Psyllid ID: psy13814

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70-----
MSDIKNYCLDIKGDFPFAIIGDENRDLAVKLDLLDEENKNNLETAITVRAVYIIGPDRKLKLSIVYPASTGRSVE
cccHHHHHHHcccccccEEEEEcccHHHHHcccccccccccccccEEEEEEEEEccccEEEEEEEcccccccccc
cccHHHHcccccccccccEEEccccHHHHHcccccccccccccccccccEEEEEccccEEEEEEEccccEcccHH
msdiknycldikgdfpfaiigdenRDLAVKLDLLDEENKNNLETAITVRAVYiigpdrklklsivypastgrsve
MSDIKNYCLDIKGDFPFAIIGDENRDLAVKLDLLDEenknnletaitvravyiigpdrklklsivypastgrsve
MSDIKNYCLDIKGDFPFAIIGDENRDLAVkldlldeenknnleTAITVRAVYIIGPDRKLKLSIVYPASTGRSVE
****KNYCLDIKGDFPFAIIGDENRDLAVKLDLLDEENKNNLETAITVRAVYIIGPDRKLKLSIVY*********
MSDIKNYCLDIKGDFPFAIIGDENRDLAVKLDLLDEENKNNLETAITVRAVYIIGPDRKLKLSIVYPASTGRS**
MSDIKNYCLDIKGDFPFAIIGDENRDLAVKLDLLDEENKNNLETAITVRAVYIIGPDRKLKLSIVYPASTGRSVE
MSDIKNYCLDIKGDFPFAIIGDENRDLAVKLDLLDEENKNNLETAITVRAVYIIGPDRKLKLSIVYPASTGRS**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooo
ooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSDIKNYCLDIKGDFPFAIIGDENRDLAVKLDLLDEENKNNLETAITVRAVYIIGPDRKLKLSIVYPASTGRSVE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query75 2.2.26 [Sep-21-2011]
O77834224 Peroxiredoxin-6 OS=Bos ta yes N/A 0.813 0.272 0.540 3e-13
Q9TSX9224 Peroxiredoxin-6 OS=Sus sc yes N/A 0.853 0.285 0.515 6e-13
Q2PFL9224 Peroxiredoxin-6 OS=Macaca N/A N/A 0.906 0.303 0.485 7e-13
Q5ZJF4224 Peroxiredoxin-6 OS=Gallus yes N/A 0.813 0.272 0.524 1e-12
P30041224 Peroxiredoxin-6 OS=Homo s yes N/A 0.973 0.325 0.472 1e-12
O35244224 Peroxiredoxin-6 OS=Rattus yes N/A 0.813 0.272 0.524 3e-12
O17433235 1-Cys peroxiredoxin OS=Di N/A N/A 0.813 0.259 0.508 4e-12
O08709224 Peroxiredoxin-6 OS=Mus mu yes N/A 0.813 0.272 0.524 6e-12
Q5R7E0224 Peroxiredoxin-6 OS=Pongo yes N/A 0.973 0.325 0.472 7e-12
P52570232 Putative peroxiredoxin OS N/A N/A 0.88 0.284 0.439 1e-10
>sp|O77834|PRDX6_BOVIN Peroxiredoxin-6 OS=Bos taurus GN=PRDX6 PE=1 SV=3 Back     alignment and function desciption
 Score = 73.9 bits (180), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 45/61 (73%)

Query: 15  FPFAIIGDENRDLAVKLDLLDEENKNNLETAITVRAVYIIGPDRKLKLSIVYPASTGRSV 74
            PF II D+NRDLA++L +LD   K+     +T R V+I GPD+KLKLSI+YPA+TGR+ 
Sbjct: 98  LPFPIIDDKNRDLAIQLGMLDPAEKDEKGMPVTARVVFIFGPDKKLKLSILYPATTGRNF 157

Query: 75  E 75
           +
Sbjct: 158 D 158
Involved in redox regulation of the cell. Can reduce H(2)O(2) and short chain organic, fatty acid, and phospholipid hydroperoxides. May play a role in the regulation of phospholipid turnover as well as in protection against oxidative injury.
Bos taurus (taxid: 9913)
EC: 1EC: .EC: 1EC: 1EC: .EC: 1EC: .EC: 9
>sp|Q9TSX9|PRDX6_PIG Peroxiredoxin-6 OS=Sus scrofa GN=PRDX6 PE=2 SV=3 Back     alignment and function description
>sp|Q2PFL9|PRDX6_MACFA Peroxiredoxin-6 OS=Macaca fascicularis GN=PRDX6 PE=2 SV=3 Back     alignment and function description
>sp|Q5ZJF4|PRDX6_CHICK Peroxiredoxin-6 OS=Gallus gallus GN=PRDX6 PE=2 SV=3 Back     alignment and function description
>sp|P30041|PRDX6_HUMAN Peroxiredoxin-6 OS=Homo sapiens GN=PRDX6 PE=1 SV=3 Back     alignment and function description
>sp|O35244|PRDX6_RAT Peroxiredoxin-6 OS=Rattus norvegicus GN=Prdx6 PE=1 SV=3 Back     alignment and function description
>sp|O17433|1CPX_DIRIM 1-Cys peroxiredoxin OS=Dirofilaria immitis PE=2 SV=1 Back     alignment and function description
>sp|O08709|PRDX6_MOUSE Peroxiredoxin-6 OS=Mus musculus GN=Prdx6 PE=1 SV=3 Back     alignment and function description
>sp|Q5R7E0|PRDX6_PONAB Peroxiredoxin-6 OS=Pongo abelii GN=PRDX6 PE=2 SV=3 Back     alignment and function description
>sp|P52570|TSA_ONCVO Putative peroxiredoxin OS=Onchocerca volvulus GN=TSA PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query75
240848687 220 peroxiredoxin-6-like [Acyrthosiphon pisu 1.0 0.340 0.613 2e-22
307213913 220 Peroxiredoxin-6 [Harpegnathos saltator] 1.0 0.340 0.626 1e-20
242013375 198 Peroxiredoxin-6, putative [Pediculus hum 1.0 0.378 0.6 3e-20
195383650 220 GJ20147 [Drosophila virilis] gi|19414533 1.0 0.340 0.613 3e-20
359843252147 peroxiredoxin, partial [Schistocerca gre 0.92 0.469 0.637 4e-20
350401799 220 PREDICTED: peroxiredoxin-6-like [Bombus 1.0 0.340 0.586 7e-20
60300018 220 peroxiredoxin [Gryllotalpa orientalis] 1.0 0.340 0.586 7e-20
195442250 220 GK18009 [Drosophila willistoni] gi|19416 1.0 0.340 0.6 8e-20
195442248 220 GK17795 [Drosophila willistoni] gi|19416 1.0 0.340 0.6 1e-19
332024226 220 Peroxiredoxin-6 [Acromyrmex echinatior] 1.0 0.340 0.586 2e-19
>gi|240848687|ref|NP_001155826.1| peroxiredoxin-6-like [Acyrthosiphon pisum] gi|239788954|dbj|BAH71128.1| ACYPI009972 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  109 bits (273), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 67/75 (89%)

Query: 1   MSDIKNYCLDIKGDFPFAIIGDENRDLAVKLDLLDEENKNNLETAITVRAVYIIGPDRKL 60
           ++DIK+YCLDIKG+FP+ II D  RDLAV+LD++ EE+K+N+E A+T+R++YIIGPD+K+
Sbjct: 79  INDIKSYCLDIKGEFPYPIISDSTRDLAVQLDMISEEDKDNVELALTIRSLYIIGPDKKV 138

Query: 61  KLSIVYPASTGRSVE 75
           KL +VYP STGR+++
Sbjct: 139 KLMMVYPTSTGRNIQ 153

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|307213913|gb|EFN89160.1| Peroxiredoxin-6 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|242013375|ref|XP_002427383.1| Peroxiredoxin-6, putative [Pediculus humanus corporis] gi|212511757|gb|EEB14645.1| Peroxiredoxin-6, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|195383650|ref|XP_002050539.1| GJ20147 [Drosophila virilis] gi|194145336|gb|EDW61732.1| GJ20147 [Drosophila virilis] Back     alignment and taxonomy information
>gi|359843252|gb|AEV89761.1| peroxiredoxin, partial [Schistocerca gregaria] Back     alignment and taxonomy information
>gi|350401799|ref|XP_003486265.1| PREDICTED: peroxiredoxin-6-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|60300018|gb|AAX18657.1| peroxiredoxin [Gryllotalpa orientalis] Back     alignment and taxonomy information
>gi|195442250|ref|XP_002068871.1| GK18009 [Drosophila willistoni] gi|194164956|gb|EDW79857.1| GK18009 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|195442248|ref|XP_002068870.1| GK17795 [Drosophila willistoni] gi|194164955|gb|EDW79856.1| GK17795 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|332024226|gb|EGI64430.1| Peroxiredoxin-6 [Acromyrmex echinatior] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query75
FB|FBgn0033521220 CG12896 [Drosophila melanogast 1.0 0.340 0.493 4.2e-15
FB|FBgn0033520220 Prx2540-1 "Peroxiredoxin 2540- 1.0 0.340 0.493 4.2e-15
FB|FBgn0033518220 Prx2540-2 "Peroxiredoxin 2540- 1.0 0.340 0.493 4.2e-15
UNIPROTKB|P30041224 PRDX6 "Peroxiredoxin-6" [Homo 0.973 0.325 0.418 1.5e-10
UNIPROTKB|Q2PFL9224 PRDX6 "Peroxiredoxin-6" [Macac 0.973 0.325 0.418 1.5e-10
UNIPROTKB|O77834224 PRDX6 "Peroxiredoxin-6" [Bos t 0.8 0.267 0.483 2e-10
UNIPROTKB|F1PC59221 PRDX6 "Uncharacterized protein 0.8 0.271 0.483 2e-10
UNIPROTKB|Q9TSX9224 PRDX6 "Peroxiredoxin-6" [Sus s 0.853 0.285 0.453 4.1e-10
RGD|71005224 Prdx6 "peroxiredoxin 6" [Rattu 0.8 0.267 0.466 6.6e-10
UNIPROTKB|Q5R7E0224 PRDX6 "Peroxiredoxin-6" [Pongo 0.973 0.325 0.418 8.4e-10
FB|FBgn0033521 CG12896 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 191 (72.3 bits), Expect = 4.2e-15, P = 4.2e-15
 Identities = 37/75 (49%), Positives = 49/75 (65%)

Query:     1 MSDIKNYCLDIKGDFPFAIIGDENRDLAVXXXXXXXXXXXXXXTAITVRAVYIIGPDRKL 60
             ++DIK+YCLDI GDFP+ II D  RDLAV                 T+RA++II PD K+
Sbjct:    79 VNDIKSYCLDIPGDFPYPIIADPTRDLAVTLGMLDEEQKKDPEVGKTIRALFIISPDHKV 138

Query:    61 KLSIVYPASTGRSVE 75
             +LS+ YP STGR+V+
Sbjct:   139 RLSMFYPMSTGRNVD 153
GO:0007498 "mesoderm development" evidence=IEP
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0016209 "antioxidant activity" evidence=IEA
GO:0051920 "peroxiredoxin activity" evidence=IEA
FB|FBgn0033520 Prx2540-1 "Peroxiredoxin 2540-1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0033518 Prx2540-2 "Peroxiredoxin 2540-2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|P30041 PRDX6 "Peroxiredoxin-6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q2PFL9 PRDX6 "Peroxiredoxin-6" [Macaca fascicularis (taxid:9541)] Back     alignment and assigned GO terms
UNIPROTKB|O77834 PRDX6 "Peroxiredoxin-6" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PC59 PRDX6 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9TSX9 PRDX6 "Peroxiredoxin-6" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|71005 Prdx6 "peroxiredoxin 6" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q5R7E0 PRDX6 "Peroxiredoxin-6" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O08709PRDX6_MOUSE1, ., 1, 1, ., 1, ., 90.52450.81330.2723yesN/A
O35244PRDX6_RAT1, ., 1, 1, ., 1, ., 90.52450.81330.2723yesN/A
Q9TSX9PRDX6_PIG1, ., 1, 1, ., 1, ., 90.51560.85330.2857yesN/A
Q5ZJF4PRDX6_CHICK1, ., 1, 1, ., 1, ., 1, 50.52450.81330.2723yesN/A
O77834PRDX6_BOVIN1, ., 1, 1, ., 1, ., 90.54090.81330.2723yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query75
cd03016203 cd03016, PRX_1cys, Peroxiredoxin (PRX) family, 1-c 1e-22
COG0450194 COG0450, AhpC, Peroxiredoxin [Posttranslational mo 1e-11
PRK13190202 PRK13190, PRK13190, putative peroxiredoxin; Provis 1e-10
cd02971140 cd02971, PRX_family, Peroxiredoxin (PRX) family; c 2e-09
PRK13189222 PRK13189, PRK13189, peroxiredoxin; Provisional 7e-09
PRK13191215 PRK13191, PRK13191, putative peroxiredoxin; Provis 1e-06
cd03015173 cd03015, PRX_Typ2cys, Peroxiredoxin (PRX) family, 5e-04
PRK13599215 PRK13599, PRK13599, putative peroxiredoxin; Provis 0.002
>gnl|CDD|239314 cd03016, PRX_1cys, Peroxiredoxin (PRX) family, 1-cys PRX subfamily; composed of PRXs containing only one conserved cysteine, which serves as the peroxidatic cysteine Back     alignment and domain information 
 Score = 84.9 bits (211), Expect = 1e-22
 Identities = 30/73 (41%), Positives = 47/73 (64%), Gaps = 7/73 (9%)

Query: 3   DIKNYCLDIKGDFPFAIIGDENRDLAVKLDLLDEENKNNLETAITVRAVYIIGPDRKLKL 62
           DI+ Y      + PF II D +R++A  L ++D +  + L    TVRAV+II PD+K++L
Sbjct: 79  DIEEYT---GVEIPFPIIADPDREVAKLLGMIDPDAGSTL----TVRAVFIIDPDKKIRL 131

Query: 63  SIVYPASTGRSVE 75
            + YPA+TGR+ +
Sbjct: 132 ILYYPATTGRNFD 144

They are homodimeric thiol-specific antioxidant (TSA) proteins that confer a protective role in cells by reducing and detoxifying hydrogen peroxide, peroxynitrite, and organic hydroperoxides. As with all other PRXs, a cysteine sulfenic acid intermediate is formed upon reaction of 1-cys PRX with its substrates. Having no resolving cysteine, the oxidized enzyme is resolved by an external small-molecule or protein reductant such as thioredoxin or glutaredoxin. Similar to typical 2-cys PRX, 1-cys PRX forms a functional dimeric unit with a B-type interface, as well as a decameric structure which is stabilized in the reduced form of the enzyme. Other oligomeric forms, tetramers and hexamers, have also been reported. Mammalian 1-cys PRX is localized cellularly in the cytosol and is expressed at high levels in brain, eye, testes and lung. The seed-specific plant 1-cys PRXs protect tissues from reactive oxygen species during desiccation and are also called rehydrins. Length = 203
>gnl|CDD|223527 COG0450, AhpC, Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|106159 PRK13190, PRK13190, putative peroxiredoxin; Provisional Back     alignment and domain information
>gnl|CDD|239269 cd02971, PRX_family, Peroxiredoxin (PRX) family; composed of the different classes of PRXs including many proteins originally known as bacterioferritin comigratory proteins (BCP), based on their electrophoretic mobility before their function was identified Back     alignment and domain information
>gnl|CDD|237297 PRK13189, PRK13189, peroxiredoxin; Provisional Back     alignment and domain information
>gnl|CDD|183885 PRK13191, PRK13191, putative peroxiredoxin; Provisional Back     alignment and domain information
>gnl|CDD|239313 cd03015, PRX_Typ2cys, Peroxiredoxin (PRX) family, Typical 2-Cys PRX subfamily; PRXs are thiol-specific antioxidant (TSA) proteins, which confer a protective role in cells through its peroxidase activity by reducing hydrogen peroxide, peroxynitrite, and organic hydroperoxides Back     alignment and domain information
>gnl|CDD|106544 PRK13599, PRK13599, putative peroxiredoxin; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 75
COG0450194 AhpC Peroxiredoxin [Posttranslational modification 99.82
KOG0854|consensus224 99.79
COG1225157 Bcp Peroxiredoxin [Posttranslational modification, 99.79
KOG0852|consensus196 99.66
PRK13191215 putative peroxiredoxin; Provisional 99.65
PRK10382187 alkyl hydroperoxide reductase subunit C; Provision 99.64
PRK13599215 putative peroxiredoxin; Provisional 99.63
cd03016203 PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX sub 99.6
PRK13189222 peroxiredoxin; Provisional 99.59
PRK15000200 peroxidase; Provisional 99.59
PRK13190202 putative peroxiredoxin; Provisional 99.58
PTZ00137261 2-Cys peroxiredoxin; Provisional 99.58
PTZ00253199 tryparedoxin peroxidase; Provisional 99.51
cd03013155 PRX5_like Peroxiredoxin (PRX) family, PRX5-like su 99.47
TIGR03137187 AhpC peroxiredoxin. This gene contains two invaria 99.35
PRK00522167 tpx lipid hydroperoxide peroxidase; Provisional 99.12
PRK09437154 bcp thioredoxin-dependent thiol peroxidase; Review 99.09
cd03018149 PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-lik 99.09
cd03015173 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2- 99.08
cd03014143 PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical 99.07
cd03017140 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferrit 99.06
cd02970149 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypot 99.02
PF00578124 AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Per 98.97
cd02971140 PRX_family Peroxiredoxin (PRX) family; composed of 98.89
cd03012126 TlpA_like_DipZ_like TlpA-like family, DipZ-like su 98.88
cd02969171 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypot 98.68
cd02968142 SCO SCO (an acronym for Synthesis of Cytochrome c 98.43
PRK15412185 thiol:disulfide interchange protein DsbE; Provisio 98.43
PLN02412167 probable glutathione peroxidase 98.4
cd03010127 TlpA_like_DsbE TlpA-like family, DsbE (also known 98.38
PF08534146 Redoxin: Redoxin; InterPro: IPR013740 This redoxin 98.37
KOG0855|consensus211 98.36
TIGR00385173 dsbE periplasmic protein thiol:disulfide oxidoredu 98.35
TIGR02540153 gpx7 putative glutathione peroxidase Gpx7. This mo 98.35
cd00340152 GSH_Peroxidase Glutathione (GSH) peroxidase family 98.26
PRK03147173 thiol-disulfide oxidoreductase; Provisional 98.14
cd02966116 TlpA_like_family TlpA-like family; composed of Tlp 98.07
cd03011123 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppresso 98.06
TIGR01626184 ytfJ_HI0045 conserved hypothetical protein YtfJ-fa 98.06
PTZ00256183 glutathione peroxidase; Provisional 97.97
COG2077158 Tpx Peroxiredoxin [Posttranslational modification, 97.82
PF13911115 AhpC-TSA_2: AhpC/TSA antioxidant enzyme 97.71
cd02967114 mauD Methylamine utilization (mau) D family; mauD 97.63
cd03008146 TryX_like_RdCVF Tryparedoxin (TryX)-like family, R 97.58
PLN02399236 phospholipid hydroperoxide glutathione peroxidase 97.47
TIGR02661189 MauD methylamine dehydrogenase accessory protein M 97.44
PTZ00056199 glutathione peroxidase; Provisional 97.37
PRK14018 521 trifunctional thioredoxin/methionine sulfoxide red 96.9
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 96.87
cd03009131 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family 96.75
PRK13728181 conjugal transfer protein TrbB; Provisional 96.5
PF1390595 Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_ 95.52
cd02964132 TryX_like_family Tryparedoxin (TryX)-like family; 95.47
PF09695160 YtfJ_HI0045: Bacterial protein of unknown function 93.26
PF02630174 SCO1-SenC: SCO1/SenC; InterPro: IPR003782 This fam 90.89
COG0678165 AHP1 Peroxiredoxin [Posttranslational modification 90.88
TIGR02738153 TrbB type-F conjugative transfer system pilin asse 88.55
cd02950142 TxlA TRX-like protein A (TxlA) family; TxlA was or 87.15
TIGR02740271 TraF-like TraF-like protein. This protein is relat 83.32
cd02951125 SoxW SoxW family; SoxW is a bacterial periplasmic 83.29
KOG0541|consensus171 82.5
PF13098112 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_ 82.09
PF05176252 ATP-synt_10: ATP10 protein; InterPro: IPR007849 Th 81.88
COG3054184 Predicted transcriptional regulator [General funct 81.29
>COG0450 AhpC Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=99.82  E-value=1.4e-20  Score=125.13  Aligned_cols=67  Identities=28%  Similarity=0.543  Sum_probs=57.3

Q ss_pred             hhhhhhcCC-----CCCCceeEEecCchHHHHHcCCccccccCCcccCccceeEEEECCCCcEEEEEEcCCCCCCCCC
Q psy13814          3 DIKNYCLDI-----KGDFPFAIIGDENRDLAVKLDLLDEENKNNLETAITVRAVYIIGPDRKLKLSIVYPASTGRSVE   75 (75)
Q Consensus         3 ~~~~~~~~~-----k~~l~fpLlsD~~~~i~~~yGv~~~~~~~~~~~~~~~R~tFiId~dG~I~~~~~~~~~~GRn~~   75 (75)
                      .|++|...+     -.+++|||+||++++||++|||+.++.+      .+.|+||||||+|+||++.+||.++|||++
T Consensus        80 sH~aW~~~~~~~~gi~~i~~PmiaD~~~~vs~~ygvl~~~~g------~a~R~~FIIDp~g~ir~~~v~~~~iGRn~d  151 (194)
T COG0450          80 SHKAWKATIREAGGIGKIKFPMIADPKGEIARAYGVLHPEEG------LALRGTFIIDPDGVIRHILVNPLTIGRNVD  151 (194)
T ss_pred             HHHHHHhcHHhcCCccceecceEEcCchhHHHHcCCcccCCC------cceeEEEEECCCCeEEEEEEecCCCCcCHH
Confidence            355665532     1348999999999999999999998654      699999999999999999999999999974

>KOG0854|consensus Back     alignment and domain information
>COG1225 Bcp Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0852|consensus Back     alignment and domain information
>PRK13191 putative peroxiredoxin; Provisional Back     alignment and domain information
>PRK10382 alkyl hydroperoxide reductase subunit C; Provisional Back     alignment and domain information
>PRK13599 putative peroxiredoxin; Provisional Back     alignment and domain information
>cd03016 PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX subfamily; composed of PRXs containing only one conserved cysteine, which serves as the peroxidatic cysteine Back     alignment and domain information
>PRK13189 peroxiredoxin; Provisional Back     alignment and domain information
>PRK15000 peroxidase; Provisional Back     alignment and domain information
>PRK13190 putative peroxiredoxin; Provisional Back     alignment and domain information
>PTZ00137 2-Cys peroxiredoxin; Provisional Back     alignment and domain information
>PTZ00253 tryparedoxin peroxidase; Provisional Back     alignment and domain information
>cd03013 PRX5_like Peroxiredoxin (PRX) family, PRX5-like subfamily; members are similar to the human protein, PRX5, a homodimeric TRX peroxidase, widely expressed in tissues and found cellularly in mitochondria, peroxisomes and the cytosol Back     alignment and domain information
>TIGR03137 AhpC peroxiredoxin Back     alignment and domain information
>PRK00522 tpx lipid hydroperoxide peroxidase; Provisional Back     alignment and domain information
>PRK09437 bcp thioredoxin-dependent thiol peroxidase; Reviewed Back     alignment and domain information
>cd03018 PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-like subfamily; composed of proteins similar to Mycobacterium tuberculosis AhpE Back     alignment and domain information
>cd03015 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2-Cys PRX subfamily; PRXs are thiol-specific antioxidant (TSA) proteins, which confer a protective role in cells through its peroxidase activity by reducing hydrogen peroxide, peroxynitrite, and organic hydroperoxides Back     alignment and domain information
>cd03014 PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical 2-cys PRX subfamily; composed of PRXs containing peroxidatic and resolving cysteines, similar to the homodimeric thiol specific antioxidant (TSA) protein also known as TRX-dependent thiol peroxidase (Tpx) Back     alignment and domain information
>cd03017 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferritin comigratory protein (BCP) subfamily; composed of thioredoxin-dependent thiol peroxidases, widely expressed in pathogenic bacteria, that protect cells against toxicity from reactive oxygen species by reducing and detoxifying hydroperoxides Back     alignment and domain information
>cd02970 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypothetical proteins that show sequence similarity to PRXs Back     alignment and domain information
>PF00578 AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Peroxiredoxins (Prxs) are a ubiquitous family of antioxidant enzymes that also control cytokine-induced peroxide levels which mediate signal transduction in mammalian cells Back     alignment and domain information
>cd02971 PRX_family Peroxiredoxin (PRX) family; composed of the different classes of PRXs including many proteins originally known as bacterioferritin comigratory proteins (BCP), based on their electrophoretic mobility before their function was identified Back     alignment and domain information
>cd03012 TlpA_like_DipZ_like TlpA-like family, DipZ-like subfamily; composed uncharacterized proteins containing a TlpA-like TRX domain Back     alignment and domain information
>cd02969 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypothetical proteins that show sequence similarity to PRXs Back     alignment and domain information
>cd02968 SCO SCO (an acronym for Synthesis of Cytochrome c Oxidase) family; composed of proteins similar to Sco1, a membrane-anchored protein possessing a soluble domain with a TRX fold Back     alignment and domain information
>PRK15412 thiol:disulfide interchange protein DsbE; Provisional Back     alignment and domain information
>PLN02412 probable glutathione peroxidase Back     alignment and domain information
>cd03010 TlpA_like_DsbE TlpA-like family, DsbE (also known as CcmG and CycY) subfamily; DsbE is a membrane-anchored, periplasmic TRX-like reductase containing a CXXC motif that specifically donates reducing equivalents to apocytochrome c via CcmH, another cytochrome c maturation (Ccm) factor with a redox active CXXC motif Back     alignment and domain information
>PF08534 Redoxin: Redoxin; InterPro: IPR013740 This redoxin domain is found in peroxiredoxin, thioredoxin and glutaredoxin proteins Back     alignment and domain information
>KOG0855|consensus Back     alignment and domain information
>TIGR00385 dsbE periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily Back     alignment and domain information
>TIGR02540 gpx7 putative glutathione peroxidase Gpx7 Back     alignment and domain information
>cd00340 GSH_Peroxidase Glutathione (GSH) peroxidase family; tetrameric selenoenzymes that catalyze the reduction of a variety of hydroperoxides including lipid peroxidases, using GSH as a specific electron donor substrate Back     alignment and domain information
>PRK03147 thiol-disulfide oxidoreductase; Provisional Back     alignment and domain information
>cd02966 TlpA_like_family TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins Back     alignment and domain information
>cd03011 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppressor for copper sensitivity D protein (ScsD) and actinobacterial DsbE homolog subfamily; composed of ScsD, the DsbE homolog of Mycobacterium tuberculosis (MtbDsbE) and similar proteins, all containing a redox-active CXXC motif Back     alignment and domain information
>TIGR01626 ytfJ_HI0045 conserved hypothetical protein YtfJ-family, TIGR01626 Back     alignment and domain information
>PTZ00256 glutathione peroxidase; Provisional Back     alignment and domain information
>COG2077 Tpx Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13911 AhpC-TSA_2: AhpC/TSA antioxidant enzyme Back     alignment and domain information
>cd02967 mauD Methylamine utilization (mau) D family; mauD protein is the translation product of the mauD gene found in methylotrophic bacteria, which are able to use methylamine as a sole carbon source and a nitrogen source Back     alignment and domain information
>cd03008 TryX_like_RdCVF Tryparedoxin (TryX)-like family, Rod-derived cone viability factor (RdCVF) subfamily; RdCVF is a thioredoxin (TRX)-like protein specifically expressed in photoreceptors Back     alignment and domain information
>PLN02399 phospholipid hydroperoxide glutathione peroxidase Back     alignment and domain information
>TIGR02661 MauD methylamine dehydrogenase accessory protein MauD Back     alignment and domain information
>PTZ00056 glutathione peroxidase; Provisional Back     alignment and domain information
>PRK14018 trifunctional thioredoxin/methionine sulfoxide reductase A/B protein; Provisional Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>cd03009 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family, TryX and nucleoredoxin (NRX) subfamily; TryX and NRX are thioredoxin (TRX)-like protein disulfide oxidoreductases that alter the redox state of target proteins via the reversible oxidation of an active center CXXC motif Back     alignment and domain information
>PRK13728 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>PF13905 Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_A 1OC8_B 1O6J_A 1OC9_B 1O81_A 3FKF_A 1O85_A 1O7U_A 1O8W_A Back     alignment and domain information
>cd02964 TryX_like_family Tryparedoxin (TryX)-like family; composed of TryX and related proteins including nucleoredoxin (NRX), rod-derived cone viability factor (RdCVF) and the nematode homolog described as a 16-kD class of TRX Back     alignment and domain information
>PF09695 YtfJ_HI0045: Bacterial protein of unknown function (YtfJ_HI0045); InterPro: IPR006513 These are sequences from gammaproteobacteria that are related to the Escherichia coli protein, YtfJ Back     alignment and domain information
>PF02630 SCO1-SenC: SCO1/SenC; InterPro: IPR003782 This family is involved in biogenesis of respiratory and photosynthetic systems Back     alignment and domain information
>COG0678 AHP1 Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02738 TrbB type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB Back     alignment and domain information
>cd02950 TxlA TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus Back     alignment and domain information
>TIGR02740 TraF-like TraF-like protein Back     alignment and domain information
>cd02951 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, containing a redox active CXXC motif, encoded by a genetic locus (sox operon) involved in thiosulfate oxidation Back     alignment and domain information
>KOG0541|consensus Back     alignment and domain information
>PF13098 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_A 2L57_A 1EEJ_B 1TJD_A 1JZD_B 1JZO_A 1G0T_B 3GV1_A 1V58_A 2H0H_A Back     alignment and domain information
>PF05176 ATP-synt_10: ATP10 protein; InterPro: IPR007849 This entry represents the ATPase assembly factor ATP10 found in mitochondria, which is essential for the assembly of the mitochondrial F1-F0 complex Back     alignment and domain information
>COG3054 Predicted transcriptional regulator [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query75
2v2g_A233 Crystal Structure Of The C45s Mutant Of The Peroxir 1e-13
1prx_A224 Horf6 A Novel Human Peroxidase Enzyme Length = 224 6e-10
3tb2_A220 1-Cys Peroxidoxin From Plasmodium Yoelli Length = 2 7e-06
1xcc_A220 1-Cys Peroxidoxin From Plasmodium Yoelli Length = 2 7e-06
>pdb|2V2G|A Chain A, Crystal Structure Of The C45s Mutant Of The Peroxiredoxin 6 Of Arenicola Marina. Monoclinic Form Length = 233 Back     alignment and structure 
Iteration: 1

 Score = 71.2 bits (173), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 37/72 (51%), Positives = 47/72 (65%), Gaps = 3/72 (4%)
Query: 3   DIKNYCLD-IKGDFPFAIIGDENRDLAVXXXXXXXXXXXXXXTAITVRAVYIIGPDRKLK 61
           D+K  CL  +KGD P+ II DE R+LAV                +T RAV+IIGPD+KLK
Sbjct: 83  DVK--CLSGVKGDMPYPIIADETRELAVKLGMVDPDERTSTGMPLTCRAVFIIGPDKKLK 140
Query: 62  LSIVYPASTGRS 73
           LSI+YPA+TGR+
Sbjct: 141 LSILYPATTGRN 152
>pdb|1PRX|A Chain A, Horf6 A Novel Human Peroxidase Enzyme Length = 224 Back     alignment and structure
>pdb|3TB2|A Chain A, 1-Cys Peroxidoxin From Plasmodium Yoelli Length = 220 Back     alignment and structure
>pdb|1XCC|A Chain A, 1-Cys Peroxidoxin From Plasmodium Yoelli Length = 220 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query75
2v2g_A233 Peroxiredoxin 6; oxidoreductase, antioxidant enzym 7e-26
1prx_A224 HORF6; peroxiredoxin, hydrogen peroxide, redox reg 1e-24
1xcc_A220 1-Cys peroxiredoxin; unknown function, structural 9e-24
3a2v_A249 Probable peroxiredoxin; thioredoxin peroxidase, hy 7e-20
1zof_A198 Alkyl hydroperoxide-reductase; decamer, toroide-sh 2e-06
2i81_A213 2-Cys peroxiredoxin; structural genomics consortiu 3e-06
2h01_A192 2-Cys peroxiredoxin; thioredoxin peroxidase, struc 8e-06
3tjj_A254 Peroxiredoxin-4; thioredoxin fold, sulfenylation, 3e-05
2bmx_A195 Alkyl hydroperoxidase C; peroxiredoxin, antioxidan 3e-05
3qpm_A240 Peroxiredoxin; oxidoreductase, thioredoxin fold, p 5e-05
2pn8_A211 Peroxiredoxin-4; thioredoxin, oxidoreductase, stru 7e-05
1n8j_A186 AHPC, alkyl hydroperoxide reductase C22 protein; p 1e-04
2c0d_A221 Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, th 2e-04
1we0_A187 Alkyl hydroperoxide reductase C; peroxiredoxin, AH 2e-04
1e2y_A188 TRYP, tryparedoxin peroxidase; 2-Cys peroxiredoxin 3e-04
3ztl_A222 Thioredoxin peroxidase; oxidoreductase, reductase, 4e-04
3sbc_A216 Peroxiredoxin TSA1; alpha-beta fold, peroxidase, c 4e-04
1uul_A202 Tryparedoxin peroxidase homologue; peroxiredoxin, 8e-04
>2v2g_A Peroxiredoxin 6; oxidoreductase, antioxidant enzymes; 1.60A {Arenicola marina} PDB: 2v32_A 2v41_A Length = 233 Back     alignment and structure
 Score = 93.8 bits (234), Expect = 7e-26
 Identities = 38/73 (52%), Positives = 53/73 (72%), Gaps = 1/73 (1%)

Query: 3   DIKNYCLDIKGDFPFAIIGDENRDLAVKLDLLDEENKNNLETAITVRAVYIIGPDRKLKL 62
           D+K     +KGD P+ II DE R+LAVKL ++D + + +    +T RAV+IIGPD+KLKL
Sbjct: 83  DVKCLS-GVKGDMPYPIIADETRELAVKLGMVDPDERTSTGMPLTCRAVFIIGPDKKLKL 141

Query: 63  SIVYPASTGRSVE 75
           SI+YPA+TGR+  
Sbjct: 142 SILYPATTGRNFS 154
>1prx_A HORF6; peroxiredoxin, hydrogen peroxide, redox regulation, cellular signaling, antioxidant; 2.00A {Homo sapiens} SCOP: c.47.1.10 Length = 224 Back     alignment and structure
>1xcc_A 1-Cys peroxiredoxin; unknown function, structural genomics, structural genomics consortium, SGC; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10 PDB: 3tb2_A Length = 220 Back     alignment and structure
>3a2v_A Probable peroxiredoxin; thioredoxin peroxidase, hydrogen peroxide, antioxidant, oxidoreductase, redox-active center; 1.65A {Aeropyrum pernix} PDB: 1x0r_A 2zct_A 2nvl_A 2e2g_A 2cv4_A* 3a5w_A 2e2m_A 3a2x_A 3a2w_A Length = 249 Back     alignment and structure
>1zof_A Alkyl hydroperoxide-reductase; decamer, toroide-shaped complex, oxidoreductase; 2.95A {Helicobacter pylori} SCOP: c.47.1.10 Length = 198 Back     alignment and structure
>2i81_A 2-Cys peroxiredoxin; structural genomics consortium, SGC, oxidoreductase; 2.45A {Plasmodium vivax sai-1} PDB: 2h66_A Length = 213 Back     alignment and structure
>2h01_A 2-Cys peroxiredoxin; thioredoxin peroxidase, structural genomics, SGC, structural genomics consortium, oxidoreductase; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10 Length = 192 Back     alignment and structure
>3tjj_A Peroxiredoxin-4; thioredoxin fold, sulfenylation, endoplasmic reticulum, oxidoreductase; HET: CSO; 1.91A {Homo sapiens} PDB: 3tjk_A 3tjb_A 3tjf_A 3tjg_A 3tkq_A 3tkp_A 3tks_A 3tkr_A 3tks_C Length = 254 Back     alignment and structure
>2bmx_A Alkyl hydroperoxidase C; peroxiredoxin, antioxidant defense system, oxidoreductase, structural proteomics in EURO spine; 2.4A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Length = 195 Back     alignment and structure
>3qpm_A Peroxiredoxin; oxidoreductase, thioredoxin fold, peroxidase; 1.90A {Larimichthys crocea} Length = 240 Back     alignment and structure
>2pn8_A Peroxiredoxin-4; thioredoxin, oxidoreductase, structural genomics consortium, SGC; 1.80A {Homo sapiens} Length = 211 Back     alignment and structure
>1n8j_A AHPC, alkyl hydroperoxide reductase C22 protein; peroxiredoxin, decamer, antioxidant, peroxidase, AHPF, oxidoreductase; 2.17A {Salmonella typhimurium} SCOP: c.47.1.10 PDB: 1yep_A 1yf1_A 1yf0_A 1yex_A 3emp_A Length = 186 Back     alignment and structure
>2c0d_A Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, thioredoxin dependant, mitochondrial, antioxidant, oxidoreductase, redox-active center; 1.78A {Plasmodium falciparum} Length = 221 Back     alignment and structure
>1we0_A Alkyl hydroperoxide reductase C; peroxiredoxin, AHPC, oxidoreductase; 2.90A {Amphibacillus xylanus} SCOP: c.47.1.10 Length = 187 Back     alignment and structure
>1e2y_A TRYP, tryparedoxin peroxidase; 2-Cys peroxiredoxin, oxidoreductase; 3.2A {Crithidia fasciculata} SCOP: c.47.1.10 Length = 188 Back     alignment and structure
>3ztl_A Thioredoxin peroxidase; oxidoreductase, reductase, schistosomiasis, thioredoxin fold; 3.00A {Schistosoma mansoni} PDB: 3zvj_A 3zvj_D Length = 222 Back     alignment and structure
>3sbc_A Peroxiredoxin TSA1; alpha-beta fold, peroxidase, cytosol, oxidoreductase; 2.80A {Saccharomyces cerevisiae} Length = 216 Back     alignment and structure
>1uul_A Tryparedoxin peroxidase homologue; peroxiredoxin, oxidoreductase; 2.8A {Trypanosoma cruzi} SCOP: c.47.1.10 Length = 202 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query75
3sbc_A216 Peroxiredoxin TSA1; alpha-beta fold, peroxidase, c 99.81
3tue_A219 Tryparedoxin peroxidase; thioredoxin fold, peroxir 99.8
4gqc_A164 Thiol peroxidase, peroxiredoxin Q; CXXXXC motif, f 99.63
3mng_A173 Peroxiredoxin-5, mitochondrial; peroxidase, PRXV, 99.58
4g2e_A157 Peroxiredoxin; redox protein, structural genomics, 99.58
1xcc_A220 1-Cys peroxiredoxin; unknown function, structural 99.57
1prx_A224 HORF6; peroxiredoxin, hydrogen peroxide, redox reg 99.55
2v2g_A233 Peroxiredoxin 6; oxidoreductase, antioxidant enzym 99.53
4eo3_A 322 Bacterioferritin comigratory protein/NADH dehydro; 99.52
2xhf_A171 Peroxiredoxin 5; oxidoreductase, antioxidant enzym 99.48
3a2v_A249 Probable peroxiredoxin; thioredoxin peroxidase, hy 99.46
4f82_A176 Thioredoxin reductase; structural genomics, niaid, 99.43
1xiy_A182 Peroxiredoxin, pfaop; alpha-aneurysm, thioredoxin 99.42
3tjj_A254 Peroxiredoxin-4; thioredoxin fold, sulfenylation, 99.35
3keb_A224 Probable thiol peroxidase; structural genomics, AP 99.33
3qpm_A240 Peroxiredoxin; oxidoreductase, thioredoxin fold, p 99.31
3uma_A184 Hypothetical peroxiredoxin protein; nysgrc, PSI bi 99.23
2pn8_A211 Peroxiredoxin-4; thioredoxin, oxidoreductase, stru 99.23
3ixr_A179 Bacterioferritin comigratory protein; alpha beta p 99.21
1n8j_A186 AHPC, alkyl hydroperoxide reductase C22 protein; p 99.2
1tp9_A162 Peroxiredoxin, PRX D (type II); oligomer, thioredo 99.18
2wfc_A167 Peroxiredoxin 5, PRDX5; oxidoreductase, antioxidan 99.16
2i81_A213 2-Cys peroxiredoxin; structural genomics consortiu 99.16
2pwj_A171 Mitochondrial peroxiredoxin; alpha and beta protei 99.15
3gkn_A163 Bacterioferritin comigratory protein; BCP, PRX, at 99.14
3p7x_A166 Probable thiol peroxidase; thioredoxin fold, oxido 99.14
1uul_A202 Tryparedoxin peroxidase homologue; peroxiredoxin, 99.13
1zye_A220 Thioredoxin-dependent peroxide reductase; catenane 99.13
2c0d_A221 Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, th 99.12
1qmv_A197 Human thioredoxin peroxidase-B; peroxiredoxin, sul 99.1
1nm3_A241 Protein HI0572; hybrid, peroxiredoxin, glutaredoxi 99.09
2h01_A192 2-Cys peroxiredoxin; thioredoxin peroxidase, struc 99.04
1psq_A163 Probable thiol peroxidase; structural genomics, NY 99.02
3zrd_A200 Thiol peroxidase; oxidoreductase, 2Cys peroxiredox 99.01
1q98_A165 Thiol peroxidase, TPX; structural genomics, NYSGXR 98.97
1we0_A187 Alkyl hydroperoxide reductase C; peroxiredoxin, AH 98.95
3ztl_A222 Thioredoxin peroxidase; oxidoreductase, reductase, 98.94
3drn_A161 Peroxiredoxin, bacterioferritin comigratory prote 98.88
2yzh_A171 Probable thiol peroxidase; redox protein, antioxid 98.86
2jsy_A167 Probable thiol peroxidase; solution structure, ant 98.81
1xvw_A160 Hypothetical protein RV2238C/MT2298; thioredoxin f 98.8
1xvq_A175 Thiol peroxidase; thioredoxin fold, structural gen 98.74
1zof_A198 Alkyl hydroperoxide-reductase; decamer, toroide-sh 98.74
2bmx_A195 Alkyl hydroperoxidase C; peroxiredoxin, antioxidan 98.74
2a4v_A159 Peroxiredoxin DOT5; yeast nuclear thiol peroxidase 98.73
3u5r_E218 Uncharacterized protein; structural genomics, PSI- 98.5
3eyt_A158 Uncharacterized protein SPOA0173; thioredoxin-like 98.48
3lor_A160 Thiol-disulfide isomerase and thioredoxins; PSI, M 98.47
3hdc_A158 Thioredoxin family protein; ATCC53774, DSM 7210, , 98.45
4evm_A138 Thioredoxin family protein; structural genomics, n 98.43
3erw_A145 Sporulation thiol-disulfide oxidoreductase A; thio 98.43
3fw2_A150 Thiol-disulfide oxidoreductase; structural genomic 98.39
3gl3_A152 Putative thiol:disulfide interchange protein DSBE; 98.38
3kcm_A154 Thioredoxin family protein; SGX, thioredoxin prote 98.37
2f9s_A151 Thiol-disulfide oxidoreductase RESA; thioredoxin-l 98.34
2cvb_A188 Probable thiol-disulfide isomerase/thioredoxin; re 98.34
2b5x_A148 YKUV protein, TRXY; thioredoxin-like, oxidoreducta 98.33
3kh7_A176 Thiol:disulfide interchange protein DSBE; TRX-like 98.29
2lrn_A152 Thiol:disulfide interchange protein; structural ge 98.26
2ywi_A196 Hypothetical conserved protein; uncharacterized co 98.26
3lwa_A183 Secreted thiol-disulfide isomerase; thioredoxin, P 98.26
1lu4_A136 Soluble secreted antigen MPT53; thioredoxin-like f 98.24
4h86_A199 Peroxiredoxin type-2; oxidoreductase; 2.00A {Sacch 98.23
3ia1_A154 THIO-disulfide isomerase/thioredoxin; oxidoreducta 98.23
3ewl_A142 Uncharacterized conserved protein BF1870; alpha-be 98.2
2ggt_A164 SCO1 protein homolog, mitochondrial; copper chaper 98.2
1jfu_A186 Thiol:disulfide interchange protein TLPA; thioredo 98.19
1xzo_A174 BSSCO, hypothetical protein YPMQ; thioredoxin-like 98.19
2l5o_A153 Putative thioredoxin; structural genomics, unknown 98.16
2rli_A171 SCO2 protein homolog, mitochondrial; copper protei 98.13
2h30_A164 Thioredoxin, peptide methionine sulfoxide reductas 98.13
3fkf_A148 Thiol-disulfide oxidoreductase; structural genomic 98.12
3raz_A151 Thioredoxin-related protein; structural genomics, 98.1
1zzo_A136 RV1677; thioredoxin fold, structural genomics, PSI 98.09
2b1k_A168 Thiol:disulfide interchange protein DSBE; C-termin 98.09
1kng_A156 Thiol:disulfide interchange protein CYCY; thioredo 98.05
3hcz_A148 Possible thiol-disulfide isomerase; APC61559.2, cy 98.04
4fo5_A143 Thioredoxin-like protein; AHPC/TSA family protein, 98.03
2k6v_A172 Putative cytochrome C oxidase assembly protein; th 98.02
2hyx_A 352 Protein DIPZ; thioredoxin fold, jelly-roll, struct 98.01
2lrt_A152 Uncharacterized protein; structural genomics, thio 97.99
3ha9_A165 Uncharacterized thioredoxin-like protein; PSI, MCS 97.99
2ls5_A159 Uncharacterized protein; structural genomics, unkn 97.17
3or5_A165 Thiol:disulfide interchange protein, thioredoxin p 97.9
3eur_A142 Uncharacterized protein; PSI2,MCSG, conserved prot 97.83
3cmi_A171 Peroxiredoxin HYR1; thioredoxin-like fold, oxidore 97.79
2b7k_A200 SCO1 protein; metallochaperone, cytochrome C oxida 97.71
2gs3_A185 PHGPX, GPX-4, phospholipid hydroperoxide glutathio 97.65
2obi_A183 PHGPX, GPX-4, phospholipid hydroperoxide glutathio 97.64
3me7_A170 Putative uncharacterized protein; electron transfe 97.61
2lja_A152 Putative thiol-disulfide oxidoreductase; structura 97.5
2v1m_A169 Glutathione peroxidase; selenium, selenocysteine, 97.47
2lus_A143 Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carci 96.51
2r37_A207 Glutathione peroxidase 3; plasma, structural genom 97.38
2i3y_A215 Epididymal secretory glutathione peroxidase; thior 97.34
2vup_A190 Glutathione peroxidase-like protein; oxidoreductas 97.34
3dwv_A187 Glutathione peroxidase-like protein; alpha beta, 3 97.23
2p31_A181 CL683, glutathione peroxidase 7; thioredoxin fold, 96.98
1i5g_A144 Tryparedoxin II; electron transport; HET: TS5; 1.4 96.91
2p5q_A170 Glutathione peroxidase 5; thioredoxin fold, oxidor 96.9
2f8a_A208 Glutathione peroxidase 1; thioredoxin fold, struct 96.8
1o8x_A146 Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrot 96.78
3kij_A180 Probable glutathione peroxidase 8; human PDI-perox 96.61
1o73_A144 Tryparedoxin; electron transport, trypanosomatid, 96.46
4hde_A170 SCO1/SENC family lipoprotein; structural genomics, 96.4
3s9f_A165 Tryparedoxin; thioredoxin fold, disulfide reductas 96.29
2l57_A126 Uncharacterized protein; structural genomics, unkn 95.23
2ju5_A154 Thioredoxin disulfide isomerase; protein, oxidored 94.35
2kuc_A130 Putative disulphide-isomerase; structural genomics 94.28
3fk8_A133 Disulphide isomerase; APC61824.1, xylella fastidio 93.34
2fwh_A134 Thiol:disulfide interchange protein DSBD; thioredo 90.43
2l5l_A136 Thioredoxin; structural genomics, electron transpo 88.93
1nsw_A105 Thioredoxin, TRX; thermostability, electron transp 88.36
1thx_A115 Thioredoxin, thioredoxin 2; oxido-reductase, elect 87.42
3hxs_A141 Thioredoxin, TRXP; electron transport; 2.00A {Bact 86.95
2voc_A112 Thioredoxin; electron transport, homodimer, disulf 86.3
2trx_A108 Thioredoxin; electron transport; 1.68A {Escherichi 85.38
3q6o_A244 Sulfhydryl oxidase 1; protein disulfide isomerase, 85.15
2i4a_A107 Thioredoxin; acidophIle, disulfide exchange, oxido 85.05
2yzu_A109 Thioredoxin; redox protein, electron transport, st 85.02
3ira_A173 Conserved protein; methanosarcina mazei,structural 84.92
2pu9_C111 TRX-F, thioredoxin F-type, chloroplast; protein-pr 82.65
3f9u_A172 Putative exported cytochrome C biogenesis-related; 80.81
>3sbc_A Peroxiredoxin TSA1; alpha-beta fold, peroxidase, cytosol, oxidoreductase; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
Probab=99.81  E-value=3.2e-20  Score=124.21  Aligned_cols=67  Identities=21%  Similarity=0.396  Sum_probs=57.5

Q ss_pred             hhhhhhcCC-----CCCCceeEEecCchHHHHHcCCccccccCCcccCccceeEEEECCCCcEEEEEEcCCCCCCCCC
Q psy13814          3 DIKNYCLDI-----KGDFPFAIIGDENRDLAVKLDLLDEENKNNLETAITVRAVYIIGPDRKLKLSIVYPASTGRSVE   75 (75)
Q Consensus         3 ~~~~~~~~~-----k~~l~fpLlsD~~~~i~~~yGv~~~~~~~~~~~~~~~R~tFiId~dG~I~~~~~~~~~~GRn~~   75 (75)
                      .+++|....     ..+++||||||++++++++|||+.++.+      ++.|+||||||+|+|+++++||.++|||++
T Consensus        99 sh~aw~~~~~~~~~~~~l~fpllsD~~~~vak~YGv~~~~~g------~~~R~tFiID~~G~Ir~~~v~~~~~grn~d  170 (216)
T 3sbc_A           99 SLLAWTNIPRKEGGLGPINIPLLADTNHSLSRDYGVLIEEEG------VALRGLFIIDPKGVIRHITINDLPVGRNVD  170 (216)
T ss_dssp             HHHHHHTSCGGGTCCCSCSSCEEECTTSHHHHHHTCEETTTT------EECEEEEEECTTSBEEEEEEECTTBCCCHH
T ss_pred             hHHHHHHHHHHhCCccCcccceEeCCCCHHHHHcCCeeccCC------ceeeEEEEECCCCeEEEEEEcCCCCCCCHH
Confidence            466676532     2369999999999999999999987643      789999999999999999999999999974
>3tue_A Tryparedoxin peroxidase; thioredoxin fold, peroxiredoxin, oxidoreductase; 3.00A {Leishmania major} PDB: 1e2y_A Back     alignment and structure
>4gqc_A Thiol peroxidase, peroxiredoxin Q; CXXXXC motif, fully folded, locally unfolded, peroxide, DTT, structural genomics, riken; 2.00A {Aeropyrum pernix} PDB: 2cx3_A 2cx4_A 4gqf_A Back     alignment and structure
>3mng_A Peroxiredoxin-5, mitochondrial; peroxidase, PRXV, substrate analog, DTT, oxidoreductase; 1.45A {Homo sapiens} SCOP: c.47.1.10 PDB: 2vl3_A 1oc3_A 2vl2_A 2vl9_A 1urm_A 1hd2_A 1h4o_A Back     alignment and structure
>4g2e_A Peroxiredoxin; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 1.40A {Sulfolobus tokodaii} PDB: 2ywn_A 3hjp_A Back     alignment and structure
>1xcc_A 1-Cys peroxiredoxin; unknown function, structural genomics, structural genomics consortium, SGC; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10 PDB: 3tb2_A Back     alignment and structure
>1prx_A HORF6; peroxiredoxin, hydrogen peroxide, redox regulation, cellular signaling, antioxidant; 2.00A {Homo sapiens} SCOP: c.47.1.10 Back     alignment and structure
>2v2g_A Peroxiredoxin 6; oxidoreductase, antioxidant enzymes; 1.60A {Arenicola marina} PDB: 2v32_A 2v41_A Back     alignment and structure
>4eo3_A Bacterioferritin comigratory protein/NADH dehydro; thioredoxin-fold, alpha-beta-aplha sandwich fold, antioxidan oxidoreductase, FMN binding; HET: FMN; 1.65A {Thermotoga maritima} Back     alignment and structure
>2xhf_A Peroxiredoxin 5; oxidoreductase, antioxidant enzymes; 1.30A {Alvinella pompejana} Back     alignment and structure
>3a2v_A Probable peroxiredoxin; thioredoxin peroxidase, hydrogen peroxide, antioxidant, oxidoreductase, redox-active center; 1.65A {Aeropyrum pernix} PDB: 1x0r_A 2zct_A 2nvl_A 2e2g_A 2cv4_A* 3a5w_A 2e2m_A 3a2x_A 3a2w_A Back     alignment and structure
>4f82_A Thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.85A {Burkholderia cenocepacia} Back     alignment and structure
>1xiy_A Peroxiredoxin, pfaop; alpha-aneurysm, thioredoxin fold, peroxiredoxin fold, oxidoreductase; 1.80A {Plasmodium falciparum} SCOP: c.47.1.10 Back     alignment and structure
>3tjj_A Peroxiredoxin-4; thioredoxin fold, sulfenylation, endoplasmic reticulum, oxidoreductase; HET: CSO; 1.91A {Homo sapiens} PDB: 3tjk_A 3tjb_A 3tjf_A 3tjg_A 3tkq_A 3tkp_A 3tks_A 3tkr_A 3tks_C Back     alignment and structure
>3keb_A Probable thiol peroxidase; structural genomics, APC40679, PSI-2, Pro structure initiative; HET: MSE; 1.80A {Chromobacterium violaceum} Back     alignment and structure
>3qpm_A Peroxiredoxin; oxidoreductase, thioredoxin fold, peroxidase; 1.90A {Larimichthys crocea} Back     alignment and structure
>3uma_A Hypothetical peroxiredoxin protein; nysgrc, PSI biology, structural genomics, NEW YORK structura genomics research consortium; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>2pn8_A Peroxiredoxin-4; thioredoxin, oxidoreductase, structural genomics consortium, SGC; 1.80A {Homo sapiens} Back     alignment and structure
>3ixr_A Bacterioferritin comigratory protein; alpha beta protein, oxidoreductase; 1.60A {Xylella fastidiosa} Back     alignment and structure
>1n8j_A AHPC, alkyl hydroperoxide reductase C22 protein; peroxiredoxin, decamer, antioxidant, peroxidase, AHPF, oxidoreductase; 2.17A {Salmonella typhimurium} SCOP: c.47.1.10 PDB: 1yep_A 1yf1_A 1yf0_A 1yex_A 3emp_A Back     alignment and structure
>1tp9_A Peroxiredoxin, PRX D (type II); oligomer, thioredoxin fold, oxidoreductase; 1.62A {Populus trichocarpa} SCOP: c.47.1.10 Back     alignment and structure
>2wfc_A Peroxiredoxin 5, PRDX5; oxidoreductase, antioxidant enzymes; 1.75A {Arenicola marina} Back     alignment and structure
>2i81_A 2-Cys peroxiredoxin; structural genomics consortium, SGC, oxidoreductase; 2.45A {Plasmodium vivax sai-1} PDB: 2h66_A Back     alignment and structure
>2pwj_A Mitochondrial peroxiredoxin; alpha and beta protein, oxidoreductase; 2.80A {Pisum sativum} Back     alignment and structure
>3gkn_A Bacterioferritin comigratory protein; BCP, PRX, atypical 2-Cys, oxidoreduc; HET: BIH; 1.47A {Xanthomonas campestris PV} PDB: 3gkk_A 3gkm_A Back     alignment and structure
>3p7x_A Probable thiol peroxidase; thioredoxin fold, oxidoreductase; HET: PG4; 1.96A {Staphylococcus aureus} SCOP: c.47.1.0 Back     alignment and structure
>1uul_A Tryparedoxin peroxidase homologue; peroxiredoxin, oxidoreductase; 2.8A {Trypanosoma cruzi} SCOP: c.47.1.10 Back     alignment and structure
>1zye_A Thioredoxin-dependent peroxide reductase; catenane, dodecamer, peroxiredoxin, oxidoreductase; 3.30A {Bos taurus} SCOP: c.47.1.10 Back     alignment and structure
>2c0d_A Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, thioredoxin dependant, mitochondrial, antioxidant, oxidoreductase, redox-active center; 1.78A {Plasmodium falciparum} Back     alignment and structure
>1qmv_A Human thioredoxin peroxidase-B; peroxiredoxin, sulphinic acid; 1.7A {Homo sapiens} SCOP: c.47.1.10 PDB: 1qq2_A 2z9s_A 2rii_A 3hy2_A* Back     alignment and structure
>1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 Back     alignment and structure
>2h01_A 2-Cys peroxiredoxin; thioredoxin peroxidase, structural genomics, SGC, structural genomics consortium, oxidoreductase; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10 Back     alignment and structure
>1psq_A Probable thiol peroxidase; structural genomics, NYSGXRC, PSI, structure initiative, NEW YORK SGX research center for STRU genomics; 2.30A {Streptococcus pneumoniae} SCOP: c.47.1.10 Back     alignment and structure
>3zrd_A Thiol peroxidase; oxidoreductase, 2Cys peroxiredoxin, thioredoxin-fold, ROS PR; 1.74A {Yersinia pseudotuberculosis} PDB: 2xpe_A 2xpd_A 3zre_A 2yjh_A 4af2_A 3hvs_A* 1qxh_A* 3i43_A* 3hvv_A 3hvx_A Back     alignment and structure
>1q98_A Thiol peroxidase, TPX; structural genomics, NYSGXRC, PSI, protein structure initiative; 1.90A {Haemophilus influenzae} SCOP: c.47.1.10 Back     alignment and structure
>1we0_A Alkyl hydroperoxide reductase C; peroxiredoxin, AHPC, oxidoreductase; 2.90A {Amphibacillus xylanus} SCOP: c.47.1.10 Back     alignment and structure
>3ztl_A Thioredoxin peroxidase; oxidoreductase, reductase, schistosomiasis, thioredoxin fold; 3.00A {Schistosoma mansoni} PDB: 3zvj_A 3zvj_D Back     alignment and structure
>3drn_A Peroxiredoxin, bacterioferritin comigratory prote homolog; bacterioferritin comigratory protein, oxidore; HET: CIT; 2.15A {Sulfolobus solfataricus} SCOP: c.47.1.0 Back     alignment and structure
>2yzh_A Probable thiol peroxidase; redox protein, antioxidant, oxidoreductase, STRU genomics, NPPSFA; 1.85A {Aquifex aeolicus} Back     alignment and structure
>2jsy_A Probable thiol peroxidase; solution structure, antioxidant, oxidoreductase; NMR {Bacillus subtilis} PDB: 2jsz_A Back     alignment and structure
>1xvw_A Hypothetical protein RV2238C/MT2298; thioredoxin fold, oxidized cystein sulfenic acid, structural genomics, PSI; 1.90A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1xxu_A Back     alignment and structure
>1xvq_A Thiol peroxidase; thioredoxin fold, structural genomics, PSI, protein structur initiative, TB structural genomics consortium, TBSGC; 1.75A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1y25_A Back     alignment and structure
>1zof_A Alkyl hydroperoxide-reductase; decamer, toroide-shaped complex, oxidoreductase; 2.95A {Helicobacter pylori} SCOP: c.47.1.10 Back     alignment and structure
>2bmx_A Alkyl hydroperoxidase C; peroxiredoxin, antioxidant defense system, oxidoreductase, structural proteomics in EURO spine; 2.4A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Back     alignment and structure
>2a4v_A Peroxiredoxin DOT5; yeast nuclear thiol peroxidase, atypical 2-Cys peroxiredoxin, oxidoreductase; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10 Back     alignment and structure
>3u5r_E Uncharacterized protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, hypothetical protein; 2.05A {Sinorhizobium meliloti} Back     alignment and structure
>3eyt_A Uncharacterized protein SPOA0173; thioredoxin-like superfamily protein SPOA0173, silicibacter DSS, structural genomics, PSI-2; 1.95A {Silicibacter pomeroyi} Back     alignment and structure
>3lor_A Thiol-disulfide isomerase and thioredoxins; PSI, MCSG, structural genomics, midwest CE structural genomics; HET: MSE; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>3hdc_A Thioredoxin family protein; ATCC53774, DSM 7210, , structural genomics, PSI-2, protein structure initiative; 1.77A {Geobacter metallireducens gs-15} Back     alignment and structure
>4evm_A Thioredoxin family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.51A {Streptococcus pneumoniae} Back     alignment and structure
>3erw_A Sporulation thiol-disulfide oxidoreductase A; thioredoxin-like fold, RESA-like fold, dithiol, STOA, redox-active center; 2.50A {Bacillus subtilis} SCOP: c.47.1.0 Back     alignment and structure
>3fw2_A Thiol-disulfide oxidoreductase; structural genomics, APC61456.1, thiol-disulfide oxidoreduct TLPA-like family, PSI-2; 1.74A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3gl3_A Putative thiol:disulfide interchange protein DSBE; oxidoreductase, PSI-II, structural genomics, protein structure initiative; 2.09A {Chlorobium tepidum tls} Back     alignment and structure
>3kcm_A Thioredoxin family protein; SGX, thioredoxin protein, PSI, structural genomics, protein initiative; 2.45A {Geobacter metallireducens gs-15} Back     alignment and structure
>2f9s_A Thiol-disulfide oxidoreductase RESA; thioredoxin-like protein; HET: MSE; 1.40A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1st9_A 1su9_A 2h1d_A 2h1b_A 2h1a_A 2h19_A 2h1g_A 3c71_A 3c73_A Back     alignment and structure
>2cvb_A Probable thiol-disulfide isomerase/thioredoxin; redox protein, structural genomics, riken struc genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.47.1.10 PDB: 2ywo_A Back     alignment and structure
>2b5x_A YKUV protein, TRXY; thioredoxin-like, oxidoreductase; NMR {Bacillus subtilis} SCOP: c.47.1.10 PDB: 2b5y_A Back     alignment and structure
>3kh7_A Thiol:disulfide interchange protein DSBE; TRX-like, thiol-disulfide exchange, cell inner membrane, CYT C-type biogenesis, disulfide bond; 1.75A {Pseudomonas aeruginosa} PDB: 3kh9_A Back     alignment and structure
>2lrn_A Thiol:disulfide interchange protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, oxidoreductase; NMR {Bacteroides SP} Back     alignment and structure
>2ywi_A Hypothetical conserved protein; uncharacterized conserved protein, NPPSFA, national project protein structural and functional analyses; 1.60A {Geobacillus kaustophilus} Back     alignment and structure
>3lwa_A Secreted thiol-disulfide isomerase; thioredoxin, PSI, MCSG, structural genomics, midwest center for structural genomics; 1.75A {Corynebacterium glutamicum} Back     alignment and structure
>1lu4_A Soluble secreted antigen MPT53; thioredoxin-like fold, structural genomics, PSI, protein structure initiative; 1.12A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Back     alignment and structure
>4h86_A Peroxiredoxin type-2; oxidoreductase; 2.00A {Saccharomyces cerevisiae} PDB: 4dsq_A 4dsr_A 4dss_A Back     alignment and structure
>3ia1_A THIO-disulfide isomerase/thioredoxin; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Thermus thermophilus} Back     alignment and structure
>3ewl_A Uncharacterized conserved protein BF1870; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; 2.00A {Bacteroides fragilis} Back     alignment and structure
>2ggt_A SCO1 protein homolog, mitochondrial; copper chaperone, Cu-binding protein, mitochondrial assembly factor, redox, nickel, disuplhide, mitochondrion; 2.40A {Homo sapiens} SCOP: c.47.1.10 PDB: 2gqk_A 2gql_A 2gqm_A 2gt5_A 2gt6_A 2gvp_A 2hrf_A 2hrn_A 1wp0_A Back     alignment and structure
>1jfu_A Thiol:disulfide interchange protein TLPA; thioredoxin-like, double disulfide bridge, membrane protein; 1.60A {Bradyrhizobium japonicum} SCOP: c.47.1.10 Back     alignment and structure
>1xzo_A BSSCO, hypothetical protein YPMQ; thioredoxin-like fold, structural genomics, montreal-kingsto bacterial structural genomics initiative, BSGI; 1.70A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1on4_A Back     alignment and structure
>2l5o_A Putative thioredoxin; structural genomics, unknown function, PSI-2, protein struct initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2rli_A SCO2 protein homolog, mitochondrial; copper protein, thioredoxin fold, metal transport, structural genomics, spine2-complexes; NMR {Homo sapiens} Back     alignment and structure
>2h30_A Thioredoxin, peptide methionine sulfoxide reductase MSRA/MSRB; reduced, thiol-disulfide exchange, oxidoreductase; 1.60A {Neisseria gonorrhoeae} PDB: 2jzr_A 2jzs_A 2k9f_A 2fy6_A Back     alignment and structure
>3fkf_A Thiol-disulfide oxidoreductase; structural genomics, PSI-2, structure initiative, midwest center for structural genomic oxidoreductase; 2.20A {Bacteroides fragilis} Back     alignment and structure
>3raz_A Thioredoxin-related protein; structural genomics, PSI-2, protein structure initiative; 2.00A {Neisseria meningitidis serogroup B} Back     alignment and structure
>1zzo_A RV1677; thioredoxin fold, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 1.60A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 3ios_A Back     alignment and structure
>2b1k_A Thiol:disulfide interchange protein DSBE; C-terminal thioredoxin-like domain, N-terminal beta-sheet, fingerprint rigion, oxidoreductase; 1.90A {Escherichia coli} PDB: 3k8n_A 2g0f_A 1z5y_E 2b1l_A Back     alignment and structure
>1kng_A Thiol:disulfide interchange protein CYCY; thioredoxin fold, cytochrome C maturation, atomic resolution oxidoreductase; 1.14A {Bradyrhizobium japonicum} SCOP: c.47.1.10 Back     alignment and structure
>3hcz_A Possible thiol-disulfide isomerase; APC61559.2, cytophaga hutchinsoni structural genomics, PSI-2, protein structure initiative; 1.88A {Cytophaga hutchinsonii} Back     alignment and structure
>4fo5_A Thioredoxin-like protein; AHPC/TSA family protein, structural genomics, joint center F structural genomics, JCSG; 2.02A {Parabacteroides distasonis} Back     alignment and structure
>2k6v_A Putative cytochrome C oxidase assembly protein; thioredoxin fold, electron transfer protein, metal binding protein, electron transport; NMR {Thermus thermophilus} Back     alignment and structure
>2hyx_A Protein DIPZ; thioredoxin fold, jelly-roll, structural genomics, TB struct genomics consortium, TBSGC, unknown function; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>2lrt_A Uncharacterized protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, nysgrc, PSI-biology; NMR {Bacteroides vulgatus} Back     alignment and structure
>3ha9_A Uncharacterized thioredoxin-like protein; PSI, MCSG, structural G midwest center for structural genomics, protein structure initiative; 1.70A {Aeropyrum pernix} Back     alignment and structure
>2ls5_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, NEW structural genomics research consortium; NMR {Bacteroides thetaiotaomicron} Back     alignment and structure
>3or5_A Thiol:disulfide interchange protein, thioredoxin protein; PSI-II, structural genomics, protein structure initiative; 1.66A {Chlorobaculum tepidum} SCOP: c.47.1.0 Back     alignment and structure
>3eur_A Uncharacterized protein; PSI2,MCSG, conserved protein, structural genomics, protein S initiative, midwest center for structural genomics; HET: MSE; 1.30A {Bacteroides fragilis} Back     alignment and structure
>3cmi_A Peroxiredoxin HYR1; thioredoxin-like fold, oxidoreductase, peroxidase, redox-ACT center; 2.02A {Saccharomyces cerevisiae} Back     alignment and structure
>2b7k_A SCO1 protein; metallochaperone, cytochrome C oxidase, metal binding protein; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10 PDB: 2b7j_A Back     alignment and structure
>2gs3_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase; GSHPX-4,phospholipid hydroperoxide; 1.90A {Homo sapiens} Back     alignment and structure
>2obi_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase (GPX4); human GPX4, selenoprotein, thioredoxin-fold, anti-oxidatve defense system; 1.55A {Homo sapiens} Back     alignment and structure
>3me7_A Putative uncharacterized protein; electron transfer protein, electron transport, structural GE PSI-2, protein structure initiative; 1.50A {Aquifex aeolicus} PDB: 3me8_A Back     alignment and structure
>2lja_A Putative thiol-disulfide oxidoreductase; structural genomics, unknown function, thioredoxin-like; NMR {Bacteroides vulgatus} Back     alignment and structure
>2v1m_A Glutathione peroxidase; selenium, selenocysteine, oxidoreductase, lipid peroxidase, schistosoma detoxification pathway; 1.00A {Schistosoma mansoni} PDB: 2wgr_A Back     alignment and structure
>2lus_A Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carcinoscorpius rotundicauda} Back     alignment and structure
>2r37_A Glutathione peroxidase 3; plasma, structural genomics consort oxidoreductase, secreted, selenium, selenocysteine; 1.85A {Homo sapiens} Back     alignment and structure
>2i3y_A Epididymal secretory glutathione peroxidase; thioredoxin fold, epididymal androgen related protein, struc genomics, structural genomics consortium; 2.00A {Homo sapiens} Back     alignment and structure
>2vup_A Glutathione peroxidase-like protein; oxidoreductase, trypanothione, dithiol-dependant peroxidase; 2.10A {Trypanosoma brucei} Back     alignment and structure
>3dwv_A Glutathione peroxidase-like protein; alpha beta, 3-layer(ABA) sandwich, glutaredoxin fold, oxidor peroxidase; 1.41A {Trypanosoma brucei} PDB: 2rm5_A 2rm6_A 3e0u_A Back     alignment and structure
>2p31_A CL683, glutathione peroxidase 7; thioredoxin fold, NPGPX, phospholipid hydroperoxidase, struc genomics, structural genomics consortium, SGC; 2.00A {Homo sapiens} Back     alignment and structure
>1i5g_A Tryparedoxin II; electron transport; HET: TS5; 1.40A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1o6j_A 1o81_A 1oc8_A 1oc9_B 1fg4_A 1oc9_A Back     alignment and structure
>2p5q_A Glutathione peroxidase 5; thioredoxin fold, oxidoreductase; 2.00A {Populus trichocarpa x populusdeltoides} PDB: 2p5r_A Back     alignment and structure
>2f8a_A Glutathione peroxidase 1; thioredoxin fold, structural genomics, structural genomics consortium, SGC, oxidoreductase; 1.50A {Homo sapiens} SCOP: c.47.1.10 PDB: 1gp1_A 2he3_A Back     alignment and structure
>1o8x_A Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrotron radiation, disulfide bonds tryparedoxin, thioredoxin, trypanosome; 1.3A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1okd_A 1qk8_A 1o85_A 1o8w_A 1o7u_A 1ezk_A 1ewx_A Back     alignment and structure
>3kij_A Probable glutathione peroxidase 8; human PDI-peroxidase, membrane, oxidoreductase, transmembrane; 1.80A {Homo sapiens} SCOP: c.47.1.0 PDB: 3cyn_A Back     alignment and structure
>1o73_A Tryparedoxin; electron transport, trypanosomatid, thioredoxin; 2.28A {Trypanosoma brucei brucei} SCOP: c.47.1.10 Back     alignment and structure
>4hde_A SCO1/SENC family lipoprotein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; HET: MSE; 1.32A {Bacillus anthracis} Back     alignment and structure
>3s9f_A Tryparedoxin; thioredoxin fold, disulfide reductase, electron transport; 1.80A {Leishmania major} Back     alignment and structure
>2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens} Back     alignment and structure
>2ju5_A Thioredoxin disulfide isomerase; protein, oxidoreductase; NMR {Chlamydophila pneumoniae} Back     alignment and structure
>2kuc_A Putative disulphide-isomerase; structural genomics, thioredo PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} Back     alignment and structure
>3fk8_A Disulphide isomerase; APC61824.1, xylella fastidiosa temecul structural genomics, PSI-2, protein structure initiative; 1.30A {Xylella fastidiosa} Back     alignment and structure
>2fwh_A Thiol:disulfide interchange protein DSBD; thioredoxin-like, C-terminal domain, reduced form at PH7, oxidoreductase; 0.99A {Escherichia coli} SCOP: c.47.1.1 PDB: 2fwe_A 2fwf_A 2fwg_A 1vrs_D 1uc7_A Back     alignment and structure
>2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus} Back     alignment and structure
>1nsw_A Thioredoxin, TRX; thermostability, electron transport; 1.90A {Alicyclobacillus acidocaldarius} SCOP: c.47.1.1 PDB: 1rqm_A 1quw_A 1nw2_A Back     alignment and structure
>1thx_A Thioredoxin, thioredoxin 2; oxido-reductase, electron transport; 1.60A {Nostoc SP} SCOP: c.47.1.1 Back     alignment and structure
>3hxs_A Thioredoxin, TRXP; electron transport; 2.00A {Bacteroides fragilis} PDB: 3hyp_A Back     alignment and structure
>2voc_A Thioredoxin; electron transport, homodimer, disulfide, transport, redox-active center; 1.50A {Bacillus subtilis} PDB: 2ipa_A 2gzy_A 2gzz_A Back     alignment and structure
>2trx_A Thioredoxin; electron transport; 1.68A {Escherichia coli} SCOP: c.47.1.1 PDB: 1skr_B* 1skw_B* 1sl0_B* 1sks_B* 1sl2_B* 1t7p_B* 1t8e_B* 1tk0_B* 1tk5_B* 1tk8_B* 1tkd_B* 1sl1_B* 1x9s_B* 1x9w_B* 1xoa_A 1xob_A 1zyq_B* 2ajq_B* 2bto_T* 2h6x_A ... Back     alignment and structure
>3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens} Back     alignment and structure
>2i4a_A Thioredoxin; acidophIle, disulfide exchange, oxidoreductase; 1.00A {Acetobacter aceti} Back     alignment and structure
>2yzu_A Thioredoxin; redox protein, electron transport, structural genomics; 1.90A {Thermus thermophilus} PDB: 2cvk_A Back     alignment and structure
>3ira_A Conserved protein; methanosarcina mazei,structural genomics, MCSG, protein structure initiative, midwest center for STRU genomics; 2.10A {Methanosarcina mazei} Back     alignment and structure
>2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A Back     alignment and structure
>3f9u_A Putative exported cytochrome C biogenesis-related; exported cytochrome C biogenesis-related protein, bacteroide fragilis; 2.20A {Bacteroides fragilis nctc 9343} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 75
d1uula_194 c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxi 1e-07
d1prxa_220 c.47.1.10 (A:) 1-Cys peroxiredoxin {Human (Homo sa 2e-07
d1zofa1170 c.47.1.10 (A:1-170) Thioredoxin reductase TsaA {He 4e-07
d1e2ya_167 c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxi 7e-07
d1xcca_219 c.47.1.10 (A:) 1-Cys peroxiredoxin {Plasmodium yoe 2e-06
d1qmva_197 c.47.1.10 (A:) Thioredoxin peroxidase 2 (thioredox 3e-06
d1zyea1158 c.47.1.10 (A:6-163) Peroxiredoxin-3 (AOP-1, SP-22) 8e-06
d1we0a1166 c.47.1.10 (A:1-166) Alkyl hydroperoxide reductase 2e-05
d2bmxa1169 c.47.1.10 (A:2-170) Alkyl hydroperoxide reductase 4e-05
d1hd2a_161 c.47.1.10 (A:) Peroxiredoxin 5 {Human (Homo sapien 1e-04
>d1uula_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Trypanosoma cruzi [TaxId: 5693]} Length = 194 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Thioredoxin fold
superfamily: Thioredoxin-like
family: Glutathione peroxidase-like
domain: Tryparedoxin peroxidase (thioredoxin peroxidase homologue)
species: Trypanosoma cruzi [TaxId: 5693]

 Score = 44.4 bits (104), Expect = 1e-07
 Identities = 15/63 (23%), Positives = 26/63 (41%), Gaps = 6/63 (9%)

Query: 12  KGDFPFAIIGDENRDLAVKLDLLDEENKNNLETAITVRAVYIIGPDRKLKLSIVYPASTG 71
            G     I+ D+ + +     +L EE+       +  R ++II P + L+   V     G
Sbjct: 94  LGQMNIPILADKTKCIMKSYGVLKEEDG------VAYRGLFIIDPKQNLRQITVNDLPVG 147

Query: 72  RSV 74
           R V
Sbjct: 148 RDV 150
>d1prxa_ c.47.1.10 (A:) 1-Cys peroxiredoxin {Human (Homo sapiens) [TaxId: 9606]} Length = 220 Back     information, alignment and structure
>d1zofa1 c.47.1.10 (A:1-170) Thioredoxin reductase TsaA {Helicobacter pylori [TaxId: 210]} Length = 170 Back     information, alignment and structure
>d1e2ya_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Crithidia fasciculata [TaxId: 5656]} Length = 167 Back     information, alignment and structure
>d1xcca_ c.47.1.10 (A:) 1-Cys peroxiredoxin {Plasmodium yoelii yoelii [TaxId: 73239]} Length = 219 Back     information, alignment and structure
>d1qmva_ c.47.1.10 (A:) Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) {Human (Homo sapiens) [TaxId: 9606]} Length = 197 Back     information, alignment and structure
>d1zyea1 c.47.1.10 (A:6-163) Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [TaxId: 9913]} Length = 158 Back     information, alignment and structure
>d1we0a1 c.47.1.10 (A:1-166) Alkyl hydroperoxide reductase AhpC {Amphibacillus xylanus [TaxId: 1449]} Length = 166 Back     information, alignment and structure
>d2bmxa1 c.47.1.10 (A:2-170) Alkyl hydroperoxide reductase AhpC {Mycobacterium tuberculosis [TaxId: 1773]} Length = 169 Back     information, alignment and structure
>d1hd2a_ c.47.1.10 (A:) Peroxiredoxin 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 161 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query75
d1xcca_219 1-Cys peroxiredoxin {Plasmodium yoelii yoelii [Tax 99.82
d1prxa_220 1-Cys peroxiredoxin {Human (Homo sapiens) [TaxId: 99.82
d1n8ja_186 Alkyl hydroperoxide reductase AhpC {Salmonella typ 99.75
d1uula_194 Tryparedoxin peroxidase (thioredoxin peroxidase ho 99.74
d1qmva_197 Thioredoxin peroxidase 2 (thioredoxin peroxidase B 99.74
d1we0a1166 Alkyl hydroperoxide reductase AhpC {Amphibacillus 99.73
d1zyea1158 Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [ 99.72
d2zcta1237 Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]} 99.72
d2bmxa1169 Alkyl hydroperoxide reductase AhpC {Mycobacterium 99.63
d1zofa1170 Thioredoxin reductase TsaA {Helicobacter pylori [T 99.62
d2h01a1170 Thioredoxin peroxidase 2 (thioredoxin peroxidase B 99.61
d1e2ya_167 Tryparedoxin peroxidase (thioredoxin peroxidase ho 99.53
d1hd2a_161 Peroxiredoxin 5 {Human (Homo sapiens) [TaxId: 9606 99.46
d1xvwa1153 Putative peroxiredoxin Rv2238c/MT2298 {Mycobacteri 99.43
d2cx4a1160 Bacterioferritin comigratory protein {Archaeon Aer 99.41
d1nm3a2163 N-terminal, Prx domain of Hybrid-Prx5 {Haemophilus 99.24
d1tp9a1162 Plant peroxiredoxin {Western balsam poplar(Populus 99.2
d1qxha_164 Thiol peroxidase Tpx {Escherichia coli [TaxId: 562 99.19
d2a4va1156 Peroxiredoxin dot5 {Baker's yeast (Saccharomyces c 99.11
d1q98a_164 Thiol peroxidase Tpx {Haemophilus influenzae [TaxI 99.01
d1psqa_163 Probable thiol peroxidase PsaD {Streptococcus pneu 98.9
d1xvqa_166 Thiol peroxidase Tpx {Mycobacterium tuberculosis [ 98.89
d1st9a_137 Thiol-disulfide oxidoreductase ResA {Bacillus subt 98.73
d1lu4a_134 Soluble secreted antigen MPT53 {Mycobacterium tube 98.61
d2b5xa1143 thiol:disulfide oxidoreductase YkuV {Bacillus subt 98.59
d2cvba1187 Probable thiol-disulfide isomerase/thioredoxin TTH 98.5
d1xiya1179 1-Cys peroxiredoxin {Malaria parasite (Plasmodium 98.49
d2fy6a1143 Peptide methionine sulfoxide reductase MsrA/MsrB, 98.31
d1zzoa1134 Lipoprotein DsbF {Mycobacterium tuberculosis [TaxI 98.22
d1z5ye1136 Thioredoxin-like protein CcmG (CycY, DsbE) {Escher 97.93
d1knga_144 Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyr 97.9
d1jfua_176 Membrane-anchored thioredoxin-like protein TlpA, s 97.74
d1xzoa1172 Thioredoxin-like protein Sco1 (YpmQ), soluble doma 97.12
d1wp0a1160 Thioredoxin-like protein Sco1 (YpmQ), soluble doma 96.62
d2b7ka1169 Thioredoxin-like protein Sco1 (YpmQ), soluble doma 95.97
d1i5ga_144 Tryparedoxin II {Crithidia fasciculata [TaxId: 565 95.39
d1o73a_144 Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 94.86
d1o8xa_144 Tryparedoxin I {Crithidia fasciculata [TaxId: 5656 94.57
d2fwha1117 Thiol:disulfide interchange protein DsbD, C-termin 83.4
d1ecsa_120 Bleomycin resistance protein, BRP {Klebsiella pneu 82.76
>d1xcca_ c.47.1.10 (A:) 1-Cys peroxiredoxin {Plasmodium yoelii yoelii [TaxId: 73239]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Thioredoxin fold
superfamily: Thioredoxin-like
family: Glutathione peroxidase-like
domain: 1-Cys peroxiredoxin
species: Plasmodium yoelii yoelii [TaxId: 73239]

Probab=99.82  E-value=4.8e-21  Score=126.77  Aligned_cols=64  Identities=36%  Similarity=0.716  Sum_probs=58.6

Q ss_pred             CCCCceeEEecCchHHHHHcCCccccccCCcccCccceeEEEECCCCcEEEEEEcCCCCCCCCC
Q psy13814         12 KGDFPFAIIGDENRDLAVKLDLLDEENKNNLETAITVRAVYIIGPDRKLKLSIVYPASTGRSVE   75 (75)
Q Consensus        12 k~~l~fpLlsD~~~~i~~~yGv~~~~~~~~~~~~~~~R~tFiId~dG~I~~~~~~~~~~GRn~~   75 (75)
                      .++++||||||++++++++|||+.++.+...+..++.|+||||||+|+|++++.|+.++|||++
T Consensus        91 ~~~l~fpllsD~~~~va~~ygv~~~~~~~~~~~~~~~R~tFiIDp~g~Ir~~~~~~~~~gr~~~  154 (219)
T d1xcca_          91 LNKWEIPIVCDESRELANKLKIMDEQEKDITGLPLTCRCLFFISPEKKIKATVLYPATTGRNAH  154 (219)
T ss_dssp             CSCCCCCEEECTTSHHHHHHTCEEEEEECTTSCEEECEEEEEECTTSBEEEEEEECTTBCCCHH
T ss_pred             cCCCCcccccccccHHHHHhCCcccccccCcccceeeeeeEEEcCcceEEEEEEeCCCcccCHH
Confidence            3689999999999999999999998877666667899999999999999999999999999973
>d1prxa_ c.47.1.10 (A:) 1-Cys peroxiredoxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n8ja_ c.47.1.10 (A:) Alkyl hydroperoxide reductase AhpC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1uula_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1qmva_ c.47.1.10 (A:) Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we0a1 c.47.1.10 (A:1-166) Alkyl hydroperoxide reductase AhpC {Amphibacillus xylanus [TaxId: 1449]} Back     information, alignment and structure
>d1zyea1 c.47.1.10 (A:6-163) Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2zcta1 c.47.1.10 (A:6-242) Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2bmxa1 c.47.1.10 (A:2-170) Alkyl hydroperoxide reductase AhpC {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zofa1 c.47.1.10 (A:1-170) Thioredoxin reductase TsaA {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2h01a1 c.47.1.10 (A:2-171) Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure
>d1e2ya_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1hd2a_ c.47.1.10 (A:) Peroxiredoxin 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xvwa1 c.47.1.10 (A:1-153) Putative peroxiredoxin Rv2238c/MT2298 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2cx4a1 c.47.1.10 (A:4-163) Bacterioferritin comigratory protein {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1nm3a2 c.47.1.10 (A:3-165) N-terminal, Prx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1tp9a1 c.47.1.10 (A:1-162) Plant peroxiredoxin {Western balsam poplar(Populus trichocarpa) [TaxId: 3694]} Back     information, alignment and structure
>d1qxha_ c.47.1.10 (A:) Thiol peroxidase Tpx {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a4va1 c.47.1.10 (A:59-214) Peroxiredoxin dot5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q98a_ c.47.1.10 (A:) Thiol peroxidase Tpx {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1psqa_ c.47.1.10 (A:) Probable thiol peroxidase PsaD {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1xvqa_ c.47.1.10 (A:) Thiol peroxidase Tpx {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1st9a_ c.47.1.10 (A:) Thiol-disulfide oxidoreductase ResA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1lu4a_ c.47.1.10 (A:) Soluble secreted antigen MPT53 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2b5xa1 c.47.1.10 (A:1-143) thiol:disulfide oxidoreductase YkuV {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2cvba1 c.47.1.10 (A:2-188) Probable thiol-disulfide isomerase/thioredoxin TTHA0593 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xiya1 c.47.1.10 (A:2-180) 1-Cys peroxiredoxin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2fy6a1 c.47.1.10 (A:33-175) Peptide methionine sulfoxide reductase MsrA/MsrB, N-terminal domain {Neisseria meningitidis serogroup A [TaxId: 65699]} Back     information, alignment and structure
>d1zzoa1 c.47.1.10 (A:45-178) Lipoprotein DsbF {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1z5ye1 c.47.1.10 (E:49-184) Thioredoxin-like protein CcmG (CycY, DsbE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1knga_ c.47.1.10 (A:) Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1jfua_ c.47.1.10 (A:) Membrane-anchored thioredoxin-like protein TlpA, soluble domain {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1xzoa1 c.47.1.10 (A:3-174) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wp0a1 c.47.1.10 (A:138-297) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b7ka1 c.47.1.10 (A:111-279) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Baker's yeast(Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1i5ga_ c.47.1.10 (A:) Tryparedoxin II {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1o73a_ c.47.1.10 (A:) Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 5702]} Back     information, alignment and structure
>d1o8xa_ c.47.1.10 (A:) Tryparedoxin I {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2fwha1 c.47.1.1 (A:428-544) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ecsa_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure