back alignment and domain information

>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins	Back alignment and domain information

>PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells	Back alignment and domain information

>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site	Back alignment and domain information

>KOG4223\|consensus	Back alignment and domain information

>PRK04863 mukB cell division protein MukB; Provisional	Back alignment and domain information

>PRK04778 septation ring formation regulator EzrA; Provisional	Back alignment and domain information

>KOG0377\|consensus	Back alignment and domain information

>PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A	Back alignment and domain information

>PF13514 AAA_27: AAA domain	Back alignment and domain information

>KOG4251\|consensus	Back alignment and domain information

>PRK03918 chromosome segregation protein; Provisional	Back alignment and domain information

>TIGR00606 rad50 rad50	Back alignment and domain information

>KOG0516\|consensus	Back alignment and domain information

>smart00054 EFh EF-hand, calcium binding motif	Back alignment and domain information

>PRK02224 chromosome segregation protein; Provisional	Back alignment and domain information

>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>KOG2643\|consensus	Back alignment and domain information

>KOG4251\|consensus	Back alignment and domain information

>TIGR00606 rad50 rad50	Back alignment and domain information

>smart00054 EFh EF-hand, calcium binding motif	Back alignment and domain information

>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A	Back alignment and domain information

>PF08580 KAR9: Yeast cortical protein KAR9; InterPro: IPR013889 The KAR9 protein in Saccharomyces cerevisiae (Baker's yeast) is a cytoskeletal protein required for karyogamy, correct positioning of the mitotic spindle and for orientation of cytoplasmic microtubules []	Back alignment and domain information

>PRK02224 chromosome segregation protein; Provisional	Back alignment and domain information

>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E	Back alignment and domain information

>PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A	Back alignment and domain information

>KOG2643\|consensus	Back alignment and domain information

>PF09279 EF-hand_like: Phosphoinositide-specific phospholipase C, efhand-like; InterPro: IPR015359 This domain is predominantly found in the enzyme phosphoinositol-specific phospholipase C	Back alignment and domain information

>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>KOG0161\|consensus	Back alignment and domain information

>KOG0161\|consensus	Back alignment and domain information

>PF05042 Caleosin: Caleosin related protein; InterPro: IPR007736 This family contains plant proteins related to caleosin	Back alignment and domain information

>smart00027 EH Eps15 homology domain	Back alignment and domain information

>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13	Back alignment and domain information

>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z	Back alignment and domain information

>PRK03918 chromosome segregation protein; Provisional	Back alignment and domain information

>COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning]	Back alignment and domain information

>KOG3866\|consensus	Back alignment and domain information

>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B	Back alignment and domain information

>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP)	Back alignment and domain information

>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction	Back alignment and domain information

>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12	Back alignment and domain information

>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif	Back alignment and domain information

>KOG2243\|consensus	Back alignment and domain information

>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>KOG2562\|consensus	Back alignment and domain information

>PF08580 KAR9: Yeast cortical protein KAR9; InterPro: IPR013889 The KAR9 protein in Saccharomyces cerevisiae (Baker's yeast) is a cytoskeletal protein required for karyogamy, correct positioning of the mitotic spindle and for orientation of cytoplasmic microtubules []	Back alignment and domain information

>KOG3555\|consensus	Back alignment and domain information

>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1	Back alignment and domain information

>PF13514 AAA_27: AAA domain	Back alignment and domain information

>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11	Back alignment and domain information

>PF11802 CENP-K: Centromere-associated protein K; InterPro: IPR020993 Cenp-K is one of seven new Cenp-A-nucleosome distal (CAD) centromere components (the others being Cenp-L, Cenp-O, Cenp-P, Cenp-Q, Cenp-R and Cenp-S) that are identified as assembling on the Cenp-A nucleosome associated complex, NAC []	Back alignment and domain information

>KOG1029\|consensus	Back alignment and domain information

>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10	Back alignment and domain information

>KOG1955\|consensus	Back alignment and domain information

>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		801
1v5r_A		97	Solution Structure Of The Gas2 Domain Of The Growth		2e-09
3lij_A		494	Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820)		4e-04
3l19_A		214	Crystal Structure Of Calcium Binding Domain Of Cpcd		4e-04

>pdb|1V5R|A Chain A, Solution Structure Of The Gas2 Domain Of The Growth Arrest Specific 2 Protein Length = 97

Back alignment and structure

Iteration: 1
 Score = 61.6 bits (148), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 31/71 (43%), Positives = 46/71 (64%), Gaps = 5/71 (7%)
Query: 729 IHDEVKRLVQ--LCTCRQKFRVFQVGEGKYRFGDSQKLRLVRILRST-VMVRVGGGWVAL 785
           + D VKR+ +   C C  KF V ++ +G+YR G  +K+  +R+L +  VMVRVGGGW   
Sbjct: 10  LDDAVKRISEDPPCKCPTKFCVERLSQGRYRVG--EKILFIRMLHNKHVMVRVGGGWETF 67
Query: 786 DEFLIKNDPCR 796
             +L+K+DPCR
Sbjct: 68  AGYLLKHDPCR 78

PyMOL of 1v5r

>pdb|3LIJ|A Chain A, Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) In Complex With Ca2+ And Amppnp Length = 494

Back alignment and structure

>pdb|3L19|A Chain A, Crystal Structure Of Calcium Binding Domain Of Cpcdpk3, Cgd5_820 Length = 214

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		801
1u4q_A		322	Spectrin alpha chain, brain; alpha spectrin, three	3e-25
1u4q_A		322	Spectrin alpha chain, brain; alpha spectrin, three	3e-21
1u4q_A		322	Spectrin alpha chain, brain; alpha spectrin, three	2e-13
1u4q_A		322	Spectrin alpha chain, brain; alpha spectrin, three	1e-12
3edv_A		323	Spectrin beta chain, brain 1; spectrin repeat, coi	2e-24
3edv_A		323	Spectrin beta chain, brain 1; spectrin repeat, coi	6e-21
3edv_A		323	Spectrin beta chain, brain 1; spectrin repeat, coi	8e-20
3edv_A		323	Spectrin beta chain, brain 1; spectrin repeat, coi	5e-11
1v5r_A		97	Growth-arrest-specific protein 2; GAS2 domain, zin	2e-24
3kbt_A		326	Beta-I spectrin, spectrin beta chain, erythrocyte;	2e-23
3kbt_A		326	Beta-I spectrin, spectrin beta chain, erythrocyte;	3e-23
3kbt_A		326	Beta-I spectrin, spectrin beta chain, erythrocyte;	3e-21
3kbt_A		326	Beta-I spectrin, spectrin beta chain, erythrocyte;	1e-10
3kbt_A		326	Beta-I spectrin, spectrin beta chain, erythrocyte;	4e-10
1sjj_A		863	Actinin; 3-helix bundle, calponin homology domain,	5e-19
1sjj_A		863	Actinin; 3-helix bundle, calponin homology domain,	5e-18
1s35_A		214	Beta-I spectrin, spectrin beta chain, erythrocyte;	3e-18
1s35_A		214	Beta-I spectrin, spectrin beta chain, erythrocyte;	2e-16
1s35_A		214	Beta-I spectrin, spectrin beta chain, erythrocyte;	4e-16
1s35_A		214	Beta-I spectrin, spectrin beta chain, erythrocyte;	2e-14
1s35_A		214	Beta-I spectrin, spectrin beta chain, erythrocyte;	3e-04
1u5p_A		216	Spectrin alpha chain, brain; alpha spectrin, two r	1e-17
1u5p_A		216	Spectrin alpha chain, brain; alpha spectrin, two r	2e-15
1u5p_A		216	Spectrin alpha chain, brain; alpha spectrin, two r	6e-15
1u5p_A		216	Spectrin alpha chain, brain; alpha spectrin, two r	2e-13
1hci_A		476	Alpha-actinin 2; triple-helix coiled coil, contrac	3e-17
1hci_A		476	Alpha-actinin 2; triple-helix coiled coil, contrac	3e-17
1hci_A		476	Alpha-actinin 2; triple-helix coiled coil, contrac	2e-12
1quu_A		250	Human skeletal muscle alpha-actinin 2; triple-heli	2e-16
1quu_A		250	Human skeletal muscle alpha-actinin 2; triple-heli	8e-15
1quu_A		250	Human skeletal muscle alpha-actinin 2; triple-heli	2e-13
3fb2_A		218	Spectrin alpha chain, brain spectrin; non-erythroi	7e-15
3fb2_A		218	Spectrin alpha chain, brain spectrin; non-erythroi	2e-14
3fb2_A		218	Spectrin alpha chain, brain spectrin; non-erythroi	6e-14
3fb2_A		218	Spectrin alpha chain, brain spectrin; non-erythroi	1e-13
1cun_A		213	Protein (alpha spectrin); two repeats of spectrin,	2e-14
1cun_A		213	Protein (alpha spectrin); two repeats of spectrin,	3e-14
1cun_A		213	Protein (alpha spectrin); two repeats of spectrin,	2e-13
1cun_A		213	Protein (alpha spectrin); two repeats of spectrin,	2e-13
1cun_A		213	Protein (alpha spectrin); two repeats of spectrin,	2e-04
3lbx_B		185	Beta-I spectrin, spectrin beta chain, erythrocyte;	6e-14
3lbx_B		185	Beta-I spectrin, spectrin beta chain, erythrocyte;	2e-12
3lbx_B		185	Beta-I spectrin, spectrin beta chain, erythrocyte;	1e-07
3lbx_B		185	Beta-I spectrin, spectrin beta chain, erythrocyte;	8e-07
3edu_A		218	Beta-I spectrin, spectrin beta chain, erythrocyte;	8e-14
3edu_A		218	Beta-I spectrin, spectrin beta chain, erythrocyte;	4e-13
3edu_A		218	Beta-I spectrin, spectrin beta chain, erythrocyte;	5e-13
3edu_A		218	Beta-I spectrin, spectrin beta chain, erythrocyte;	6e-12
3edu_A		218	Beta-I spectrin, spectrin beta chain, erythrocyte;	7e-04
3pe0_A		283	Plectin; cytoskeleton, plakin, spectrin repeat, SH	2e-13
3pe0_A		283	Plectin; cytoskeleton, plakin, spectrin repeat, SH	1e-10
3pe0_A		283	Plectin; cytoskeleton, plakin, spectrin repeat, SH	1e-06
3pe0_A		283	Plectin; cytoskeleton, plakin, spectrin repeat, SH	3e-06
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	5e-12
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	5e-12
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	6e-07
3r6n_A		450	Desmoplakin; spectrin repeat, SH3 domain, cell adh	1e-11
3r6n_A		450	Desmoplakin; spectrin repeat, SH3 domain, cell adh	4e-08
3r6n_A		450	Desmoplakin; spectrin repeat, SH3 domain, cell adh	4e-06
3r6n_A		450	Desmoplakin; spectrin repeat, SH3 domain, cell adh	3e-05
2iak_A		224	Bullous pemphigoid antigen 1, isoform 5; triple he	4e-11
2iak_A		224	Bullous pemphigoid antigen 1, isoform 5; triple he	5e-11
2iak_A		224	Bullous pemphigoid antigen 1, isoform 5; triple he	2e-09
2iak_A		224	Bullous pemphigoid antigen 1, isoform 5; triple he	2e-08
2iak_A		224	Bullous pemphigoid antigen 1, isoform 5; triple he	2e-04
3pdy_A		210	Plectin; cytoskeleton, plakin, intermediate filame	1e-10
3pdy_A		210	Plectin; cytoskeleton, plakin, intermediate filame	2e-10
3pdy_A		210	Plectin; cytoskeleton, plakin, intermediate filame	3e-10
3pdy_A		210	Plectin; cytoskeleton, plakin, intermediate filame	4e-10
3pdy_A		210	Plectin; cytoskeleton, plakin, intermediate filame	2e-04
3lbx_A		161	Spectrin alpha chain, erythrocyte; tetramer, compl	1e-10
3lbx_A		161	Spectrin alpha chain, erythrocyte; tetramer, compl	2e-08
3lbx_A		161	Spectrin alpha chain, erythrocyte; tetramer, compl	5e-06
3lbx_A		161	Spectrin alpha chain, erythrocyte; tetramer, compl	4e-04
3f31_A		149	Spectrin alpha chain, brain; LONE helix followed b	1e-09
3f31_A		149	Spectrin alpha chain, brain; LONE helix followed b	9e-08
3f31_A		149	Spectrin alpha chain, brain; LONE helix followed b	1e-06
3f31_A		149	Spectrin alpha chain, brain; LONE helix followed b	8e-05
3li6_A		66	Calcium-binding protein; calcium signaling protein	7e-09
1wlz_A		105	DJBP, CAP-binding protein complex interacting prot	9e-08
3q5i_A		504	Protein kinase; CDPK, malaria, phosphotransferase,	2e-07
3e3r_A		204	Calcyphosin, calcyphosine; human calcyphosine, EF-	3e-07
3lij_A		494	Calcium/calmodulin dependent protein kinase with A	7e-07
3nyv_A		484	Calmodulin-domain protein kinase 1; serine/threoni	2e-06
3k21_A		191	PFCDPK3, calcium-dependent protein kinase 3; calci	6e-06
3mwu_A		486	Calmodulin-domain protein kinase 1; serine/threoni	7e-06
2aao_A		166	CDPK, calcium-dependent protein kinase, isoform AK	7e-06
3mse_B		180	Calcium-dependent protein kinase, putative; CDPKS,	8e-06
3pm8_A		197	PFCDPK2, calcium-dependent protein kinase 2; malar	9e-06
2pmy_A		91	RAS and EF-hand domain-containing protein; rasef,	1e-05
1ij5_A		323	Plasmodial specific LAV1-2 protein; fourty kDa cal	1e-05
1c07_A		95	Protein (epidermal growth factor receptor pathway	2e-05
2hps_A		186	Coelenterazine-binding protein with bound coelent;	3e-05
2kgr_A		111	Intersectin-1; structure, alternative splicing, ca	3e-05
2bec_A		202	Calcineurin B homologous protein 2; calcineurin-ho	4e-05
1jfj_A		134	Ehcabp, calcium-binding protein; EF-hand, helix-lo	6e-05
1jba_A		204	GCAP-2, protein (guanylate cyclase activating prot	7e-05
1q80_A		174	SCP, sarcoplasmic calcium-binding protein; all-alp	8e-05
3ll8_B		155	Calcineurin subunit B type 1; protein-peptide dock	1e-04
1s6j_A		87	CDPK, calcium-dependent protein kinase SK5; EF-han	1e-04
1fi6_A		92	EH domain protein REPS1; EPS15 homology domain, EF	1e-04
3khe_A		191	Calmodulin-like domain protein kinase isoform 3; c	2e-04
2hpk_A		208	Photoprotein berovin; structural genomics, PSI, pr	2e-04
1iq3_A		110	Ralbp1-interacting protein (partner of ralbp1); EF	2e-04
1nya_A		176	Calerythrin; EF-hand, metal binding protein; NMR {	2e-04
2ct9_A		208	Calcium-binding protein P22; EF-hand, metal bindin	2e-04
1qjt_A		99	EH1, epidermal growth factor receptor substrate su	6e-04

>1u4q_A Spectrin alpha chain, brain; alpha spectrin, three repeats of spectrin, alpha-helical linker region, 3-helix coiled-coil, structural protein; 2.50A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 Length = 322	Back alignment and structure

 Score =  106 bits (265), Expect = 3e-25
 Identities = 47/341 (13%), Positives = 114/341 (33%), Gaps = 50/341 (14%)

Query: 4   NQKPPSADYKVVKAQLQEQKFLKKMLADRQHSMSSLFQMGNEVAANADPAERKAIERQLN 63
             +    D   V   L++ + L+  ++  +  +  L    + +   +   +   ++ +  
Sbjct: 27  ASEDYGKDLASVNNLLKKHQLLEADISAHEDRLKDLNSQADSLMT-SSAFDTSQVKDKRE 85

Query: 64  ELMNRFDNLNEGASQRMDALEQAMAVAKQFQDKLTGILDWLDKSEKKIKDMELIPTDEEK 123
            +  RF  +   A+ R   L ++  +  QF   +     W+ + +  +   +    D   
Sbjct: 86  TINGRFQRIKSMAAARRAKLNESHRLH-QFFRDMDDEESWIKEKKLLVSSED-YGRDLTG 143

Query: 124 IQQRIREHDALHKEILRKKPDFTELTDIASSLMGLVGEDEAAGVADKLQDTADRYGALVE 183
           +Q   ++H  L  E+   +P    + D    L                            
Sbjct: 144 VQNLRKKHKRLEAELAAHEPAIQGVLDTGKKL---------------------------- 175

Query: 184 ASDNLGQYAFLYNQLILSPRFSSVTDIKKKLERLNGLWNEVQKATNDRGRSLEEALALAE 243
                                    +I+++L +    W E+++    RG+ LEE+L   +
Sbjct: 176 ----------------SDDNTIGKEEIQQRLAQFVDHWKELKQLAAARGQRLEESLEY-Q 218

Query: 244 KFWSELQSVMATLRDLQDNLNSQEPPAVEPKAIQQQQYALKEIKAEIDQTKPEVEQCRAS 303
           +F + ++   A + +    + S++       AIQ      +  + +    K  V    A+
Sbjct: 219 QFVANVEEEEAWINEKMTLVASEDYGDTLA-AIQGLLKKHEAFETDFTVHKDRVNDVCAN 277

Query: 304 GQKLMKICGEPDKPEVKKHIEDLDSAWDNVTALFAKREENL 344
           G+ L+K         +   ++ L     ++    A+R+  L
Sbjct: 278 GEDLIK-KNNHHVENITAKMKGLKGKVSDLEKAAAQRKAKL 317

PyMOL of 1u4q

>1u4q_A Spectrin alpha chain, brain; alpha spectrin, three repeats of spectrin, alpha-helical linker region, 3-helix coiled-coil, structural protein; 2.50A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 Length = 322	Back alignment and structure

>1u4q_A Spectrin alpha chain, brain; alpha spectrin, three repeats of spectrin, alpha-helical linker region, 3-helix coiled-coil, structural protein; 2.50A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 Length = 322	Back alignment and structure

>1u4q_A Spectrin alpha chain, brain; alpha spectrin, three repeats of spectrin, alpha-helical linker region, 3-helix coiled-coil, structural protein; 2.50A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 Length = 322	Back alignment and structure

>3edv_A Spectrin beta chain, brain 1; spectrin repeat, coiled coil, actin capping, actin-binding, alternative splicing, calmodulin-binding, cytoplasm; 1.95A {Homo sapiens} Length = 323	Back alignment and structure

>3edv_A Spectrin beta chain, brain 1; spectrin repeat, coiled coil, actin capping, actin-binding, alternative splicing, calmodulin-binding, cytoplasm; 1.95A {Homo sapiens} Length = 323	Back alignment and structure

>3edv_A Spectrin beta chain, brain 1; spectrin repeat, coiled coil, actin capping, actin-binding, alternative splicing, calmodulin-binding, cytoplasm; 1.95A {Homo sapiens} Length = 323	Back alignment and structure

>3edv_A Spectrin beta chain, brain 1; spectrin repeat, coiled coil, actin capping, actin-binding, alternative splicing, calmodulin-binding, cytoplasm; 1.95A {Homo sapiens} Length = 323	Back alignment and structure

>1v5r_A Growth-arrest-specific protein 2; GAS2 domain, zinc binding domain, apoptosis, cell cycle, structural genomics; NMR {Mus musculus} SCOP: d.82.4.1 Length = 97	Back alignment and structure

>3kbt_A Beta-I spectrin, spectrin beta chain, erythrocyte; complex, spectrin, spectrin repeat, three helix bundle, ANKY binding, disease mutation, structural protein, ZU5 sandwich; 2.75A {Homo sapiens} PDB: 3kbu_A Length = 326	Back alignment and structure

>3kbt_A Beta-I spectrin, spectrin beta chain, erythrocyte; complex, spectrin, spectrin repeat, three helix bundle, ANKY binding, disease mutation, structural protein, ZU5 sandwich; 2.75A {Homo sapiens} PDB: 3kbu_A Length = 326	Back alignment and structure

>3kbt_A Beta-I spectrin, spectrin beta chain, erythrocyte; complex, spectrin, spectrin repeat, three helix bundle, ANKY binding, disease mutation, structural protein, ZU5 sandwich; 2.75A {Homo sapiens} PDB: 3kbu_A Length = 326	Back alignment and structure

>3kbt_A Beta-I spectrin, spectrin beta chain, erythrocyte; complex, spectrin, spectrin repeat, three helix bundle, ANKY binding, disease mutation, structural protein, ZU5 sandwich; 2.75A {Homo sapiens} PDB: 3kbu_A Length = 326	Back alignment and structure

>3kbt_A Beta-I spectrin, spectrin beta chain, erythrocyte; complex, spectrin, spectrin repeat, three helix bundle, ANKY binding, disease mutation, structural protein, ZU5 sandwich; 2.75A {Homo sapiens} PDB: 3kbu_A Length = 326	Back alignment and structure

>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Length = 863	Back alignment and structure

>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Length = 863	Back alignment and structure

>1s35_A Beta-I spectrin, spectrin beta chain, erythrocyte; two repeats of spectrin, alpha helical linker region, 3- helix coiled-coils, beta spectrin; 2.40A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Length = 214	Back alignment and structure

>1s35_A Beta-I spectrin, spectrin beta chain, erythrocyte; two repeats of spectrin, alpha helical linker region, 3- helix coiled-coils, beta spectrin; 2.40A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Length = 214	Back alignment and structure

>1s35_A Beta-I spectrin, spectrin beta chain, erythrocyte; two repeats of spectrin, alpha helical linker region, 3- helix coiled-coils, beta spectrin; 2.40A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Length = 214	Back alignment and structure

>1s35_A Beta-I spectrin, spectrin beta chain, erythrocyte; two repeats of spectrin, alpha helical linker region, 3- helix coiled-coils, beta spectrin; 2.40A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Length = 214	Back alignment and structure

>1s35_A Beta-I spectrin, spectrin beta chain, erythrocyte; two repeats of spectrin, alpha helical linker region, 3- helix coiled-coils, beta spectrin; 2.40A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Length = 214	Back alignment and structure

>1u5p_A Spectrin alpha chain, brain; alpha spectrin, two repeats of spectrin, alpha-helical linker region, 3-helix coiled coil, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 Length = 216	Back alignment and structure

>1u5p_A Spectrin alpha chain, brain; alpha spectrin, two repeats of spectrin, alpha-helical linker region, 3-helix coiled coil, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 Length = 216	Back alignment and structure

>1u5p_A Spectrin alpha chain, brain; alpha spectrin, two repeats of spectrin, alpha-helical linker region, 3-helix coiled coil, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 Length = 216	Back alignment and structure

>1u5p_A Spectrin alpha chain, brain; alpha spectrin, two repeats of spectrin, alpha-helical linker region, 3-helix coiled coil, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 Length = 216	Back alignment and structure

>1hci_A Alpha-actinin 2; triple-helix coiled coil, contractIle protein, muscle, Z- LINE, actin-binding protein; 2.8A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 a.7.1.1 Length = 476	Back alignment and structure

>1hci_A Alpha-actinin 2; triple-helix coiled coil, contractIle protein, muscle, Z- LINE, actin-binding protein; 2.8A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 a.7.1.1 Length = 476	Back alignment and structure

>1hci_A Alpha-actinin 2; triple-helix coiled coil, contractIle protein, muscle, Z- LINE, actin-binding protein; 2.8A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 a.7.1.1 Length = 476	Back alignment and structure

>1quu_A Human skeletal muscle alpha-actinin 2; triple-helix coiled coil, contractIle protein; 2.50A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Length = 250	Back alignment and structure

>1quu_A Human skeletal muscle alpha-actinin 2; triple-helix coiled coil, contractIle protein; 2.50A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Length = 250	Back alignment and structure

>1quu_A Human skeletal muscle alpha-actinin 2; triple-helix coiled coil, contractIle protein; 2.50A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Length = 250	Back alignment and structure

>3fb2_A Spectrin alpha chain, brain spectrin; non-erythroid alpha chain alpha-II spectrin, fordrin alpha chain, sptan1, SPTA2_human, NESG, HR5563A; 2.30A {Homo sapiens} Length = 218	Back alignment and structure

>3fb2_A Spectrin alpha chain, brain spectrin; non-erythroid alpha chain alpha-II spectrin, fordrin alpha chain, sptan1, SPTA2_human, NESG, HR5563A; 2.30A {Homo sapiens} Length = 218	Back alignment and structure

>3fb2_A Spectrin alpha chain, brain spectrin; non-erythroid alpha chain alpha-II spectrin, fordrin alpha chain, sptan1, SPTA2_human, NESG, HR5563A; 2.30A {Homo sapiens} Length = 218	Back alignment and structure

>3fb2_A Spectrin alpha chain, brain spectrin; non-erythroid alpha chain alpha-II spectrin, fordrin alpha chain, sptan1, SPTA2_human, NESG, HR5563A; 2.30A {Homo sapiens} Length = 218	Back alignment and structure

>1cun_A Protein (alpha spectrin); two repeats of spectrin, alpha helical linker region, 2 tandem 3-helix coiled- coils, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 PDB: 1aj3_A Length = 213	Back alignment and structure

>1cun_A Protein (alpha spectrin); two repeats of spectrin, alpha helical linker region, 2 tandem 3-helix coiled- coils, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 PDB: 1aj3_A Length = 213	Back alignment and structure

>1cun_A Protein (alpha spectrin); two repeats of spectrin, alpha helical linker region, 2 tandem 3-helix coiled- coils, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 PDB: 1aj3_A Length = 213	Back alignment and structure

>1cun_A Protein (alpha spectrin); two repeats of spectrin, alpha helical linker region, 2 tandem 3-helix coiled- coils, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 PDB: 1aj3_A Length = 213	Back alignment and structure

>1cun_A Protein (alpha spectrin); two repeats of spectrin, alpha helical linker region, 2 tandem 3-helix coiled- coils, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 PDB: 1aj3_A Length = 213	Back alignment and structure

>3lbx_B Beta-I spectrin, spectrin beta chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} Length = 185	Back alignment and structure

>3lbx_B Beta-I spectrin, spectrin beta chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} Length = 185	Back alignment and structure

>3lbx_B Beta-I spectrin, spectrin beta chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} Length = 185	Back alignment and structure

>3lbx_B Beta-I spectrin, spectrin beta chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} Length = 185	Back alignment and structure

>3edu_A Beta-I spectrin, spectrin beta chain, erythrocyte; ankyrin, ankyrin-binding domain, actin capping, AC binding, cytoskeleton, disease mutation; 2.10A {Homo sapiens} PDB: 3f57_A Length = 218	Back alignment and structure

>3edu_A Beta-I spectrin, spectrin beta chain, erythrocyte; ankyrin, ankyrin-binding domain, actin capping, AC binding, cytoskeleton, disease mutation; 2.10A {Homo sapiens} PDB: 3f57_A Length = 218	Back alignment and structure

>3edu_A Beta-I spectrin, spectrin beta chain, erythrocyte; ankyrin, ankyrin-binding domain, actin capping, AC binding, cytoskeleton, disease mutation; 2.10A {Homo sapiens} PDB: 3f57_A Length = 218	Back alignment and structure

>3edu_A Beta-I spectrin, spectrin beta chain, erythrocyte; ankyrin, ankyrin-binding domain, actin capping, AC binding, cytoskeleton, disease mutation; 2.10A {Homo sapiens} PDB: 3f57_A Length = 218	Back alignment and structure

>3edu_A Beta-I spectrin, spectrin beta chain, erythrocyte; ankyrin, ankyrin-binding domain, actin capping, AC binding, cytoskeleton, disease mutation; 2.10A {Homo sapiens} PDB: 3f57_A Length = 218	Back alignment and structure

>3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens} Length = 283	Back alignment and structure

>3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens} Length = 283	Back alignment and structure

>3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens} Length = 283	Back alignment and structure

>3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens} Length = 283	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens} Length = 450	Back alignment and structure

>3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens} Length = 450	Back alignment and structure

>3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens} Length = 450	Back alignment and structure

>3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens} Length = 450	Back alignment and structure

>2iak_A Bullous pemphigoid antigen 1, isoform 5; triple helical bundle, spectrin repeat, cell adhesion; 3.00A {Mus musculus} Length = 224	Back alignment and structure

>2iak_A Bullous pemphigoid antigen 1, isoform 5; triple helical bundle, spectrin repeat, cell adhesion; 3.00A {Mus musculus} Length = 224	Back alignment and structure

>2iak_A Bullous pemphigoid antigen 1, isoform 5; triple helical bundle, spectrin repeat, cell adhesion; 3.00A {Mus musculus} Length = 224	Back alignment and structure

>2iak_A Bullous pemphigoid antigen 1, isoform 5; triple helical bundle, spectrin repeat, cell adhesion; 3.00A {Mus musculus} Length = 224	Back alignment and structure

>2iak_A Bullous pemphigoid antigen 1, isoform 5; triple helical bundle, spectrin repeat, cell adhesion; 3.00A {Mus musculus} Length = 224	Back alignment and structure

>3pdy_A Plectin; cytoskeleton, plakin, intermediate filament, spectrin repeat structural protein, crosslinking; 2.22A {Homo sapiens} Length = 210	Back alignment and structure

>3pdy_A Plectin; cytoskeleton, plakin, intermediate filament, spectrin repeat structural protein, crosslinking; 2.22A {Homo sapiens} Length = 210	Back alignment and structure

>3pdy_A Plectin; cytoskeleton, plakin, intermediate filament, spectrin repeat structural protein, crosslinking; 2.22A {Homo sapiens} Length = 210	Back alignment and structure

>3pdy_A Plectin; cytoskeleton, plakin, intermediate filament, spectrin repeat structural protein, crosslinking; 2.22A {Homo sapiens} Length = 210	Back alignment and structure

>3pdy_A Plectin; cytoskeleton, plakin, intermediate filament, spectrin repeat structural protein, crosslinking; 2.22A {Homo sapiens} Length = 210	Back alignment and structure

>3lbx_A Spectrin alpha chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} PDB: 1owa_A Length = 161	Back alignment and structure

>3lbx_A Spectrin alpha chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} PDB: 1owa_A Length = 161	Back alignment and structure

>3lbx_A Spectrin alpha chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} PDB: 1owa_A Length = 161	Back alignment and structure

>3lbx_A Spectrin alpha chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} PDB: 1owa_A Length = 161	Back alignment and structure

>3f31_A Spectrin alpha chain, brain; LONE helix followed by A triple helical bundle, actin cappin binding, alternative splicing, calcium; 2.30A {Homo sapiens} Length = 149	Back alignment and structure

>3f31_A Spectrin alpha chain, brain; LONE helix followed by A triple helical bundle, actin cappin binding, alternative splicing, calcium; 2.30A {Homo sapiens} Length = 149	Back alignment and structure

>3f31_A Spectrin alpha chain, brain; LONE helix followed by A triple helical bundle, actin cappin binding, alternative splicing, calcium; 2.30A {Homo sapiens} Length = 149	Back alignment and structure

>3f31_A Spectrin alpha chain, brain; LONE helix followed by A triple helical bundle, actin cappin binding, alternative splicing, calcium; 2.30A {Homo sapiens} Length = 149	Back alignment and structure

>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Length = 66	Back alignment and structure

>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Length = 105	Back alignment and structure

>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504	Back alignment and structure

>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Length = 204	Back alignment and structure

>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494	Back alignment and structure

>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484	Back alignment and structure

>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Length = 191	Back alignment and structure

>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486	Back alignment and structure

>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Length = 166	Back alignment and structure

>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Length = 180	Back alignment and structure

>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Length = 197	Back alignment and structure

>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Length = 91	Back alignment and structure

>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323	Back alignment and structure

>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Length = 95	Back alignment and structure

>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186	Back alignment and structure

>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Length = 111	Back alignment and structure

>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Length = 202	Back alignment and structure

>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Length = 134	Back alignment and structure

>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Length = 204	Back alignment and structure

>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174	Back alignment and structure

>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Length = 155	Back alignment and structure

>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 87	Back alignment and structure

>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Length = 92	Back alignment and structure

>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Length = 191	Back alignment and structure

>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208	Back alignment and structure

>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Length = 110	Back alignment and structure

>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176	Back alignment and structure

>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Length = 208	Back alignment and structure

>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Length = 99	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		801
1sjj_A		863	Actinin; 3-helix bundle, calponin homology domain,	100.0
1hci_A		476	Alpha-actinin 2; triple-helix coiled coil, contrac	100.0
1u4q_A		322	Spectrin alpha chain, brain; alpha spectrin, three	100.0
3edv_A		323	Spectrin beta chain, brain 1; spectrin repeat, coi	100.0
1u4q_A		322	Spectrin alpha chain, brain; alpha spectrin, three	100.0
3edv_A		323	Spectrin beta chain, brain 1; spectrin repeat, coi	100.0
3kbt_A		326	Beta-I spectrin, spectrin beta chain, erythrocyte;	100.0
3kbt_A		326	Beta-I spectrin, spectrin beta chain, erythrocyte;	99.98
1sjj_A		863	Actinin; 3-helix bundle, calponin homology domain,	99.97
1hci_A		476	Alpha-actinin 2; triple-helix coiled coil, contrac	99.97
3r6n_A		450	Desmoplakin; spectrin repeat, SH3 domain, cell adh	99.94
3r6n_A		450	Desmoplakin; spectrin repeat, SH3 domain, cell adh	99.93
1v5r_A		97	Growth-arrest-specific protein 2; GAS2 domain, zin	99.92
1u5p_A		216	Spectrin alpha chain, brain; alpha spectrin, two r	99.92
1cun_A		213	Protein (alpha spectrin); two repeats of spectrin,	99.92
1s35_A		214	Beta-I spectrin, spectrin beta chain, erythrocyte;	99.91
3edu_A		218	Beta-I spectrin, spectrin beta chain, erythrocyte;	99.9
1cun_A		213	Protein (alpha spectrin); two repeats of spectrin,	99.89
1u5p_A		216	Spectrin alpha chain, brain; alpha spectrin, two r	99.89
1s35_A		214	Beta-I spectrin, spectrin beta chain, erythrocyte;	99.89
1quu_A		250	Human skeletal muscle alpha-actinin 2; triple-heli	99.89
3edu_A		218	Beta-I spectrin, spectrin beta chain, erythrocyte;	99.88
3fb2_A		218	Spectrin alpha chain, brain spectrin; non-erythroi	99.88
3pdy_A		210	Plectin; cytoskeleton, plakin, intermediate filame	99.86
1quu_A		250	Human skeletal muscle alpha-actinin 2; triple-heli	99.86
3fb2_A		218	Spectrin alpha chain, brain spectrin; non-erythroi	99.85
2iak_A		224	Bullous pemphigoid antigen 1, isoform 5; triple he	99.85
3pdy_A		210	Plectin; cytoskeleton, plakin, intermediate filame	99.79
2iak_A		224	Bullous pemphigoid antigen 1, isoform 5; triple he	99.78
3lbx_B		185	Beta-I spectrin, spectrin beta chain, erythrocyte;	99.72
3lbx_B		185	Beta-I spectrin, spectrin beta chain, erythrocyte;	99.7
3lbx_A		161	Spectrin alpha chain, erythrocyte; tetramer, compl	99.67
3pe0_A		283	Plectin; cytoskeleton, plakin, spectrin repeat, SH	99.66
3f31_A		149	Spectrin alpha chain, brain; LONE helix followed b	99.64
3lbx_A		161	Spectrin alpha chain, erythrocyte; tetramer, compl	99.63
3pe0_A		283	Plectin; cytoskeleton, plakin, spectrin repeat, SH	99.6
3f31_A		149	Spectrin alpha chain, brain; LONE helix followed b	99.58
3uun_A		119	Dystrophin; triple helical, cell structure and sta	99.47
3uul_A		118	Utrophin; spectrin repeat, structural protein, cyt	99.46
3uul_A		118	Utrophin; spectrin repeat, structural protein, cyt	99.43
3uun_A		119	Dystrophin; triple helical, cell structure and sta	99.41
2lv7_A		100	Calcium-binding protein 7; metal binding protein;	99.38
1g8x_A		1010	Myosin II heavy chain fused to alpha-actinin 3; mo	99.34
2odv_A		235	Plectin 1, HD1; plakin domain, spectrin repeat, cy	99.2
3nso_A		101	Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta	99.18
2spc_A		107	Spectrin; cytoskeleton; 1.80A {Drosophila melanoga	99.15
3n22_A		98	Protein S100-A2; EF-hand, calcium-binding, zinc-bi	99.15
1g8x_A		1010	Myosin II heavy chain fused to alpha-actinin 3; mo	99.13
3i5g_C		159	Myosin catalytic light chain LC-1, mantle muscle;	99.12
3zwh_A		104	Protein S100-A4; Ca-binding protein-motor protein	99.11
4eto_A		93	Protein S100-A4; calcium-binding protein, EF-hand,	99.1
2lnk_A		113	Protein S100-A4; EF-hand, calcium binding, all alp	99.09
2lmt_A		148	Calmodulin-related protein 97A; spermatogenesis, m	99.09
1wlz_A		105	DJBP, CAP-binding protein complex interacting prot	99.09
2ktg_A		85	Calmodulin, putative; ehcam, Ca-binding protein, p	99.06
2spc_A		107	Spectrin; cytoskeleton; 1.80A {Drosophila melanoga	99.05
1tiz_A		67	Calmodulin-related protein, putative; helix-turn-h	99.05
2y5i_A		99	S100Z, S100 calcium binding protein Z; metal-bindi	99.04
2joj_A		77	Centrin protein; N-terminal domain, centrin soluti	99.04
2b1u_A		71	Calmodulin-like protein 5; CLSP, calmodulin-like S	99.04
2obh_A		143	Centrin-2; DNA repair complex EF hand superfamily	99.03
1fi6_A		92	EH domain protein REPS1; EPS15 homology domain, EF	99.02
2obh_A		143	Centrin-2; DNA repair complex EF hand superfamily	99.02
2kz2_A		94	Calmodulin, CAM; TR2C, metal binding protein; NMR	99.02
3k21_A		191	PFCDPK3, calcium-dependent protein kinase 3; calci	99.01
1avs_A		90	Troponin C; muscle contraction, calcium-activated,	99.01
1bu3_A		109	Calcium-binding protein; 1.65A {Merluccius bilinea	99.01
1j55_A		95	S-100P protein; metal binding protein; 2.00A {Homo	99.01
2pvb_A		108	Protein (parvalbumin); calcium binding protein, me	99.0
3rm1_A		92	Protein S100-B; alpha-helical, EF hand, metal bind	99.0
1qjt_A		99	EH1, epidermal growth factor receptor substrate su	99.0
1c07_A		95	Protein (epidermal growth factor receptor pathway	99.0
2d58_A		107	Allograft inflammatory factor 1; EF-hand, metal bi	99.0
3u0k_A		440	Rcamp; fluorescent protein, calcium binding, EF-ha	98.99
3fs7_A		109	Parvalbumin, thymic; calcium-binding protein, EF-h	98.99
5pal_A		109	Parvalbumin; calcium-binding protein; 1.54A {Triak	98.99
2lhi_A		176	Calmodulin, serine/threonine-protein phosphatase c	98.98
2wcb_A		95	Protein S100-A12; calcium signalling, HOST-parasit	98.98
4drw_A		121	Protein S100-A10/annexin A2 chimeric protein; atyp	98.98
1eh2_A		106	EPS15; calcium binding, signaling domain, NPF bind	98.98
3nxa_A		100	Protein S100-A16; S100 family, calcium binding pro	98.98
1rro_A		108	RAT oncomodulin; calcium-binding protein; 1.30A {R	98.98
2kn2_A		92	Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco	98.97
2opo_A		86	Polcalcin CHE A 3; calcium-binding protein, dimer,	98.97
1rwy_A		109	Parvalbumin alpha; EF-hand, calcium-binding, calci	98.97
2h2k_A		106	Protein S100-A13; calcium binding protein, metal b	98.96
3li6_A		66	Calcium-binding protein; calcium signaling protein	98.96
1j7q_A		86	CAVP, calcium vector protein; EF-hand family, calc	98.95
1pva_A		110	Parvalbumin; calcium binding; 1.65A {Esox lucius}	98.95
3i5g_B		153	Myosin regulatory light chain LC-2, mantle muscle;	98.94
1exr_A		148	Calmodulin; high resolution, disorder, metal trans	98.94
3h4s_E		135	KCBP interacting Ca2+-binding protein; kinesin, mo	98.94
1k9u_A		78	Polcalcin PHL P 7; pollen allergen, calcium-bindin	98.94
2kgr_A		111	Intersectin-1; structure, alternative splicing, ca	98.93
1c7v_A		81	CAVP, calcium vector protein; EF-hand family, calc	98.93
3j04_B		143	Myosin regulatory light chain 2, smooth muscle MA	98.91
1iq3_A		110	Ralbp1-interacting protein (partner of ralbp1); EF	98.9
2pmy_A		91	RAS and EF-hand domain-containing protein; rasef,	98.89
2jq6_A		139	EH domain-containing protein 1; metal binding prot	98.88
2lmt_A		148	Calmodulin-related protein 97A; spermatogenesis, m	98.88
2lhi_A		176	Calmodulin, serine/threonine-protein phosphatase c	98.88
2kax_A		92	Protein S100-A5; EF-hand, calcium binding protien,	98.88
2mys_B		166	Myosin; muscle protein, motor protein; HET: MLY; 2	98.88
1k2h_A		93	S100A1, S-100 protein, alpha chain; non-covalent h	98.87
1exr_A		148	Calmodulin; high resolution, disorder, metal trans	98.87
2ovk_C		159	Myosin catalytic light chain LC-1, mantle muscle,	98.87
2bl0_C		142	Myosin regulatory light chain; muscle protein, sli	98.86
1qx2_A		76	Vitamin D-dependent calcium-binding protein, INTE;	98.86
3a8r_A		179	Putative uncharacterized protein; EF-hand, membran	98.85
1wdc_C		156	Scallop myosin; calcium binding protein, muscle pr	98.85
1yx7_A		83	Calsensin, LAN3-6 antigen; calcium-binding protein	98.85
3qrx_A		169	Centrin; calcium-binding, EF-hand, cell division,	98.85
3fwb_A		161	Cell division control protein 31; gene gating, com	98.84
3u0k_A		440	Rcamp; fluorescent protein, calcium binding, EF-ha	98.84
1a4p_A		96	S100A10; S100 family, EF-hand protein, ligand of a	98.84
1xk4_C		113	Calgranulin B; S100 family, heterotetramer, metal	98.84
2jnf_A		158	Troponin C; stretch activated muscle contraction,	98.84
1s6j_A		87	CDPK, calcium-dependent protein kinase SK5; EF-han	98.84
1dtl_A		161	Cardiac troponin C; helix-turn-helix, structural p	98.83
1xk4_A		93	Calgranulin A; S100 family, heterotetramer, metal	98.83
3i5g_C		159	Myosin catalytic light chain LC-1, mantle muscle;	98.83
2ycu_A		995	Non muscle myosin 2C, alpha-actinin; motor protein	98.83
1psr_A		100	Psoriasin, S100A7; EF-hand protein, MAD phasing, p	98.81
1jfj_A		134	Ehcabp, calcium-binding protein; EF-hand, helix-lo	98.81
3dtp_E		196	RLC, myosin regulatory light chain; muscle protein	98.81
2f2o_A		179	Calmodulin fused with calmodulin-binding domain of	98.81
3qrx_A		169	Centrin; calcium-binding, EF-hand, cell division,	98.8
1wy9_A		147	Allograft inflammatory factor 1; EF-hand, calucium	98.8
1m45_A		148	MLC1P, myosin light chain; protein-peptide complex	98.79
2odv_A		235	Plectin 1, HD1; plakin domain, spectrin repeat, cy	98.79
3ox6_A		153	Calcium-binding protein 1; EF-hand, calcium-sensor	98.79
2jjz_A		150	Ionized calcium-binding adapter molecule 2; EF-han	98.79
2f2o_A		179	Calmodulin fused with calmodulin-binding domain of	98.79
2bl0_B		145	Myosin regulatory light chain; muscle protein, sli	98.78
4ds7_A		147	Calmodulin, CAM; protein binding, metal binding, s	98.78
2bl0_C		142	Myosin regulatory light chain; muscle protein, sli	98.77
1k8u_A		90	S100A6, calcyclin, CACY; calcium regulatory protei	98.77
3fwb_A		161	Cell division control protein 31; gene gating, com	98.77
4ds7_A		147	Calmodulin, CAM; protein binding, metal binding, s	98.77
1cb1_A		78	Calbindin D9K; calcium-binding protein; NMR {Sus s	98.76
1wdc_C		156	Scallop myosin; calcium binding protein, muscle pr	98.76
2jnf_A		158	Troponin C; stretch activated muscle contraction,	98.76
3e3r_A		204	Calcyphosin, calcyphosine; human calcyphosine, EF-	98.75
1top_A		162	Troponin C; contractIle system protein; 1.78A {Gal	98.75
3ox6_A		153	Calcium-binding protein 1; EF-hand, calcium-sensor	98.74
2kyc_A		108	Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p	98.74
1m45_A		148	MLC1P, myosin light chain; protein-peptide complex	98.74
2mys_C		149	Myosin; muscle protein, motor protein; HET: MLY; 2	98.73
2aao_A		166	CDPK, calcium-dependent protein kinase, isoform AK	98.73
1s6i_A		188	CDPK, calcium-dependent protein kinase SK5; EF-han	98.72
2qac_A		146	Myosin A tail domain interacting protein MTIP; mal	98.71
1w7j_B		151	Myosin light chain 1; motor protein, unconventiona	98.71
2mys_C		149	Myosin; muscle protein, motor protein; HET: MLY; 2	98.71
1h8b_A		75	ACT-EF34, alpha-actinin 2, skeletal muscle isoform	98.71
3pm8_A		197	PFCDPK2, calcium-dependent protein kinase 2; malar	98.71
2i7a_A		174	Calpain 13; calcium-dependent cytoplasmic cysteine	98.7
3khe_A		191	Calmodulin-like domain protein kinase isoform 3; c	98.68
3i5g_B		153	Myosin regulatory light chain LC-2, mantle muscle;	98.67
1wdc_B		156	Scallop myosin; calcium binding protein, muscle pr	98.67
1ggw_A		140	Protein (CDC4P); light chain, cytokinesis, cell cy	98.67
1qls_A		99	S100C protein, calgizzarin; metal-binding protein/	98.67
1dtl_A		161	Cardiac troponin C; helix-turn-helix, structural p	98.67
1top_A		162	Troponin C; contractIle system protein; 1.78A {Gal	98.66
2bec_A		202	Calcineurin B homologous protein 2; calcineurin-ho	98.66
1q80_A		174	SCP, sarcoplasmic calcium-binding protein; all-alp	98.66
1qv0_A		195	Obelin, OBL; photoprotein, bioluminescence, atomic	98.66
3k21_A		191	PFCDPK3, calcium-dependent protein kinase 3; calci	98.65
2ct9_A		208	Calcium-binding protein P22; EF-hand, metal bindin	98.65
3ll8_B		155	Calcineurin subunit B type 1; protein-peptide dock	98.65
3sjs_A		220	URE3-BP sequence specific DNA binding protein; EF-	98.65
3akb_A		166	Putative calcium binding protein; EF-hand, metal b	98.64
1uhk_A		191	Aequorin 2, aequorin; EF-hand motif, complex, lumi	98.64
3a4u_B		143	Multiple coagulation factor deficiency protein 2;	98.64
1y1x_A		191	Leishmania major homolog of programmed cell death	98.63
3sjs_A		220	URE3-BP sequence specific DNA binding protein; EF-	98.63
1snl_A		103	Nucleobindin 1, calnuc; EF-hand, calcium-binding,	98.63
1alv_A		173	Calpain, S-camld; calcium binding, calmodulin like	98.62
3pm8_A		197	PFCDPK2, calcium-dependent protein kinase 2; malar	98.62
2ccm_A		191	Calexcitin; EF hand, calcium, signaling protein; 1	98.61
2ycu_A		995	Non muscle myosin 2C, alpha-actinin; motor protein	98.6
1y1x_A		191	Leishmania major homolog of programmed cell death	98.6
3j04_B		143	Myosin regulatory light chain 2, smooth muscle MA	98.59
2ovk_B		153	RLC, myosin regulatory light chain LC-2, mantle mu	98.58
1dgu_A		183	Calcium-saturated CIB; helical, EF-hands, blood cl	98.58
3mse_B		180	Calcium-dependent protein kinase, putative; CDPKS,	98.57
1nya_A		176	Calerythrin; EF-hand, metal binding protein; NMR {	98.57
2ovk_B		153	RLC, myosin regulatory light chain LC-2, mantle mu	98.57
2znd_A		172	Programmed cell death protein 6; penta-EF-hand pro	98.57
2bl0_B		145	Myosin regulatory light chain; muscle protein, sli	98.56
3mwu_A		486	Calmodulin-domain protein kinase 1; serine/threoni	98.56
3mse_B		180	Calcium-dependent protein kinase, putative; CDPKS,	98.55
3dd4_A		229	KV channel-interacting protein 4; EF-hands protein	98.55
3fia_A		121	Intersectin-1; EH 1 domain, NESG, structural genom	98.54
3q5i_A		504	Protein kinase; CDPK, malaria, phosphotransferase,	98.54
3ll8_B		155	Calcineurin subunit B type 1; protein-peptide dock	98.54
2ovk_C		159	Myosin catalytic light chain LC-1, mantle muscle,	98.54
2l4h_A		214	Calcium and integrin-binding protein 1; metal bind	98.52
2ccm_A		191	Calexcitin; EF hand, calcium, signaling protein; 1	98.52
2hpk_A		208	Photoprotein berovin; structural genomics, PSI, pr	98.52
1k94_A		165	Grancalcin; penta-EF-hand protein, calcium binding	98.52
1ggw_A		140	Protein (CDC4P); light chain, cytokinesis, cell cy	98.51
2mys_B		166	Myosin; muscle protein, motor protein; HET: MLY; 2	98.51
3cs1_A		219	Flagellar calcium-binding protein; myristoylated,	98.51
2bec_A		202	Calcineurin B homologous protein 2; calcineurin-ho	98.5
3dtp_E		196	RLC, myosin regulatory light chain; muscle protein	98.49
2sas_A		185	Sarcoplasmic calcium-binding protein; 2.40A {Branc	98.48
1alv_A		173	Calpain, S-camld; calcium binding, calmodulin like	98.48
3sg6_A		450	Gcamp2, myosin light chain kinase, green fluoresce	98.48
1nya_A		176	Calerythrin; EF-hand, metal binding protein; NMR {	98.47
3khe_A		191	Calmodulin-like domain protein kinase isoform 3; c	98.47
3sg6_A		450	Gcamp2, myosin light chain kinase, green fluoresce	98.47
1k94_A		165	Grancalcin; penta-EF-hand protein, calcium binding	98.46
1s6c_A		183	KV4 potassium channel-interacting protein kchip1B;	98.46
2f33_A		263	Calbindin; EF-hand, Ca2+-binding, metal binding pr	98.45
2ggz_A		211	Guanylyl cyclase-activating protein 3; EF hand, gu	98.45
3lij_A		494	Calcium/calmodulin dependent protein kinase with A	98.45
2hpk_A		208	Photoprotein berovin; structural genomics, PSI, pr	98.45
2r2i_A		198	Guanylyl cyclase-activating protein 1; EF hand, GC	98.43
2kld_A		123	Polycystin-2; PC2, PKD2, calcium binding domain, E	98.43
1w7j_B		151	Myosin light chain 1; motor protein, unconventiona	98.43
1juo_A		198	Sorcin; calcium-binding proteins, penta-EF-hand, P	98.42
2lvv_A		226	Flagellar calcium-binding protein TB-24; EF-hand,	98.42
1gjy_A		167	Sorcin, CP-22, V19; calcium binding, calcium-bindi	98.41
1ij5_A		323	Plasmodial specific LAV1-2 protein; fourty kDa cal	98.41
1fpw_A		190	Yeast frequenin, calcium-binding protein NCS-1; EF	98.4
2l2e_A		190	Calcium-binding protein NCS-1; NCS1P, myristoylate	98.4
2zfd_A		226	Calcineurin B-like protein 2; calcium binding prot	98.39
1wdc_B		156	Scallop myosin; calcium binding protein, muscle pr	98.39
2l2e_A		190	Calcium-binding protein NCS-1; NCS1P, myristoylate	98.39
1uhk_A		191	Aequorin 2, aequorin; EF-hand motif, complex, lumi	98.39
1qv0_A		195	Obelin, OBL; photoprotein, bioluminescence, atomic	98.38
2znd_A		172	Programmed cell death protein 6; penta-EF-hand pro	98.38
2r2i_A		198	Guanylyl cyclase-activating protein 1; EF hand, GC	98.38
1s1e_A		224	KV channel interacting protein 1; kchip, calcium-b	98.37
2aao_A		166	CDPK, calcium-dependent protein kinase, isoform AK	98.37
2d8n_A		207	Recoverin; structural genomics, NPPSFA, national p	98.37
1juo_A		198	Sorcin; calcium-binding proteins, penta-EF-hand, P	98.35
1jba_A		204	GCAP-2, protein (guanylate cyclase activating prot	98.34
2be4_A		272	Hypothetical protein LOC449832; DR.36843, BC083168	98.34
1g8i_A		190	Frequenin, neuronal calcium sensor 1; calcium bind	98.33
2jul_A		256	Calsenilin; EF-hand, calcium, LXXLL, DNA binding p	98.33
1jba_A		204	GCAP-2, protein (guanylate cyclase activating prot	98.33
1gjy_A		167	Sorcin, CP-22, V19; calcium binding, calcium-bindi	98.32
3e3r_A		204	Calcyphosin, calcyphosine; human calcyphosine, EF-	98.32
2ehb_A		207	Calcineurin B-like protein 4; protein complex, Ca(	98.32
2hps_A		186	Coelenterazine-binding protein with bound coelent;	98.32
1s6c_A		183	KV4 potassium channel-interacting protein kchip1B;	98.32
1s6i_A		188	CDPK, calcium-dependent protein kinase SK5; EF-han	98.31
1fpw_A		190	Yeast frequenin, calcium-binding protein NCS-1; EF	98.31
1s1e_A		224	KV channel interacting protein 1; kchip, calcium-b	98.31
2lvv_A		226	Flagellar calcium-binding protein TB-24; EF-hand,	98.31
3akb_A		166	Putative calcium binding protein; EF-hand, metal b	98.3
2be4_A		272	Hypothetical protein LOC449832; DR.36843, BC083168	98.29
2zfd_A		226	Calcineurin B-like protein 2; calcium binding prot	98.27
2qac_A		146	Myosin A tail domain interacting protein MTIP; mal	98.27
3nyv_A		484	Calmodulin-domain protein kinase 1; serine/threoni	98.27
2sas_A		185	Sarcoplasmic calcium-binding protein; 2.40A {Branc	98.26
2d8n_A		207	Recoverin; structural genomics, NPPSFA, national p	98.26
1jfj_A		134	Ehcabp, calcium-binding protein; EF-hand, helix-lo	98.26
2ehb_A		207	Calcineurin B-like protein 4; protein complex, Ca(	98.25
3dd4_A		229	KV channel-interacting protein 4; EF-hands protein	98.25
2ct9_A		208	Calcium-binding protein P22; EF-hand, metal bindin	98.24
2jul_A		256	Calsenilin; EF-hand, calcium, LXXLL, DNA binding p	98.23
1wlx_A		129	Alpha-actinin 4; three-helix bundle, protein bindi	98.22
1wlx_A		129	Alpha-actinin 4; three-helix bundle, protein bindi	98.22
2ggz_A		211	Guanylyl cyclase-activating protein 3; EF hand, gu	98.22
2f33_A		263	Calbindin; EF-hand, Ca2+-binding, metal binding pr	98.21
1djx_A		624	PLC-D1, phosphoinositide-specific phospholipase C,	98.21
3mwu_A		486	Calmodulin-domain protein kinase 1; serine/threoni	98.2
3nyv_A		484	Calmodulin-domain protein kinase 1; serine/threoni	98.2
1bjf_A		193	Neurocalcin delta; calcium-binding, myristoylation	98.19
1g8i_A		190	Frequenin, neuronal calcium sensor 1; calcium bind	98.18
3q5i_A		504	Protein kinase; CDPK, malaria, phosphotransferase,	98.16
3lij_A		494	Calcium/calmodulin dependent protein kinase with A	98.14
3bow_A		714	Calpain-2 catalytic subunit; cysteine protease, in	98.09
1bjf_A		193	Neurocalcin delta; calcium-binding, myristoylation	98.05
1ij5_A		323	Plasmodial specific LAV1-2 protein; fourty kDa cal	98.03
1dgu_A		183	Calcium-saturated CIB; helical, EF-hands, blood cl	98.03
1eg3_A		261	Dystrophin; EF-hand like domain, WW domain, struct	97.98
1q80_A		174	SCP, sarcoplasmic calcium-binding protein; all-alp	97.96
3h4s_E		135	KCBP interacting Ca2+-binding protein; kinesin, mo	97.92
3fs7_A		109	Parvalbumin, thymic; calcium-binding protein, EF-h	97.9
2i7a_A		174	Calpain 13; calcium-dependent cytoplasmic cysteine	97.88
3cs1_A		219	Flagellar calcium-binding protein; myristoylated,	97.86
1sra_A		151	Sparc; extracellular matrix protein, calcium-bindi	97.84
2zkm_X		799	1-phosphatidylinositol-4,5-bisphosphate phosphodie	97.82
3a4u_B		143	Multiple coagulation factor deficiency protein 2;	97.8
2pvb_A		108	Protein (parvalbumin); calcium binding protein, me	97.76
1qxp_A		900	MU-like calpain; M-calpain, MU-calpain, catalytic	97.75
1rro_A		108	RAT oncomodulin; calcium-binding protein; 1.30A {R	97.67
1pva_A		110	Parvalbumin; calcium binding; 1.65A {Esox lucius}	97.66
5pal_A		109	Parvalbumin; calcium-binding protein; 1.54A {Triak	97.66
1rwy_A		109	Parvalbumin alpha; EF-hand, calcium-binding, calci	97.63
3a8r_A		179	Putative uncharacterized protein; EF-hand, membran	97.63
3bow_A		714	Calpain-2 catalytic subunit; cysteine protease, in	97.61
2hps_A		186	Coelenterazine-binding protein with bound coelent;	97.6
2l4h_A		214	Calcium and integrin-binding protein 1; metal bind	97.59
1bu3_A		109	Calcium-binding protein; 1.65A {Merluccius bilinea	97.58
1eg3_A		261	Dystrophin; EF-hand like domain, WW domain, struct	97.51
1djx_A		624	PLC-D1, phosphoinositide-specific phospholipase C,	97.47
1qxp_A		900	MU-like calpain; M-calpain, MU-calpain, catalytic	97.46
2zkm_X		799	1-phosphatidylinositol-4,5-bisphosphate phosphodie	97.41
3ohm_B		885	1-phosphatidylinositol-4,5-bisphosphate phosphodi	97.4
2kyc_A		108	Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p	97.37
3qr0_A		816	Phospholipase C-beta (PLC-beta); PH domain, EF han	96.85
1nub_A		229	Basement membrane protein BM-40; extracellular mod	96.77
3ohm_B		885	1-phosphatidylinositol-4,5-bisphosphate phosphodi	96.49
3qr0_A		816	Phospholipase C-beta (PLC-beta); PH domain, EF han	95.9
1tuz_A		118	Diacylglycerol kinase alpha; transferase, HR532, n	95.84
2jjz_A		150	Ionized calcium-binding adapter molecule 2; EF-han	94.75
1s6j_A		87	CDPK, calcium-dependent protein kinase SK5; EF-han	94.29
4drw_A		121	Protein S100-A10/annexin A2 chimeric protein; atyp	94.08
1c07_A		95	Protein (epidermal growth factor receptor pathway	94.05
3li6_A		66	Calcium-binding protein; calcium signaling protein	93.92
1wy9_A		147	Allograft inflammatory factor 1; EF-hand, calucium	93.89
2lv7_A		100	Calcium-binding protein 7; metal binding protein;	93.82
1xk4_C		113	Calgranulin B; S100 family, heterotetramer, metal	93.13
2b1u_A		71	Calmodulin-like protein 5; CLSP, calmodulin-like S	93.01
3nso_A		101	Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta	92.95
1qjt_A		99	EH1, epidermal growth factor receptor substrate su	92.77
1iq3_A		110	Ralbp1-interacting protein (partner of ralbp1); EF	92.76
2kgr_A		111	Intersectin-1; structure, alternative splicing, ca	92.75
2kz2_A		94	Calmodulin, CAM; TR2C, metal binding protein; NMR	92.08
3zwh_A		104	Protein S100-A4; Ca-binding protein-motor protein	91.71
1fi6_A		92	EH domain protein REPS1; EPS15 homology domain, EF	91.34
1pul_A		125	Hypothetical protein C32E8.3 in chromosome I; alph	91.3
2kld_A		123	Polycystin-2; PC2, PKD2, calcium binding domain, E	91.17
4eto_A		93	Protein S100-A4; calcium-binding protein, EF-hand,	91.1
1tiz_A		67	Calmodulin-related protein, putative; helix-turn-h	91.04
1c7v_A		81	CAVP, calcium vector protein; EF-hand family, calc	90.9
2lnk_A		113	Protein S100-A4; EF-hand, calcium binding, all alp	90.88
2pmy_A		91	RAS and EF-hand domain-containing protein; rasef,	90.87
3n22_A		98	Protein S100-A2; EF-hand, calcium-binding, zinc-bi	90.58
2ktg_A		85	Calmodulin, putative; ehcam, Ca-binding protein, p	90.44
2opo_A		86	Polcalcin CHE A 3; calcium-binding protein, dimer,	90.38
1snl_A		103	Nucleobindin 1, calnuc; EF-hand, calcium-binding,	90.32
1qx2_A		76	Vitamin D-dependent calcium-binding protein, INTE;	90.24
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	90.23
3nxa_A		100	Protein S100-A16; S100 family, calcium binding pro	89.91
2kn2_A		92	Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco	89.8
1yx7_A		83	Calsensin, LAN3-6 antigen; calcium-binding protein	89.73
1j7q_A		86	CAVP, calcium vector protein; EF-hand family, calc	89.67
1k9u_A		78	Polcalcin PHL P 7; pollen allergen, calcium-bindin	89.56
2d58_A		107	Allograft inflammatory factor 1; EF-hand, metal bi	89.24
1avs_A		90	Troponin C; muscle contraction, calcium-activated,	89.18
1eh2_A		106	EPS15; calcium binding, signaling domain, NPF bind	88.84
2h2k_A		106	Protein S100-A13; calcium binding protein, metal b	88.74
1wlz_A		105	DJBP, CAP-binding protein complex interacting prot	88.62
1cb1_A		78	Calbindin D9K; calcium-binding protein; NMR {Sus s	88.41
2qpt_A		550	EH domain-containing protein-2; protein-nucleotide	88.09
3rm1_A		92	Protein S100-B; alpha-helical, EF hand, metal bind	87.63
2kax_A		92	Protein S100-A5; EF-hand, calcium binding protien,	86.04
2jq6_A		139	EH domain-containing protein 1; metal binding prot	85.72
2y5i_A		99	S100Z, S100 calcium binding protein Z; metal-bindi	85.08
1j55_A		95	S-100P protein; metal binding protein; 2.00A {Homo	84.95
2l5y_A		150	Stromal interaction molecule 2; EF-hand, SAM domai	84.82
2joj_A		77	Centrin protein; N-terminal domain, centrin soluti	84.61
1qls_A		99	S100C protein, calgizzarin; metal-binding protein/	84.35
1k2h_A		93	S100A1, S-100 protein, alpha chain; non-covalent h	83.98
1a4p_A		96	S100A10; S100 family, EF-hand protein, ligand of a	83.12
1k8u_A		90	S100A6, calcyclin, CACY; calcium regulatory protei	82.44
2wcb_A		95	Protein S100-A12; calcium signalling, HOST-parasit	81.81
1xk4_A		93	Calgranulin A; S100 family, heterotetramer, metal	81.7
1sra_A		151	Sparc; extracellular matrix protein, calcium-bindi	81.61

>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1	Back alignment and structure

Probab=100.00  E-value=1.5e-38  Score=383.72  Aligned_cols=518  Identities=15%  Similarity=0.235  Sum_probs=391.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCCCCCHHHHHHHHHHHHHHHHHHHccCccHHH---H----HHHHHHhhcc
Q psy13767         86 AMAVAKQFQDKLTGILDWLDKSEKKIKDMELIPTDEEKIQQRIREHDALHKEILRKKPDFTE---L----TDIASSLMGL  158 (801)
Q Consensus        86 ~~~~~~~f~~~~~~l~~WL~~~e~~l~~~~~~~~d~~~v~~~l~~~~~l~~el~~~~~~~~~---l----~~~~~~L~~~  158 (801)
                      .-.....|...+.++..||.+++..+.+ .++|.++..++.++++|+.|.....  .+.+..   +    ...+..+...
T Consensus       248 ~e~l~~~y~~~~~el~~Wi~~~~~~l~~-~~~~~~l~~v~~~l~~~~~~~~~~k--~~~~~e~~~le~~~~~l~~~l~~~  324 (863)
T 1sjj_A          248 NEQLMEDYEKLASDLLEWIRRTIPWLEN-RAPENTMQAMQQKLEDFRDYRRLHK--PPKVQEKCQLEINFNTLQTKLRLS  324 (863)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHGGGSSC-CCCCSSHHHHHHHHHHHHHHHHTTS--HHHHHHHHHHHHTTTHHHHHTTTT
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHHhc-cCcCCCHHHHHHHHHHHHHHHHhcc--chHHHHHHHHHHHHHHHHHHHHHC
Confidence            3334567999999999999999987765 4689999999999999999998532  122211   1    1112222211


Q ss_pred             cChhhhhhHhhhHHhHHHHHHHHHHHHhhhhhhhhhhhccccCCCCCchHHHHHHHHHHHHHHHHHHHHHHHHhhhHHHH
Q psy13767        159 VGEDEAAGVADKLQDTADRYGALVEASDNLGQYAFLYNQLILSPRFSSVTDIKKKLERLNGLWNEVQKATNDRGRSLEEA  238 (801)
Q Consensus       159 ~~~~~~~~i~~~~~~l~~r~~~l~~~~~~r~~~LW~~~~l~Ls~~~~~~~~i~~~l~~L~~~w~~l~~~~~~r~~~L~~~  238 (801)
                      ..+.-.+.....+..++.+|..|......|.                                 ........|..+|+. 
T Consensus       325 ~~~~~~~~~~~~~~~i~~~w~~L~~~~~~r~---------------------------------~~l~~~~~R~~~Le~-  370 (863)
T 1sjj_A          325 NRPAFMPSEGKMVSDINNAWGGLEQAEKGYE---------------------------------EWLLNEIRRLERLDH-  370 (863)
T ss_dssp             SSCCCCCSTTSCGGGHHHHHHHHHHHHTTTH---------------------------------HHHHHHHEEHHHHHH-
T ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHHHHHHH---------------------------------HHHHHHHHHHHHHHH-
Confidence            1111112223345556666666555443332                                 222334456677775 


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhhhcCCCCCCChHHHHHHHHHHHHHHHHHhccchhHHHHHHHHHHHHHHcCCCChhH
Q psy13767        239 LALAEKFWSELQSVMATLRDLQDNLNSQEPPAVEPKAIQQQQYALKEIKAEIDQTKPEVEQCRASGQKLMKICGEPDKPE  318 (801)
Q Consensus       239 ~~~~~~f~~~~~~l~~Wl~~~e~~l~~~~~~~~d~~~~~~~l~~~~~l~~el~~~~~~~~~l~~~~~~L~~~~~~~~~~~  318 (801)
                        ++.+|...++++..||.+++..+.+.+....|++.++.++++|+.|+.+|..+++.+..+...|+.|+. .++++++.
T Consensus       371 --l~~~F~~~~~~~~~Wl~~~e~~l~~~~~g~~dl~~v~~ll~kh~~f~~el~~~~~~v~~l~~~~~~L~~-~~~~~~~~  447 (863)
T 1sjj_A          371 --LAEKFRQKASIHESWTDGKEAMLQQKDYETATLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNE-LDYYDSPS  447 (863)
T ss_dssp             --HHHHHHHHHHHHHHHHHHHHHHHHSCTTTSSCHHHHHHHHHHHHHHHHHHTTHHHHHHHHHHHHHHHHH-TCCTTHHH
T ss_pred             --HHHHHHHHHHHHHHHHHHHHHHhhcccccCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh-CCcccHHH
Confidence              347999999999999999999998865333499999999999999999999999999999999999998 58899999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----HHHhhcCCcCcHHHHHHHhHHHHHHHHHHHHHHHHHHHH
Q psy13767        319 VKKHIEDLDSAWDNVTALFAKREENLIHAMEKAMEFH----ETLQRKGEQGTITALFAKREENLIHAMEKAMEFHETLQQ  394 (801)
Q Consensus       319 i~~~l~~l~~~w~~l~~~~~~r~~~L~~~l~~~~~~~----~~~~~l~~~~ti~~l~~kr~~wl~~a~~~a~~~~~~L~~  394 (801)
                      |..+++.|+.+|+.|..++..|+.+|+.++...+.++    .|.+++.++          ..||..+...          
T Consensus       448 I~~~~~~l~~~W~~L~~~~~~R~~~L~~~l~~~q~~~~l~~~f~~~a~~~----------~~Wl~~~e~~----------  507 (863)
T 1sjj_A          448 VNARCQKICDQWDNLGALTQKRREALERTEKLLETIDQLYLEYAKRAAPF----------NNWMEGAMED----------  507 (863)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTT----------HHHHHHHHHH----------
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----------HHHHHHHHHH----------
Confidence            9999999999999999999999999999997655433    444455443          3466653211          


Q ss_pred             hHHhhhhhccchHHHhhhhcCCcccHHHHHHHHHHHHHHHHHHHHhhHhHHHHHHHHHHHHhhcC------cchhhhHHH
Q psy13767        395 NRDDCKKADCNADAVQTFVNSLPEDDQEARTQLAEHEKFLRELAEKEIEKDATIGLAQRILVKSH------PDGATVIKH  468 (801)
Q Consensus       395 ~~edlk~~l~~~e~~~r~~~~~~~d~~~l~~~l~~~~~~~~~l~~~~~~v~~l~~~~~~Ll~~~~------p~~~~~i~~  468 (801)
                                    +  ...+++.+++.++.++++|+.|+.++..++.++..+...++.+...+.      ....+.+..
T Consensus       508 --------------l--~~~~~g~dl~~ve~ll~kh~~~~~~l~~~~~~~~~~~~l~~~l~~~~~~~~~~~~~~~~~~~~  571 (863)
T 1sjj_A          508 --------------L--QDTFIVHTIEEIQGLTTAHEQFKATLPDADKERQAILGIHNEVSKIVQTYHVNMAGTNPYTTI  571 (863)
T ss_dssp             --------------H--HCCCCCSSSGGGHHHHHHHHHHHTTHHHHHHHHHHHHHHHHHHHHHHHTTTCCCCSCCSSSSC
T ss_pred             --------------h--cchHhhccHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHhcccccCCCCCCcC
Confidence                          1  124568899999999999999999999999999999999998765311      112234556


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHH-------HhHHHHHHHHHHHHHHHHHHHhhhhhccCCCCCCChhHHHHHHHHH
Q psy13767        469 WITIIQSRWEEVSSWAKQREERLRNHL-------RSLQDLDSLLEELLEWLAKCESHLLNLEAEPLPDDIPTVERLIEEH  541 (801)
Q Consensus       469 ~~~~l~~rw~~l~~~~~~r~~~L~~~~-------~~~~~f~~~~~el~~Wl~~~e~~l~~~~~~~~~~d~~~~~~~l~~h  541 (801)
                      ++..|..+|+.|+..+..|..+|+.++       ..++.|...++++..||.+++..+.+.   +++ .+.+++.++.+|
T Consensus       572 ~~~~L~~rw~~L~~~~~~R~~~L~~~l~~~~~~~~l~~~F~~~a~~~~~Wi~e~e~~l~~~---~~~-~~~~le~~l~~~  647 (863)
T 1sjj_A          572 TPQEINGKWEHVRQLVPRRDQALMEEHARQQQNERLRKQFGAQANVIGPWIQTKMEEIGRI---SIE-MHGTLEDQLNHL  647 (863)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHGGGHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTSC---TTC-TTTSSHHHHHHH
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHhh---ccC-CCCCHHHHHHHH
Confidence            799999999999999999999999988       567889899999999999999998752   222 235677789999


Q ss_pred             HHHHHHHHhhhhhhhhhhccCccccccCCCCCCCCCCCCCCCCCCCCCccChhHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy13767        542 KEFMEATSKRQHEVDSVRASPSREKLNDNLPHYGPRFPPKGSKGAEPQFRNPRCRLLWDTWRNVWLLAWERQRRLQERLN  621 (801)
Q Consensus       542 k~~~~ei~~~~~~~~~l~~~~~~~~~~~~L~~~~~~~~~~~~~~~~~~~i~~~~~~L~~~W~~L~~~~~~r~~~L~~~l~  621 (801)
                      +.|+.++..+.+.++.+...++.      |...++.-.|         .+...++.+...|..+...+..+...++....
T Consensus       648 ~~~~~el~~~~~~i~~l~~l~~~------L~~~~~~~~~---------~~~~s~e~l~i~~~eF~~~~~~~~~~~e~~~l  712 (863)
T 1sjj_A          648 RQYEKSIVNYKPKIDQLEGDHQQ------IQEALIFDNK---------HTNYTMEHIRVGWEQLLTTIARTINEVENQIL  712 (863)
T ss_dssp             HHHHHHHHTTGGGHHHHHHHHHH------HHTTTCCCCT---------TCSSTTHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHhHHHHHHHHHHHHH------HHHhcCCCCC---------cccccHHHHHHHHHHHHHHHHHHHhhHHHHHH
Confidence            99999999999999999988875      4433221111         22346788999999988877665543332110


Q ss_pred             HHHHHHHhhcCCHHHHHHHHHHHHhHHHHHHHHHhcccccCCCCCcCHHHHHHHHHhcCCCCCHHHHHHHHHHhCCCCCC
Q psy13767        622 YLIELEKVKNFSWDDWRKRFLRFMNHKKSRLTDLFRKMDKNNDGLIPREDFVDGIIKTKFETSKLEMGAVADMFDHDYNP  701 (801)
Q Consensus       622 ~l~e~~~~~~f~f~~~~~~~l~~~~~~~~~~~~~F~~~D~d~~g~i~~~e~~~~l~~~g~~~~~~e~~~~~~~~d~d~~~  701 (801)
                          ......+.            ......+..+|+.||+|+||.|+..||..++..+|..++..++..++..+|.| |+
T Consensus       713 ----~~~~~~l~------------~~~~~~~~~~F~~~D~d~~G~I~~~El~~~l~~~g~~~~~~~~~~~~~~~D~d-~d  775 (863)
T 1sjj_A          713 ----TRDAKGIS------------QEQMNEFRASFNHFDRKKTGMMDCEDFRACLISMGYNMGEAEFARIMSIVDPN-RM  775 (863)
T ss_dssp             ----HCCCCCSS------------HHHHHHHHHHHTTTCSSSSSEEESTTHHHHHHHHTCCCCTHHHHHHHHHHCTT-SC
T ss_pred             ----HhhccCCC------------HHHHHHHHHHHHHHCCCCCCCcCHHHHHHHHHHcCCCCCHHHHHHHHHHhCCC-CC
Confidence                00111111            13456788999999999999999999999999999999999999999999999 99


Q ss_pred             CcccHHHHHHHhCC
Q psy13767        702 GLIDWKEFIAALRP  715 (801)
Q Consensus       702 g~i~~~ef~~~~~~  715 (801)
                      |.|+|+||+..|..
T Consensus       776 G~I~~~EF~~~~~~  789 (863)
T 1sjj_A          776 GVVTFQAFIDFMSR  789 (863)
T ss_dssp             SEEETTHHHHTHHH
T ss_pred             CcCcHHHHHHHHHH
Confidence            99999999998853

PyMOL of 1sjj

>1hci_A Alpha-actinin 2; triple-helix coiled coil, contractIle protein, muscle, Z- LINE, actin-binding protein; 2.8A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 a.7.1.1	Back alignment and structure

>1u4q_A Spectrin alpha chain, brain; alpha spectrin, three repeats of spectrin, alpha-helical linker region, 3-helix coiled-coil, structural protein; 2.50A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 a.7.1.1	Back alignment and structure

>3edv_A Spectrin beta chain, brain 1; spectrin repeat, coiled coil, actin capping, actin-binding, alternative splicing, calmodulin-binding, cytoplasm; 1.95A {Homo sapiens}	Back alignment and structure

>1u4q_A Spectrin alpha chain, brain; alpha spectrin, three repeats of spectrin, alpha-helical linker region, 3-helix coiled-coil, structural protein; 2.50A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 a.7.1.1	Back alignment and structure

>3edv_A Spectrin beta chain, brain 1; spectrin repeat, coiled coil, actin capping, actin-binding, alternative splicing, calmodulin-binding, cytoplasm; 1.95A {Homo sapiens}	Back alignment and structure

>3kbt_A Beta-I spectrin, spectrin beta chain, erythrocyte; complex, spectrin, spectrin repeat, three helix bundle, ANKY binding, disease mutation, structural protein, ZU5 sandwich; 2.75A {Homo sapiens} PDB: 3kbu_A	Back alignment and structure

>3kbt_A Beta-I spectrin, spectrin beta chain, erythrocyte; complex, spectrin, spectrin repeat, three helix bundle, ANKY binding, disease mutation, structural protein, ZU5 sandwich; 2.75A {Homo sapiens} PDB: 3kbu_A	Back alignment and structure

>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1	Back alignment and structure

>1hci_A Alpha-actinin 2; triple-helix coiled coil, contractIle protein, muscle, Z- LINE, actin-binding protein; 2.8A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 a.7.1.1	Back alignment and structure

>3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens}	Back alignment and structure

>3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens}	Back alignment and structure

>1v5r_A Growth-arrest-specific protein 2; GAS2 domain, zinc binding domain, apoptosis, cell cycle, structural genomics; NMR {Mus musculus} SCOP: d.82.4.1	Back alignment and structure

>1u5p_A Spectrin alpha chain, brain; alpha spectrin, two repeats of spectrin, alpha-helical linker region, 3-helix coiled coil, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1	Back alignment and structure

>1cun_A Protein (alpha spectrin); two repeats of spectrin, alpha helical linker region, 2 tandem 3-helix coiled- coils, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 PDB: 1aj3_A	Back alignment and structure

>1s35_A Beta-I spectrin, spectrin beta chain, erythrocyte; two repeats of spectrin, alpha helical linker region, 3- helix coiled-coils, beta spectrin; 2.40A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1	Back alignment and structure

>3edu_A Beta-I spectrin, spectrin beta chain, erythrocyte; ankyrin, ankyrin-binding domain, actin capping, AC binding, cytoskeleton, disease mutation; 2.10A {Homo sapiens} PDB: 3f57_A	Back alignment and structure

>1cun_A Protein (alpha spectrin); two repeats of spectrin, alpha helical linker region, 2 tandem 3-helix coiled- coils, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 PDB: 1aj3_A	Back alignment and structure

>1u5p_A Spectrin alpha chain, brain; alpha spectrin, two repeats of spectrin, alpha-helical linker region, 3-helix coiled coil, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1	Back alignment and structure

>1s35_A Beta-I spectrin, spectrin beta chain, erythrocyte; two repeats of spectrin, alpha helical linker region, 3- helix coiled-coils, beta spectrin; 2.40A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1	Back alignment and structure

>1quu_A Human skeletal muscle alpha-actinin 2; triple-helix coiled coil, contractIle protein; 2.50A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1	Back alignment and structure

>3edu_A Beta-I spectrin, spectrin beta chain, erythrocyte; ankyrin, ankyrin-binding domain, actin capping, AC binding, cytoskeleton, disease mutation; 2.10A {Homo sapiens} PDB: 3f57_A	Back alignment and structure

>3fb2_A Spectrin alpha chain, brain spectrin; non-erythroid alpha chain alpha-II spectrin, fordrin alpha chain, sptan1, SPTA2_human, NESG, HR5563A; 2.30A {Homo sapiens}	Back alignment and structure

>3pdy_A Plectin; cytoskeleton, plakin, intermediate filament, spectrin repeat structural protein, crosslinking; 2.22A {Homo sapiens}	Back alignment and structure

>1quu_A Human skeletal muscle alpha-actinin 2; triple-helix coiled coil, contractIle protein; 2.50A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1	Back alignment and structure

>3fb2_A Spectrin alpha chain, brain spectrin; non-erythroid alpha chain alpha-II spectrin, fordrin alpha chain, sptan1, SPTA2_human, NESG, HR5563A; 2.30A {Homo sapiens}	Back alignment and structure

>2iak_A Bullous pemphigoid antigen 1, isoform 5; triple helical bundle, spectrin repeat, cell adhesion; 3.00A {Mus musculus}	Back alignment and structure

>3pdy_A Plectin; cytoskeleton, plakin, intermediate filament, spectrin repeat structural protein, crosslinking; 2.22A {Homo sapiens}	Back alignment and structure

>2iak_A Bullous pemphigoid antigen 1, isoform 5; triple helical bundle, spectrin repeat, cell adhesion; 3.00A {Mus musculus}	Back alignment and structure

>3lbx_B Beta-I spectrin, spectrin beta chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens}	Back alignment and structure

>3lbx_B Beta-I spectrin, spectrin beta chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens}	Back alignment and structure

>3lbx_A Spectrin alpha chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} PDB: 1owa_A	Back alignment and structure

>3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens}	Back alignment and structure

>3f31_A Spectrin alpha chain, brain; LONE helix followed by A triple helical bundle, actin cappin binding, alternative splicing, calcium; 2.30A {Homo sapiens} SCOP: a.7.1.0	Back alignment and structure

>3lbx_A Spectrin alpha chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} PDB: 1owa_A	Back alignment and structure

>3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens}	Back alignment and structure

>3f31_A Spectrin alpha chain, brain; LONE helix followed by A triple helical bundle, actin cappin binding, alternative splicing, calcium; 2.30A {Homo sapiens} SCOP: a.7.1.0	Back alignment and structure

>3uun_A Dystrophin; triple helical, cell structure and stability, cytoskeletal, structural protein; 2.30A {Homo sapiens}	Back alignment and structure

>3uul_A Utrophin; spectrin repeat, structural protein, cytoskeletal, helical bundle; 1.95A {Rattus norvegicus} PDB: 3uum_A	Back alignment and structure

>3uul_A Utrophin; spectrin repeat, structural protein, cytoskeletal, helical bundle; 1.95A {Rattus norvegicus} PDB: 3uum_A	Back alignment and structure

>3uun_A Dystrophin; triple helical, cell structure and stability, cytoskeletal, structural protein; 2.30A {Homo sapiens}	Back alignment and structure

>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens}	Back alignment and structure

>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1	Back alignment and structure

>2odv_A Plectin 1, HD1; plakin domain, spectrin repeat, cytoskeleton, hemidesmosomes epidermolysis bullosa, structural protein; 2.05A {Homo sapiens} PDB: 2odu_A	Back alignment and structure

>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A	Back alignment and structure

>2spc_A Spectrin; cytoskeleton; 1.80A {Drosophila melanogaster} SCOP: a.7.1.1	Back alignment and structure

>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1	Back alignment and structure

>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C	Back alignment and structure

>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens}	Back alignment and structure

>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A*	Back alignment and structure

>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A	Back alignment and structure

>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A	Back alignment and structure

>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7	Back alignment and structure

>2spc_A Spectrin; cytoskeleton; 1.80A {Drosophila melanogaster} SCOP: a.7.1.1	Back alignment and structure

>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5	Back alignment and structure

>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio}	Back alignment and structure

>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus}	Back alignment and structure

>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens}	Back alignment and structure

>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A	Back alignment and structure

>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6	Back alignment and structure

>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A	Back alignment and structure

>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus}	Back alignment and structure

>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A	Back alignment and structure

>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A	Back alignment and structure

>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4	Back alignment and structure

>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A	Back alignment and structure

>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A	Back alignment and structure

>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ...	Back alignment and structure

>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6	Back alignment and structure

>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6	Back alignment and structure

>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens}	Back alignment and structure

>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor}	Back alignment and structure

>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A	Back alignment and structure

>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4	Back alignment and structure

>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A	Back alignment and structure

>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens}	Back alignment and structure

>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A	Back alignment and structure

>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A	Back alignment and structure

>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A	Back alignment and structure

>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max}	Back alignment and structure

>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A	Back alignment and structure

>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A	Back alignment and structure

>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A	Back alignment and structure

>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica}	Back alignment and structure

>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A	Back alignment and structure

>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A	Back alignment and structure

>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B	Back alignment and structure

>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ...	Back alignment and structure

>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana}	Back alignment and structure

>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10	Back alignment and structure

>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens}	Back alignment and structure

>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A	Back alignment and structure

>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus}	Back alignment and structure

>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6	Back alignment and structure

>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens}	Back alignment and structure

>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A	Back alignment and structure

>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A	Back alignment and structure

>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A	Back alignment and structure

>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B	Back alignment and structure

>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A	Back alignment and structure

>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ...	Back alignment and structure

>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum}	Back alignment and structure

>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A	Back alignment and structure

>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group}	Back alignment and structure

>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ...	Back alignment and structure

>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A	Back alignment and structure

>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A	Back alignment and structure

>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A	Back alignment and structure

>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor}	Back alignment and structure

>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A	Back alignment and structure

>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A*	Back alignment and structure

>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A	Back alignment and structure

>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5	Back alignment and structure

>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ...	Back alignment and structure

>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A	Back alignment and structure

>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C	Back alignment and structure

>2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A*	Back alignment and structure

>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A	Back alignment and structure

>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A	Back alignment and structure

>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia}	Back alignment and structure

>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A	Back alignment and structure

>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A	Back alignment and structure

>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A	Back alignment and structure

>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A	Back alignment and structure

>2odv_A Plectin 1, HD1; plakin domain, spectrin repeat, cytoskeleton, hemidesmosomes epidermolysis bullosa, structural protein; 2.05A {Homo sapiens} PDB: 2odu_A	Back alignment and structure

>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A	Back alignment and structure

>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A	Back alignment and structure

>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A	Back alignment and structure

>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum}	Back alignment and structure

>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A	Back alignment and structure

>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum}	Back alignment and structure

>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A	Back alignment and structure

>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A	Back alignment and structure

>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A	Back alignment and structure

>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1	Back alignment and structure

>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ...	Back alignment and structure

>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A	Back alignment and structure

>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens}	Back alignment and structure

>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ...	Back alignment and structure

>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A	Back alignment and structure

>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A	Back alignment and structure

>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A	Back alignment and structure

>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C*	Back alignment and structure

>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana}	Back alignment and structure

>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5	Back alignment and structure

>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A	Back alignment and structure

>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C	Back alignment and structure

>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C*	Back alignment and structure

>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1}	Back alignment and structure

>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens}	Back alignment and structure

>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii}	Back alignment and structure

>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B	Back alignment and structure

>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ...	Back alignment and structure

>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5	Back alignment and structure

>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A	Back alignment and structure

>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ...	Back alignment and structure

>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ...	Back alignment and structure

>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens}	Back alignment and structure

>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A	Back alignment and structure

>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A*	Back alignment and structure

>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A	Back alignment and structure

>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A	Back alignment and structure

>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B*	Back alignment and structure

>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A	Back alignment and structure

>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A	Back alignment and structure

>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A	Back alignment and structure

>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C	Back alignment and structure

>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8	Back alignment and structure

>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A	Back alignment and structure

>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7	Back alignment and structure

>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A	Back alignment and structure

>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1}	Back alignment and structure

>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii}	Back alignment and structure

>2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A*	Back alignment and structure

>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8	Back alignment and structure

>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus}	Back alignment and structure

>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A*	Back alignment and structure

>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum}	Back alignment and structure

>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5	Back alignment and structure

>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A	Back alignment and structure

>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum}	Back alignment and structure

>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A*	Back alignment and structure

>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum}	Back alignment and structure

>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A	Back alignment and structure

>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A	Back alignment and structure

>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei}	Back alignment and structure

>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B*	Back alignment and structure

>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A	Back alignment and structure

>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii}	Back alignment and structure

>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola}	Back alignment and structure

>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A	Back alignment and structure

>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5	Back alignment and structure

>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B	Back alignment and structure

>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi}	Back alignment and structure

>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens}	Back alignment and structure

>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia}	Back alignment and structure

>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5	Back alignment and structure

>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A	Back alignment and structure

>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A	Back alignment and structure

>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5	Back alignment and structure

>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii}	Back alignment and structure

>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A	Back alignment and structure

>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A	Back alignment and structure

>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E	Back alignment and structure

>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A	Back alignment and structure

>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens}	Back alignment and structure

>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A*	Back alignment and structure

>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola}	Back alignment and structure

>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus}	Back alignment and structure

>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A	Back alignment and structure

>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C	Back alignment and structure

>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A	Back alignment and structure

>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei}	Back alignment and structure

>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8	Back alignment and structure

>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A	Back alignment and structure

>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A	Back alignment and structure

>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe}	Back alignment and structure

>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A	Back alignment and structure

>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ...	Back alignment and structure

>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe}	Back alignment and structure

>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A	Back alignment and structure

>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A*	Back alignment and structure

>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A	Back alignment and structure

>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus}	Back alignment and structure

>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5	Back alignment and structure

>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana}	Back alignment and structure

>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A	Back alignment and structure

>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A	Back alignment and structure

>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5	Back alignment and structure

>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A	Back alignment and structure

>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A	Back alignment and structure

>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus}	Back alignment and structure

>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5	Back alignment and structure

>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8	Back alignment and structure

>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens}	Back alignment and structure

>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A	Back alignment and structure

>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A	Back alignment and structure

>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E	Back alignment and structure

>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5	Back alignment and structure

>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A	Back alignment and structure

>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5	Back alignment and structure

>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei}	Back alignment and structure

>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A	Back alignment and structure

>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A	Back alignment and structure

>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A	Back alignment and structure

>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A	Back alignment and structure

>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A*	Back alignment and structure

>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5	Back alignment and structure

>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A	Back alignment and structure

>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A	Back alignment and structure

>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A	Back alignment and structure

>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A	Back alignment and structure

>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A	Back alignment and structure

>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus}	Back alignment and structure

>1wlx_A Alpha-actinin 4; three-helix bundle, protein binding; NMR {Homo sapiens}	Back alignment and structure

>1wlx_A Alpha-actinin 4; three-helix bundle, protein binding; NMR {Homo sapiens}	Back alignment and structure

>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens}	Back alignment and structure

>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A	Back alignment and structure

>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A	Back alignment and structure

>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A*	Back alignment and structure

>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A*	Back alignment and structure

>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5	Back alignment and structure

>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A	Back alignment and structure

>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei}	Back alignment and structure

>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A*	Back alignment and structure

>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L	Back alignment and structure

>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5	Back alignment and structure

>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A	Back alignment and structure

>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A*	Back alignment and structure

>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A	Back alignment and structure

>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A	Back alignment and structure

>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana}	Back alignment and structure

>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A	Back alignment and structure

>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens}	Back alignment and structure

>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi}	Back alignment and structure

>1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3	Back alignment and structure

>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B	Back alignment and structure

>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C	Back alignment and structure

>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A	Back alignment and structure

>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3	Back alignment and structure

>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A	Back alignment and structure

>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A	Back alignment and structure

>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4	Back alignment and structure

>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A	Back alignment and structure

>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group}	Back alignment and structure

>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L	Back alignment and structure

>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A	Back alignment and structure

>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A	Back alignment and structure

>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4	Back alignment and structure

>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A	Back alignment and structure

>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A	Back alignment and structure

>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3	Back alignment and structure

>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B	Back alignment and structure

>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens}	Back alignment and structure

>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A	Back alignment and structure

>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A	Back alignment and structure

>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A*	Back alignment and structure

>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens}	Back alignment and structure

>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A	Back alignment and structure

>1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7	Back alignment and structure

>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A	Back alignment and structure

>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5	Back alignment and structure

>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens}	Back alignment and structure

>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6	Back alignment and structure

>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica}	Back alignment and structure

>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A	Back alignment and structure

>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens}	Back alignment and structure

>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A*	Back alignment and structure

>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens}	Back alignment and structure

>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A	Back alignment and structure

>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6	Back alignment and structure

>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6	Back alignment and structure

>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens}	Back alignment and structure

>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus}	Back alignment and structure

>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens}	Back alignment and structure

>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6	Back alignment and structure

>1pul_A Hypothetical protein C32E8.3 in chromosome I; alpha helical, northeast structural genomics consortium, PSI, protein structure initiative; NMR {Caenorhabditis elegans} SCOP: a.39.1.11	Back alignment and structure

>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A	Back alignment and structure

>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A*	Back alignment and structure

>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5	Back alignment and structure

>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A	Back alignment and structure

>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A	Back alignment and structure

>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens}	Back alignment and structure

>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A	Back alignment and structure

>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7	Back alignment and structure

>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A	Back alignment and structure

>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A	Back alignment and structure

>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max}	Back alignment and structure

>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A	Back alignment and structure

>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A	Back alignment and structure

>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10	Back alignment and structure

>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens}	Back alignment and structure

>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A	Back alignment and structure

>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A	Back alignment and structure

>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A	Back alignment and structure

>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7	Back alignment and structure

>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1	Back alignment and structure

>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus}	Back alignment and structure

>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ...	Back alignment and structure

>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A	Back alignment and structure

>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A	Back alignment and structure

>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio}	Back alignment and structure

>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A	Back alignment and structure

>2l5y_A Stromal interaction molecule 2; EF-hand, SAM domain, store OPE calcium entry, signaling protein; NMR {Homo sapiens}	Back alignment and structure

>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus}	Back alignment and structure

>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A	Back alignment and structure

>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A	Back alignment and structure

>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A	Back alignment and structure

>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A	Back alignment and structure

>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A	Back alignment and structure

>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A	Back alignment and structure

>1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		801
d1v5ra1		85	d.82.4.1 (A:7-91) Growth-arrest-specific protein 2	3e-26
d1owaa_		156	a.7.1.1 (A:) Spectrin alpha chain {Human (Homo sap	1e-09
d1owaa_		156	a.7.1.1 (A:) Spectrin alpha chain {Human (Homo sap	5e-05
d1owaa_		156	a.7.1.1 (A:) Spectrin alpha chain {Human (Homo sap	1e-04
d1owaa_		156	a.7.1.1 (A:) Spectrin alpha chain {Human (Homo sap	0.002
d1s35a1		106	a.7.1.1 (A:1063-1168) Spectrin beta chain {Human (	6e-08
d1s35a1		106	a.7.1.1 (A:1063-1168) Spectrin beta chain {Human (	2e-05
d1s35a1		106	a.7.1.1 (A:1063-1168) Spectrin beta chain {Human (	3e-05
d1s35a1		106	a.7.1.1 (A:1063-1168) Spectrin beta chain {Human (	2e-04
d1quua1		124	a.7.1.1 (A:1-124) alpha-actinin {Human (Homo sapie	2e-07
d1quua1		124	a.7.1.1 (A:1-124) alpha-actinin {Human (Homo sapie	1e-04
d1quua1		124	a.7.1.1 (A:1-124) alpha-actinin {Human (Homo sapie	1e-04
d1tiza_		67	a.39.1.5 (A:) Calmodulin-related protein T21P5.17	6e-07
d1s6ja_		87	a.39.1.5 (A:) Calcium-dependent protein kinase sk5	1e-06
d1wlza1		83	a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {H	2e-06
d1oqpa_		77	a.39.1.5 (A:) Caltractin (centrin 2) {Green algae	2e-06
d1u5pa1		110	a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicke	3e-06
d1u5pa1		110	a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicke	7e-06
d1u5pa1		110	a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicke	7e-05
d1u5pa1		110	a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicke	0.002
d1u5pa2		101	a.7.1.1 (A:1772-1872) Spectrin alpha chain {Chicke	5e-06
d1u5pa2		101	a.7.1.1 (A:1772-1872) Spectrin alpha chain {Chicke	5e-05
d1u5pa2		101	a.7.1.1 (A:1772-1872) Spectrin alpha chain {Chicke	0.002
d2pvba_		107	a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax	1e-05
d1rroa_		108	a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus)	1e-05
d1fi5a_		81	a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus),	3e-05
d1cuna2		104	a.7.1.1 (A:116-219) Spectrin alpha chain {Chicken	5e-05
d1cuna2		104	a.7.1.1 (A:116-219) Spectrin alpha chain {Chicken	0.002
d1c07a_		95	a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId:	6e-05
d2spca_		107	a.7.1.1 (A:) Spectrin alpha chain {Drosophila sp.	1e-04
d1c7va_		68	a.39.1.5 (A:) Calcium vector protein {Amphioxus (B	2e-04
d2opoa1		81	a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Che	2e-04
d2fcea1		61	a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [	2e-04
d1f54a_		77	a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom	3e-04
d1jc2a_		75	a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus)	4e-04
d1rwya_		109	a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [Ta	4e-04
d1s35a2		105	a.7.1.1 (A:1169-1273) Spectrin beta chain {Human (	4e-04
d1avsa_		81	a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus)	6e-04
d1pvaa_		109	a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax	7e-04
d1fw4a_		65	a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId:	0.002
d5pala_		109	a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis	0.002
d1quua2		124	a.7.1.1 (A:125-248) alpha-actinin {Human (Homo sap	0.002
d1quua2		124	a.7.1.1 (A:125-248) alpha-actinin {Human (Homo sap	0.004
d1topa_		162	a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus)	0.003
d1hcia4		114	a.7.1.1 (A:633-746) alpha-actinin {Human (Homo sap	0.004

>d1v5ra1 d.82.4.1 (A:7-91) Growth-arrest-specific protein 2, GAS2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85	Back information, alignment and structure


class: Alpha and beta proteins (a+b)
fold: N domain of copper amine oxidase-like
superfamily: GAS2 domain-like
family: GAS2 domain
domain: Growth-arrest-specific protein 2, GAS2
species: Mouse (Mus musculus) [TaxId: 10090]

 Score =  100 bits (251), Expect = 3e-26
 Identities = 31/71 (43%), Positives = 46/71 (64%), Gaps = 5/71 (7%)

Query: 729 IHDEVKRLVQ--LCTCRQKFRVFQVGEGKYRFGDSQKLRLVRILRST-VMVRVGGGWVAL 785
           + D VKR+ +   C C  KF V ++ +G+YR G+  K+  +R+L +  VMVRVGGGW   
Sbjct: 4   LDDAVKRISEDPPCKCPTKFCVERLSQGRYRVGE--KILFIRMLHNKHVMVRVGGGWETF 61

Query: 786 DEFLIKNDPCR 796
             +L+K+DPCR
Sbjct: 62  AGYLLKHDPCR 72

PyMOL of d1v5ra1

>d1owaa_ a.7.1.1 (A:) Spectrin alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 156	Back information, alignment and structure

>d1owaa_ a.7.1.1 (A:) Spectrin alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 156	Back information, alignment and structure

>d1owaa_ a.7.1.1 (A:) Spectrin alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 156	Back information, alignment and structure

>d1owaa_ a.7.1.1 (A:) Spectrin alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 156	Back information, alignment and structure

>d1s35a1 a.7.1.1 (A:1063-1168) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 106	Back information, alignment and structure

>d1s35a1 a.7.1.1 (A:1063-1168) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 106	Back information, alignment and structure

>d1s35a1 a.7.1.1 (A:1063-1168) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 106	Back information, alignment and structure

>d1s35a1 a.7.1.1 (A:1063-1168) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 106	Back information, alignment and structure

>d1quua1 a.7.1.1 (A:1-124) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 124	Back information, alignment and structure

>d1quua1 a.7.1.1 (A:1-124) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 124	Back information, alignment and structure

>d1quua1 a.7.1.1 (A:1-124) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 124	Back information, alignment and structure

>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67	Back information, alignment and structure

>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 87	Back information, alignment and structure

>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Length = 83	Back information, alignment and structure

>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77	Back information, alignment and structure

>d1u5pa1 a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 110	Back information, alignment and structure

>d1u5pa1 a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 110	Back information, alignment and structure

>d1u5pa1 a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 110	Back information, alignment and structure

>d1u5pa1 a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 110	Back information, alignment and structure

>d1u5pa2 a.7.1.1 (A:1772-1872) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 101	Back information, alignment and structure

>d1u5pa2 a.7.1.1 (A:1772-1872) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 101	Back information, alignment and structure

>d1u5pa2 a.7.1.1 (A:1772-1872) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 101	Back information, alignment and structure

>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 107	Back information, alignment and structure

>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 108	Back information, alignment and structure

>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Length = 81	Back information, alignment and structure

>d1cuna2 a.7.1.1 (A:116-219) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 104	Back information, alignment and structure

>d1cuna2 a.7.1.1 (A:116-219) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 104	Back information, alignment and structure

>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Length = 95	Back information, alignment and structure

>d2spca_ a.7.1.1 (A:) Spectrin alpha chain {Drosophila sp. [TaxId: 7242]} Length = 107	Back information, alignment and structure

>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 68	Back information, alignment and structure

>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Length = 81	Back information, alignment and structure

>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 61	Back information, alignment and structure

>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 77	Back information, alignment and structure

>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 75	Back information, alignment and structure

>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Length = 109	Back information, alignment and structure

>d1s35a2 a.7.1.1 (A:1169-1273) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 105	Back information, alignment and structure

>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 81	Back information, alignment and structure

>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 109	Back information, alignment and structure

>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 65	Back information, alignment and structure

>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Length = 109	Back information, alignment and structure

>d1quua2 a.7.1.1 (A:125-248) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 124	Back information, alignment and structure

>d1quua2 a.7.1.1 (A:125-248) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 124	Back information, alignment and structure

>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 162	Back information, alignment and structure

>d1hcia4 a.7.1.1 (A:633-746) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 114	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		801
d1v5ra1		85	Growth-arrest-specific protein 2, GAS2 {Mouse (Mus	99.95
d1owaa_		156	Spectrin alpha chain {Human (Homo sapiens) [TaxId:	99.49
d1quua1		124	alpha-actinin {Human (Homo sapiens) [TaxId: 9606]}	99.46
d1owaa_		156	Spectrin alpha chain {Human (Homo sapiens) [TaxId:	99.44
d1cuna2		104	Spectrin alpha chain {Chicken (Gallus gallus) [Tax	99.41
d1s35a2		105	Spectrin beta chain {Human (Homo sapiens) [TaxId:	99.39
d1s35a1		106	Spectrin beta chain {Human (Homo sapiens) [TaxId:	99.39
d1u5pa1		110	Spectrin alpha chain {Chicken (Gallus gallus) [Tax	99.39
d1quua1		124	alpha-actinin {Human (Homo sapiens) [TaxId: 9606]}	99.36
d1wrka1		82	Troponin C {Human (Homo sapiens), cardiac isoform	99.34
d1avsa_		81	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	99.34
d1u5pa2		101	Spectrin alpha chain {Chicken (Gallus gallus) [Tax	99.34
d1fw4a_		65	Calmodulin {Cow (Bos taurus) [TaxId: 9913]}	99.33
d1f54a_		77	Calmodulin {Baker's yeast (Saccharomyces cerevisia	99.33
d1jc2a_		75	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	99.32
d2fcea1		61	Calmodulin {Cow (Bos taurus) [TaxId: 9913]}	99.32
d1fi5a_		81	Troponin C {Chicken (Gallus gallus), cardiac isofo	99.31
d1u5pa1		110	Spectrin alpha chain {Chicken (Gallus gallus) [Tax	99.3
d2opoa1		81	Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta	99.3
d1tiza_		67	Calmodulin-related protein T21P5.17 {Thale cress (	99.29
d1cuna2		104	Spectrin alpha chain {Chicken (Gallus gallus) [Tax	99.29
d2pq3a1		73	Calmodulin {Rattus norvegicus [TaxId: 10116]}	99.28
d1s35a1		106	Spectrin beta chain {Human (Homo sapiens) [TaxId:	99.27
d1s35a2		105	Spectrin beta chain {Human (Homo sapiens) [TaxId:	99.27
d1c7va_		68	Calcium vector protein {Amphioxus (Branchiostoma l	99.26
d1oqpa_		77	Caltractin (centrin 2) {Green algae (Chlamydomonas	99.26
d5pala_		109	Parvalbumin {Leopard shark (Triakis semifasciata)	99.25
d1hcia4		114	alpha-actinin {Human (Homo sapiens) [TaxId: 9606]}	99.25
d1pvaa_		109	Parvalbumin {Pike (Esox lucius) [TaxId: 8010]}	99.24
d1s6ja_		87	Calcium-dependent protein kinase sk5 CLD {Soybean	99.22
d1u5pa2		101	Spectrin alpha chain {Chicken (Gallus gallus) [Tax	99.2
d1quua2		124	alpha-actinin {Human (Homo sapiens) [TaxId: 9606]}	99.2
d1quua2		124	alpha-actinin {Human (Homo sapiens) [TaxId: 9606]}	99.2
d1rroa_		108	Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116	99.18
d1wlza1		83	DJ-1-binding protein, DJBP {Human (Homo sapiens) [	99.18
d2spca_		107	Spectrin alpha chain {Drosophila sp. [TaxId: 7242]	99.17
d2pvba_		107	Parvalbumin {Pike (Esox lucius) [TaxId: 8010]}	99.14
d1rwya_		109	Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]}	99.14
d1hcia4		114	alpha-actinin {Human (Homo sapiens) [TaxId: 9606]}	99.1
d2spca_		107	Spectrin alpha chain {Drosophila sp. [TaxId: 7242]	99.05
d1qx2a_		76	Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]}	99.0
d1wdcb_		142	Myosin Essential Chain {Bay scallop (Aequipecten i	98.97
d1wdcc_		152	Myosin Regulatory Chain {Bay scallop (Aequipecten	98.93
d1c07a_		95	Eps15 {Human (Homo sapiens) [TaxId: 9606]}	98.91
d2mysb_		145	Myosin Essential Chain {Chicken (Gallus gallus) [T	98.89
d1lkja_		146	Calmodulin {Baker's yeast (Saccharomyces cerevisia	98.88
d1fi6a_		92	Reps1 {Mouse (Mus musculus) [TaxId: 10090]}	98.87
d1zfsa1		93	Calcyclin (S100) {Rat (Rattus norvegicus), s100a1	98.87
d1exra_		146	Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI	98.86
d1jfja_		134	EHCABP {Entamoeba (Entamoeba histolytica) [TaxId:	98.84
d1cb1a_		78	Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]}	98.84
d2mysc_		145	Myosin Regulatory Chain {Chicken (Gallus gallus) [	98.84
d1yuta1		98	Calcyclin (S100) {Human (Homo sapiens), s100a13 [T	98.82
d1a4pa_		92	Calcyclin (S100) {Human (Homo sapiens), P11 s100a1	98.82
d2obha1		141	Calmodulin {Human (Homo sapiens) [TaxId: 9606]}	98.8
d1m45a_		146	Myosin Light Chain Mlc1p {Baker's yeast (Saccharom	98.8
d2mysc_		145	Myosin Regulatory Chain {Chicken (Gallus gallus) [	98.79
d3c1va1		93	Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta	98.78
d1dtla_		156	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	98.78
d1ksoa_		93	Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta	98.77
d1ggwa_		140	Cdc4p {Fission yeast (Schizosaccharomyces pombe) [	98.75
d1snla_		99	Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax	98.73
d1topa_		162	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	98.73
d1k8ua_		89	Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta	98.73
d1xk4a1		87	Calcyclin (S100) {Human (Homo sapiens), calgranuli	98.7
d2jxca1		95	Eps15 {Human (Homo sapiens) [TaxId: 9606]}	98.67
d1exra_		146	Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI	98.67
d1qv0a_		189	Calcium-regulated photoprotein {Hydrozoa (Obelia l	98.67
d1k94a_		165	Grancalcin {Human (Homo sapiens) [TaxId: 9606]}	98.65
d1w7jb1		139	Myosin Essential Chain {Human (Homo sapiens) [TaxI	98.65
d1uhka1		187	Calcium-regulated photoprotein {Jellyfish (Aequore	98.62
d1ggwa_		140	Cdc4p {Fission yeast (Schizosaccharomyces pombe) [	98.61
d1qjta_		99	Eps15 {Mouse (Mus musculus) [TaxId: 10090]}	98.6
d2obha1		141	Calmodulin {Human (Homo sapiens) [TaxId: 9606]}	98.59
d1e8aa_		87	Calcyclin (S100) {Human (Homo sapiens), calgranuli	98.58
d1wdcc_		152	Myosin Regulatory Chain {Bay scallop (Aequipecten	98.58
d1iq3a_		110	Pob1 {Human (Homo sapiens) [TaxId: 9606]}	98.56
d1y1xa_		182	Programmed cell death 6 protein-like protein {Leis	98.54
d1s6ia_		182	Calcium-dependent protein kinase sk5 CLD {Soybean	98.53
d1psra_		100	Calcyclin (S100) {Human (Homo sapiens), psoriasin	98.52
d1nyaa_		176	Calerythrin {Saccharopolyspora erythraea [TaxId: 1	98.51
d1qxpa2		188	Calpain large subunit, C-terminal domain (domain I	98.5
d1wdcb_		142	Myosin Essential Chain {Bay scallop (Aequipecten i	98.46
d1xo5a_		180	Calcium- and integrin-binding protein, CIB {Human	98.44
d2hf5a1		33	Troponin C {Human (Homo sapiens), cardiac isoform	98.44
d1w7jb1		139	Myosin Essential Chain {Human (Homo sapiens) [TaxI	98.43
d1lkja_		146	Calmodulin {Baker's yeast (Saccharomyces cerevisia	98.37
d1df0a1		186	Calpain large subunit, C-terminal domain (domain I	98.37
d2sasa_		185	Sarcoplasmic calcium-binding protein {Amphioxus (B	98.37
d1hqva_		181	Apoptosis-linked protein alg-2 {Mouse (Mus musculu	98.37
d2scpa_		174	Sarcoplasmic calcium-binding protein {Sandworm (Ne	98.36
d1y1xa_		182	Programmed cell death 6 protein-like protein {Leis	98.35
d1alva_		173	Calpain small (regulatory) subunit (domain VI) {Pi	98.34
d1dtla_		156	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	98.34
d2mysb_		145	Myosin Essential Chain {Chicken (Gallus gallus) [T	98.34
d1m45a_		146	Myosin Light Chain Mlc1p {Baker's yeast (Saccharom	98.32
d1g8ia_		187	Frequenin (neuronal calcium sensor 1) {Human (Homo	98.32
d1bjfa_		181	Neurocalcin {Cow (Bos taurus) [TaxId: 9913]}	98.32
d1hqva_		181	Apoptosis-linked protein alg-2 {Mouse (Mus musculu	98.31
d1jbaa_		189	Guanylate cyclase activating protein 2, GCAP-2 {Co	98.28
d1jfja_		134	EHCABP {Entamoeba (Entamoeba histolytica) [TaxId:	98.26
d1fpwa_		190	Frequenin (neuronal calcium sensor 1) {Baker's yea	98.25
d1ij5a_		321	Cbp40 (plasmodial specific CaII-binding protein LA	98.24
d1s6ia_		182	Calcium-dependent protein kinase sk5 CLD {Soybean	98.23
d1topa_		162	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	98.22
d1k94a_		165	Grancalcin {Human (Homo sapiens) [TaxId: 9606]}	98.2
d3cr5x1		90	Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId:	98.19
d1fpwa_		190	Frequenin (neuronal calcium sensor 1) {Baker's yea	98.18
d1omra_		201	Recoverin {Cow (Bos taurus) [TaxId: 9913]}	98.18
d2zfda1		183	Calcineurin B-like protein 2 {Thale cress (Arabido	98.18
d1auib_		165	Calcineurin regulatory subunit (B-chain) {Human (H	98.15
d1ctda_		34	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	98.15
d1jbaa_		189	Guanylate cyclase activating protein 2, GCAP-2 {Co	98.1
d1auib_		165	Calcineurin regulatory subunit (B-chain) {Human (H	98.09
d1juoa_		172	Sorcin {Human (Homo sapiens) [TaxId: 9606]}	98.08
d1ij5a_		321	Cbp40 (plasmodial specific CaII-binding protein LA	98.05
d1s6ca_		178	Kchip1, Kv4 potassium channel-interacting protein	98.04
d1s6ca_		178	Kchip1, Kv4 potassium channel-interacting protein	98.03
d1qlsa_		95	Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1	98.01
d1omra_		201	Recoverin {Cow (Bos taurus) [TaxId: 9913]}	98.01
d1juoa_		172	Sorcin {Human (Homo sapiens) [TaxId: 9606]}	97.93
d1j55a_		94	Calcyclin (S100) {Human (Homo sapiens), s100p [Tax	97.92
d1alva_		173	Calpain small (regulatory) subunit (domain VI) {Pi	97.86
d1g8ia_		187	Frequenin (neuronal calcium sensor 1) {Human (Homo	97.85
d1pvaa_		109	Parvalbumin {Pike (Esox lucius) [TaxId: 8010]}	97.84
d2zfda1		183	Calcineurin B-like protein 2 {Thale cress (Arabido	97.82
d1df0a1		186	Calpain large subunit, C-terminal domain (domain I	97.8
d1bjfa_		181	Neurocalcin {Cow (Bos taurus) [TaxId: 9913]}	97.76
d1xo5a_		180	Calcium- and integrin-binding protein, CIB {Human	97.7
d1qxpa2		188	Calpain large subunit, C-terminal domain (domain I	97.69
d1xk4c1		83	Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr	97.65
d5pala_		109	Parvalbumin {Leopard shark (Triakis semifasciata)	97.63
d2scpa_		174	Sarcoplasmic calcium-binding protein {Sandworm (Ne	97.61
d1uhka1		187	Calcium-regulated photoprotein {Jellyfish (Aequore	97.5
d2zkmx1		170	Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI	97.39
d2sasa_		185	Sarcoplasmic calcium-binding protein {Amphioxus (B	97.34
d2pvba_		107	Parvalbumin {Pike (Esox lucius) [TaxId: 8010]}	97.34
d1nyaa_		176	Calerythrin {Saccharopolyspora erythraea [TaxId: 1	97.18
d1ctda_		34	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	97.18
d1rwya_		109	Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]}	97.18
d1rroa_		108	Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116	97.09
d2hf5a1		33	Troponin C {Human (Homo sapiens), cardiac isoform	96.91
d1qv0a_		189	Calcium-regulated photoprotein {Hydrozoa (Obelia l	96.8
d1hcia1		125	alpha-actinin {Human (Homo sapiens) [TaxId: 9606]}	96.75
d1tuza_		118	Diacylglycerol kinase alpha, N-terminal domain {Hu	96.16
d2zkmx1		170	Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI	96.03
d1fi5a_		81	Troponin C {Chicken (Gallus gallus), cardiac isofo	95.92
d1jc2a_		75	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	95.89
d1oqpa_		77	Caltractin (centrin 2) {Green algae (Chlamydomonas	95.49
d1hcia1		125	alpha-actinin {Human (Homo sapiens) [TaxId: 9606]}	95.01
d2opoa1		81	Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta	94.94
d1fw4a_		65	Calmodulin {Cow (Bos taurus) [TaxId: 9913]}	94.81
d1c7va_		68	Calcium vector protein {Amphioxus (Branchiostoma l	94.8
d2pq3a1		73	Calmodulin {Rattus norvegicus [TaxId: 10116]}	94.11
d1s6ja_		87	Calcium-dependent protein kinase sk5 CLD {Soybean	94.02
d1c07a_		95	Eps15 {Human (Homo sapiens) [TaxId: 9606]}	93.92
d1tiza_		67	Calmodulin-related protein T21P5.17 {Thale cress (	93.66
d1avsa_		81	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	93.39
d1f54a_		77	Calmodulin {Baker's yeast (Saccharomyces cerevisia	93.04
d1sraa_		151	C-terminal (EC) domain of BM-40/SPARC/osteonectin	92.75
d2fcea1		61	Calmodulin {Cow (Bos taurus) [TaxId: 9913]}	92.14
d1wrka1		82	Troponin C {Human (Homo sapiens), cardiac isoform	91.75
d1snla_		99	Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax	91.46
d1qx2a_		76	Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]}	91.44
d1wlza1		83	DJ-1-binding protein, DJBP {Human (Homo sapiens) [	91.23
d1fi6a_		92	Reps1 {Mouse (Mus musculus) [TaxId: 10090]}	90.86
d3c1va1		93	Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta	90.04
d1j7qa_		86	Calcium vector protein {Amphioxus (Branchiostoma l	89.91
d1yuta1		98	Calcyclin (S100) {Human (Homo sapiens), s100a13 [T	89.75
d1a4pa_		92	Calcyclin (S100) {Human (Homo sapiens), P11 s100a1	89.36
d1qjta_		99	Eps15 {Mouse (Mus musculus) [TaxId: 10090]}	88.62
d1qasa1		94	Phosphoinositide-specific phospholipase C, isozyme	88.45
d1zfsa1		93	Calcyclin (S100) {Rat (Rattus norvegicus), s100a1	88.27
d1cb1a_		78	Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]}	87.61
d1ksoa_		93	Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta	85.95
d1xk4a1		87	Calcyclin (S100) {Human (Homo sapiens), calgranuli	84.57
d1iq3a_		110	Pob1 {Human (Homo sapiens) [TaxId: 9606]}	84.52
d1psra_		100	Calcyclin (S100) {Human (Homo sapiens), psoriasin	84.38
d2jxca1		95	Eps15 {Human (Homo sapiens) [TaxId: 9606]}	83.75
d1e8aa_		87	Calcyclin (S100) {Human (Homo sapiens), calgranuli	83.36
d1k8ua_		89	Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta	81.76

>d1v5ra1 d.82.4.1 (A:7-91) Growth-arrest-specific protein 2, GAS2 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: N domain of copper amine oxidase-like
superfamily: GAS2 domain-like
family: GAS2 domain
domain: Growth-arrest-specific protein 2, GAS2
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.95  E-value=2e-30  Score=196.36  Aligned_cols=71  Identities=42%  Similarity=0.909  Sum_probs=64.9

Q ss_pred             hhhhHHHHhhhc--ccccccccceeEcCCCccccCCcchhHHHhhhcC-ccceecCccHhhHHHhhhhcCCCCccc
Q psy13767        727 EKIHDEVKRLVQ--LCTCRQKFRVFQVGEGKYRFGDSQKLRLVRILRS-TVMVRVGGGWVALDEFLIKNDPCRDNV  799 (801)
Q Consensus       727 ~~i~~~v~~~~~--~c~~~~~~~v~~~~~g~y~~g~~~~~~~~r~~~~-~~~~rvg~g~~~~~~~~~~~~~~~~~~  799 (801)
                      +.||+++..++.  .|+|+++|+|.++++|+|+||++  ++|||+|++ ||||||||||+||+|||++|||||+++
T Consensus         2 k~lD~~v~~~~~~~~C~C~~~f~i~ri~eGkY~~G~k--~i~vRil~~~~VmVRVGGGw~~L~efL~k~dPcr~~~   75 (85)
T d1v5ra1           2 NLLDDAVKRISEDPPCKCPTKFCVERLSQGRYRVGEK--ILFIRMLHNKHVMVRVGGGWETFAGYLLKHDPCRMLQ   75 (85)
T ss_dssp             CHHHHHHHHHHTSSCCCSSSCCCEEEEETTEEEETTE--EEEEEEETTTEEEEEETTEEEEHHHHHHHHCHHHHTS
T ss_pred             chHHHHHHHHhcCCCCcCCCccceEEecCCcEEECCE--EEEEEEeCCCEEEEEEcCcHHHHHHHHHhcChhhhhh
Confidence            347888877776  59999999999999999999997  999999997 799999999999999999999999874

PyMOL of d1v5ra1

>d1owaa_ a.7.1.1 (A:) Spectrin alpha chain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1quua1 a.7.1.1 (A:1-124) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1owaa_ a.7.1.1 (A:) Spectrin alpha chain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1cuna2 a.7.1.1 (A:116-219) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1s35a2 a.7.1.1 (A:1169-1273) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1s35a1 a.7.1.1 (A:1063-1168) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1u5pa1 a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1quua1 a.7.1.1 (A:1-124) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]}	Back information, alignment and structure

>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1u5pa2 a.7.1.1 (A:1772-1872) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]}	Back information, alignment and structure

>d1u5pa1 a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]}	Back information, alignment and structure

>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1cuna2 a.7.1.1 (A:116-219) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]}	Back information, alignment and structure

>d1s35a1 a.7.1.1 (A:1063-1168) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1s35a2 a.7.1.1 (A:1169-1273) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]}	Back information, alignment and structure

>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]}	Back information, alignment and structure

>d1hcia4 a.7.1.1 (A:633-746) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]}	Back information, alignment and structure

>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]}	Back information, alignment and structure

>d1u5pa2 a.7.1.1 (A:1772-1872) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1quua2 a.7.1.1 (A:125-248) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1quua2 a.7.1.1 (A:125-248) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2spca_ a.7.1.1 (A:) Spectrin alpha chain {Drosophila sp. [TaxId: 7242]}	Back information, alignment and structure

>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]}	Back information, alignment and structure

>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]}	Back information, alignment and structure

>d1hcia4 a.7.1.1 (A:633-746) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2spca_ a.7.1.1 (A:) Spectrin alpha chain {Drosophila sp. [TaxId: 7242]}	Back information, alignment and structure

>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]}	Back information, alignment and structure

>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]}	Back information, alignment and structure

>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]}	Back information, alignment and structure

>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]}	Back information, alignment and structure

>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}	Back information, alignment and structure

>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]}	Back information, alignment and structure

>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]}	Back information, alignment and structure

>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]}	Back information, alignment and structure

>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]}	Back information, alignment and structure

>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]}	Back information, alignment and structure

>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]}	Back information, alignment and structure

>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]}	Back information, alignment and structure

>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]}	Back information, alignment and structure

>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]}	Back information, alignment and structure

>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]}	Back information, alignment and structure

>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]}	Back information, alignment and structure

>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]}	Back information, alignment and structure

>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]}	Back information, alignment and structure

>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]}	Back information, alignment and structure

>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]}	Back information, alignment and structure

>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]}	Back information, alignment and structure

>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]}	Back information, alignment and structure

>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]}	Back information, alignment and structure

>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]}	Back information, alignment and structure

>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]}	Back information, alignment and structure

>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]}	Back information, alignment and structure

>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]}	Back information, alignment and structure

>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}	Back information, alignment and structure

>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]}	Back information, alignment and structure

>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]}	Back information, alignment and structure

>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]}	Back information, alignment and structure

>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]}	Back information, alignment and structure

>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]}	Back information, alignment and structure

>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]}	Back information, alignment and structure

>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]}	Back information, alignment and structure

>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]}	Back information, alignment and structure

>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]}	Back information, alignment and structure

>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]}	Back information, alignment and structure

>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]}	Back information, alignment and structure

>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]}	Back information, alignment and structure

>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]}	Back information, alignment and structure

>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]}	Back information, alignment and structure

>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]}	Back information, alignment and structure

>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]}	Back information, alignment and structure

>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]}	Back information, alignment and structure

>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]}	Back information, alignment and structure

>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]}	Back information, alignment and structure

>d1hcia1 a.7.1.1 (A:272-396) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]}	Back information, alignment and structure

>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1hcia1 a.7.1.1 (A:272-396) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]}	Back information, alignment and structure

>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]}	Back information, alignment and structure

>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]}	Back information, alignment and structure

>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]}	Back information, alignment and structure

>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]}	Back information, alignment and structure

>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]}	Back information, alignment and structure

>d1j7qa_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]}	Back information, alignment and structure

>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]}	Back information, alignment and structure

>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]}	Back information, alignment and structure

>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]}	Back information, alignment and structure

>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]}	Back information, alignment and structure

>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]}	Back information, alignment and structure

>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]}	Back information, alignment and structure

>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]}	Back information, alignment and structure

>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]}	Back information, alignment and structure