Psyllid ID: psy13819

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320---
MRRWSKGVLFANGRHWGRYWSEVGPQYSLFVPEEFLKVGTNRITIFELTRAPDKYDVDFVDKISQRRARMSRTFAIDLAGDTFRLNEDPFQFVSGSFHYFRAPPGRWCWIMRAMRAAGLNALSTYVEWRSHEVHPGHYHYDGHRDIEHFLQLAVEEDLYILLRPGPFICGKRDFGGFPPWLLKVAPDILLRQNHPVYQRYVTRWFQELFPRIQKYLYGNDRPIILVQVENEYGSDAECDPAHAVWLRDLLRTYVQDKAVLYSTDGAFDAYLRCTVDGVYSTVDFTVFKDVNVSFQAQRTRAPQGPLVNAEFEFFPMLLWAGMS
cccccEEEEEEcccccccccccccccEEEEEccccccccccccEEEEEEccccccccccccHHHHHHHccccEEEEEEcccEEEEccEEEEEEEEEEcccccccHHHHHHHHHHHHccccEEEEEcccccccccccEEEEcccccHHHHHHHHHHcccEEEEcccccccccccccccHHHccccccccEEEcccHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEcccccccccccHHHHHHHHHHHHHccccccEEEEEccccccccccccccEEEEccccccccHHHHHHHHHHccccccEEEEEEcccccccccccc
ccccccEEEEEEccccccccccccccEEEEEccHHHcccccEEEEEEEccccccHHHHHEccccccccccccEEEEEccccEEEEcccEEEEEEEcEccccccHHHHHHHHHHHHHccccEEEEEEEccccccccccEcccccHHHHHHHHHHHHcccEEEEEcccEEEEEEcccccHHHHHHccccEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEccccccccccHHHHHHHHHHHHHHccccEEEEEEcccccccEccccccEEEEEcccccccHHHHHHHHccccccccEEcccccccHHHHccccc
mrrwskgvlfangrhwgrywsevgpqyslfvpeeflkvgtnRITIFEltrapdkydvdfVDKISQRRARMSRTFAIDlagdtfrlnedpfqfvsgsfhyfrappgrWCWIMRAMRAAGLNALSTYVEwrshevhpghyhydghrDIEHFLQLAVEEDLYillrpgpficgkrdfggfppwllkvapdillrqnhpvyqRYVTRWFQELFPRIQkylygndrpiILVQVEneygsdaecdpaHAVWLRDLLRTYVQDKAVLYSTDGAFDAYLRCTVDGVYSTVDFTVFKdvnvsfqaqrtrapqgplvnaefEFFPMLLWAGMS
mrrwskgvlfangrhwgryWSEVGPQYSLFVPEEFLKVGTNRITIfeltrapdkydvdFVDKISQRRARMSRTFAIDLAGDTFRLNEDPFQFVSGSFHYFRAPPGRWCWIMRAMRAAGLNALSTYVEWRSHEVHPGHYHYDGHRDIEHFLQLAVEEDLYILLRPGPFICGKRDFGGFPPWLLKVAPDILLRQNHPVYQRYVTRWFQELFPRIQKYLYGNDRPIILVQVENEYGSDAECDPAHAVWLRDLLRTYVQDKAVLYSTDGAFDAYLRCTVDGVYSTVDFTVFKDVNVSFQAQrtrapqgplvnaEFEFFPMLLWAGMS
MRRWSKGVLFANGRHWGRYWSEVGPQYSLFVPEEFLKVGTNRITIFELTRAPDKYDVDFVDKISQRRARMSRTFAIDLAGDTFRLNEDPFQFVSGSFHYFRAPPGRWCWIMRAMRAAGLNALSTYVEWRSHEVHPGHYHYDGHRDIEHFLQLAVEEDLYILLRPGPFICGKRDFGGFPPWLLKVAPDILLRQNHPVYQRYVTRWFQELFPRIQKYLYGNDRPIILVQVENEYGSDAECDPAHAVWLRDLLRTYVQDKAVLYSTDGAFDAYLRCTVDGVYSTVDFTVFKDVNVSFQAQRTRAPQGPLVNAEFEFFPMLLWAGMS
****SKGVLFANGRHWGRYWSEVGPQYSLFVPEEFLKVGTNRITIFELTRAPDKYDVDFVDKISQRRARMSRTFAIDLAGDTFRLNEDPFQFVSGSFHYFRAPPGRWCWIMRAMRAAGLNALSTYVEWRSHEVHPGHYHYDGHRDIEHFLQLAVEEDLYILLRPGPFICGKRDFGGFPPWLLKVAPDILLRQNHPVYQRYVTRWFQELFPRIQKYLYGNDRPIILVQVENEYGSDAECDPAHAVWLRDLLRTYVQDKAVLYSTDGAFDAYLRCTVDGVYSTVDFTVFKDVNVSFQAQRTRAPQGPLVNAEFEFFPMLLWA***
*RRWSKGVLFANGRHWGRYWSEVGPQYSLFVPEEFLKVGTNRITIFELTRAPDKYDVDFVDKISQRRARMSRTFAIDLAGDTFRLNEDPFQFVSGSFHYFRAPPGRWCWIMRAMRAAGLNALSTYVEWRSHEVHPGHYHYDGHRDIEHFLQLAVEEDLYILLRPGPFICGKRDFGGFPPWLLKVAPDILLRQNHPVYQRYVTRWFQELFPRIQKYLYGNDRPIILVQVENEYGSDAECDPAHAVWLRDLLRTYVQDKAVLYSTDGAFDAYLRCTVDGVYSTVDFTVFKDVNVSFQAQRTRAPQGPLVNAEFEFFPMLLWAGMS
MRRWSKGVLFANGRHWGRYWSEVGPQYSLFVPEEFLKVGTNRITIFELTRAPDKYDVDFVDKISQRRARMSRTFAIDLAGDTFRLNEDPFQFVSGSFHYFRAPPGRWCWIMRAMRAAGLNALSTYVEWRSHEVHPGHYHYDGHRDIEHFLQLAVEEDLYILLRPGPFICGKRDFGGFPPWLLKVAPDILLRQNHPVYQRYVTRWFQELFPRIQKYLYGNDRPIILVQVENEYGSDAECDPAHAVWLRDLLRTYVQDKAVLYSTDGAFDAYLRCTVDGVYSTVDFTVFKDVNVSFQAQRTRAPQGPLVNAEFEFFPMLLWAGMS
**RWSKGVLFANGRHWGRYWSEVGPQYSLFVPEEFLKVGTNRITIFELTRAPDKYDVDFVDKISQRRARMSRTFAIDLAGDTFRLNEDPFQFVSGSFHYFRAPPGRWCWIMRAMRAAGLNALSTYVEWRSHEVHPGHYHYDGHRDIEHFLQLAVEEDLYILLRPGPFICGKRDFGGFPPWLLKVAPDILLRQNHPVYQRYVTRWFQELFPRIQKYLYGNDRPIILVQVENEYGSDAECDPAHAVWLRDLLRTYVQDKAVLYSTDGAFDAYLRCTVDGVYSTVDFTVFKDVNVSFQAQRTRAPQGPLVNAEFEFFPMLLWAG**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRRWSKGVLFANGRHWGRYWSEVGPQYSLFVPEEFLKVGTNRITIFELTRAPDKYDVDFVDKISQRRARMSRTFAIDLAGDTFRLNEDPFQFVSGSFHYFRAPPGRWCWIMRAMRAAGLNALSTYVEWRSHEVHPGHYHYDGHRDIEHFLQLAVEEDLYILLRPGPFICGKRDFGGFPPWLLKVAPDILLRQNHPVYQRYVTRWFQELFPRIQKYLYGNDRPIILVQVENEYGSDAECDPAHAVWLRDLLRTYVQDKAVLYSTDGAFDAYLRCTVDGVYSTVDFTVFKDVNVSFQAQRTRAPQGPLVNAEFEFFPMLLWAGMS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query323 2.2.26 [Sep-21-2011]
O19015 669 Beta-galactosidase OS=Fel N/A N/A 0.755 0.364 0.443 2e-55
Q9TRY9 668 Beta-galactosidase OS=Can yes N/A 0.755 0.365 0.430 6e-55
P23780 647 Beta-galactosidase OS=Mus yes N/A 0.739 0.369 0.443 1e-54
Q58D55 653 Beta-galactosidase OS=Bos yes N/A 0.739 0.366 0.439 6e-54
Q5R7P4 677 Beta-galactosidase OS=Pon yes N/A 0.755 0.360 0.434 9e-54
P16278 677 Beta-galactosidase OS=Hom yes N/A 0.755 0.360 0.430 4e-53
Q8VC60 646 Beta-galactosidase-1-like no N/A 0.736 0.368 0.433 2e-51
Q60HF6 682 Beta-galactosidase OS=Mac N/A N/A 0.755 0.357 0.426 3e-51
Q95LV1 654 Beta-galactosidase-1-like N/A N/A 0.736 0.363 0.425 3e-49
Q6UWU2 654 Beta-galactosidase-1-like no N/A 0.736 0.363 0.425 6e-49
>sp|O19015|BGAL_FELCA Beta-galactosidase OS=Felis catus GN=GLB1 PE=2 SV=1 Back     alignment and function desciption
 Score =  216 bits (550), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 109/246 (44%), Positives = 151/246 (61%), Gaps = 2/246 (0%)

Query: 67  RARMSRTFAIDLAGDTFRLNEDPFQFVSGSFHYFRAPPGRWCWIMRAMRAAGLNALSTYV 126
           R    RTF ID   + F  +  PF+++SGS HYFR P   W   +  M+ AGLNA+ TYV
Sbjct: 26  RNASQRTFKIDYGHNRFLKDGQPFRYISGSIHYFRVPRFYWKDRLLKMKMAGLNAIQTYV 85

Query: 127 EWRSHEVHPGHYHYDGHRDIEHFLQLAVEEDLYILLRPGPFICGKRDFGGFPPWLLKVAP 186
            W  HE  PG Y + G  D+E+FL+LA E  L ++LRPGP+IC + D GG P WLL +  
Sbjct: 86  PWNFHEPQPGQYQFSGEHDVEYFLKLAHELGLLVILRPGPYICAEWDMGGLPAWLL-LKE 144

Query: 187 DILLRQNHPVYQRYVTRWFQELFPRIQKYLYGNDRPIILVQVENEYGSDAECDPAHAVWL 246
            I+LR + P Y   V +W   L P+++  LY N  PII VQVENEYGS   CD  +  +L
Sbjct: 145 SIILRSSDPDYLAAVDKWLGVLLPKMKPLLYQNGGPIITVQVENEYGSYFTCDYDYLRFL 204

Query: 247 RDLLRTYVQDKAVLYSTDGAFDAYLRC-TVDGVYSTVDFTVFKDVNVSFQAQRTRAPQGP 305
           +   R ++    +L++TDGA + +L+C  + G+Y+TVDF    ++  +FQ QR   P+GP
Sbjct: 205 QRRFRDHLGGDVLLFTTDGAHEKFLQCGALQGIYATVDFGPDANITAAFQIQRKSEPRGP 264

Query: 306 LVNAEF 311
           LVN+EF
Sbjct: 265 LVNSEF 270
Cleaves beta-linked terminal galactosyl residues from gangliosides, glycoproteins, and glycosaminoglycans.
Felis catus (taxid: 9685)
EC: 3EC: .EC: 2EC: .EC: 1EC: .EC: 2EC: 3
>sp|Q9TRY9|BGAL_CANFA Beta-galactosidase OS=Canis familiaris GN=GLB1 PE=2 SV=3 Back     alignment and function description
>sp|P23780|BGAL_MOUSE Beta-galactosidase OS=Mus musculus GN=Glb1 PE=2 SV=1 Back     alignment and function description
>sp|Q58D55|BGAL_BOVIN Beta-galactosidase OS=Bos taurus GN=GLB1 PE=2 SV=1 Back     alignment and function description
>sp|Q5R7P4|BGAL_PONAB Beta-galactosidase OS=Pongo abelii GN=GLB1 PE=2 SV=1 Back     alignment and function description
>sp|P16278|BGAL_HUMAN Beta-galactosidase OS=Homo sapiens GN=GLB1 PE=1 SV=2 Back     alignment and function description
>sp|Q8VC60|GLB1L_MOUSE Beta-galactosidase-1-like protein OS=Mus musculus GN=Glb1l PE=2 SV=1 Back     alignment and function description
>sp|Q60HF6|BGAL_MACFA Beta-galactosidase OS=Macaca fascicularis GN=GLB1 PE=2 SV=1 Back     alignment and function description
>sp|Q95LV1|GLB1L_MACFA Beta-galactosidase-1-like protein OS=Macaca fascicularis GN=GLB1L PE=2 SV=1 Back     alignment and function description
>sp|Q6UWU2|GLB1L_HUMAN Beta-galactosidase-1-like protein OS=Homo sapiens GN=GLB1L PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query323
328721397 628 PREDICTED: beta-galactosidase-like [Acyr 0.739 0.380 0.522 6e-66
193690496 635 PREDICTED: beta-galactosidase-like [Acyr 0.739 0.376 0.491 1e-63
307188518 624 Beta-galactosidase [Camponotus floridanu 0.739 0.383 0.491 6e-63
345487997 638 PREDICTED: beta-galactosidase-like [Naso 0.761 0.385 0.480 7e-63
347967093 630 AGAP002058-PA [Anopheles gambiae str. PE 0.736 0.377 0.485 9e-63
350418578 646 PREDICTED: beta-galactosidase-like [Bomb 0.736 0.368 0.5 1e-61
157106609 648 beta-galactosidase [Aedes aegypti] gi|10 0.736 0.367 0.510 1e-61
170034400 611 beta-galactosidase [Culex quinquefasciat 0.746 0.394 0.487 1e-61
328711635 712 PREDICTED: beta-galactosidase-like [Acyr 0.743 0.337 0.487 2e-61
195444086 640 GK11429 [Drosophila willistoni] gi|19416 0.739 0.373 0.504 4e-61
>gi|328721397|ref|XP_003247292.1| PREDICTED: beta-galactosidase-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  257 bits (656), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 126/241 (52%), Positives = 164/241 (68%), Gaps = 2/241 (0%)

Query: 73  TFAIDLAGDTFRLNEDPFQFVSGSFHYFRAPPGRWCWIMRAMRAAGLNALSTYVEWRSHE 132
           TF +D   + F  +   F++VSGS HYFR P   W   ++ M+AAGLNA+STYVEW  HE
Sbjct: 14  TFTVDYERNEFLKDGQVFRYVSGSLHYFRVPKPYWKDRIQKMKAAGLNAISTYVEWSLHE 73

Query: 133 VHPGHYHYDGHRDIEHFLQLAVEEDLYILLRPGPFICGKRDFGGFPPWLLKVAPDILLRQ 192
            +PG Y++D   D+E+FLQL  +E +Y+LLRPGP+IC +RDFGGFP WLL V P   LR 
Sbjct: 74  PYPGEYNFDDIADLEYFLQLVKDEGMYLLLRPGPYICAERDFGGFPFWLLNVVPKKRLRT 133

Query: 193 NHPVYQRYVTRWFQELFPRIQKYLYGNDRPIILVQVENEYGSDAECDPAHAVWLRDLLRT 252
           N P Y+ YVT+WF  L P+I ++LYGN   II+VQVENEYGS   CD  + +WLRDL + 
Sbjct: 134 NDPSYKHYVTKWFNVLMPKIDRFLYGNGGNIIMVQVENEYGSYNACDQEYMLWLRDLYKR 193

Query: 253 YVQDKAVLYSTDGAFDAYLRC-TVDGVYSTVDF-TVFKDVNVSFQAQRTRAPQGPLVNAE 310
           YV  KA+LY+TDG   +Y  C  +  VY+TVDF    KDV+  F+  RT   +GPLVN+E
Sbjct: 194 YVGYKALLYTTDGCGYSYFTCGAIPDVYATVDFGASVKDVSQCFKYMRTTQKRGPLVNSE 253

Query: 311 F 311
           +
Sbjct: 254 Y 254

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|193690496|ref|XP_001952133.1| PREDICTED: beta-galactosidase-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|307188518|gb|EFN73255.1| Beta-galactosidase [Camponotus floridanus] Back     alignment and taxonomy information
>gi|345487997|ref|XP_001602984.2| PREDICTED: beta-galactosidase-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|347967093|ref|XP_320991.5| AGAP002058-PA [Anopheles gambiae str. PEST] gi|333469761|gb|EAA01064.5| AGAP002058-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|350418578|ref|XP_003491903.1| PREDICTED: beta-galactosidase-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|157106609|ref|XP_001649402.1| beta-galactosidase [Aedes aegypti] gi|108879821|gb|EAT44046.1| AAEL004575-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|170034400|ref|XP_001845062.1| beta-galactosidase [Culex quinquefasciatus] gi|167875695|gb|EDS39078.1| beta-galactosidase [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|328711635|ref|XP_001944394.2| PREDICTED: beta-galactosidase-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|195444086|ref|XP_002069708.1| GK11429 [Drosophila willistoni] gi|194165793|gb|EDW80694.1| GK11429 [Drosophila willistoni] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query323
FB|FBgn0260746 637 Ect3 "Ectoderm-expressed 3" [D 0.739 0.375 0.491 1e-59
FB|FBgn0001089 672 Gal "beta galactosidase" [Dros 0.730 0.351 0.473 6.8e-56
ZFIN|ZDB-GENE-050410-9 676 glb1 "galactosidase, beta 1" [ 0.736 0.352 0.475 1.4e-55
UNIPROTKB|F1MUF4 653 GLB1 "Beta-galactosidase" [Bos 0.739 0.366 0.439 4.9e-53
UNIPROTKB|Q58D55 653 GLB1 "Beta-galactosidase" [Bos 0.739 0.366 0.439 4.9e-53
MGI|MGI:88151 647 Glb1 "galactosidase, beta 1" [ 0.739 0.369 0.443 4.9e-53
UNIPROTKB|Q9TRY9 668 GLB1 "Beta-galactosidase" [Can 0.755 0.365 0.430 4.9e-53
RGD|1597145 647 Glb1 "galactosidase, beta 1" [ 0.739 0.369 0.439 4.9e-53
UNIPROTKB|F1PWH9 642 GLB1 "Beta-galactosidase" [Can 0.739 0.372 0.435 6.3e-53
UNIPROTKB|P16278 677 GLB1 "Beta-galactosidase" [Hom 0.755 0.360 0.430 7.2e-52
FB|FBgn0260746 Ect3 "Ectoderm-expressed 3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 612 (220.5 bits), Expect = 1.0e-59, P = 1.0e-59
 Identities = 119/242 (49%), Positives = 158/242 (65%)

Query:    71 SRTFAIDLAGDTFRLNEDPFQFVSGSFHYFRAPPGRWCWIMRAMRAAGLNALSTYVEWRS 130
             +RTF +D   D F  + +PF+F++GSFHYFRA P  W   +R MRAAGLNA++TYVEW  
Sbjct:    21 NRTFVVDYEKDQFLKDGEPFRFIAGSFHYFRAHPATWQRHLRTMRAAGLNAVTTYVEWSL 80

Query:   131 HEVHPGHYHYDGHRDIEHFLQLAVEEDLYILLRPGPFICGKRDFGGFPPWLLKVAPDILL 190
             H    G Y + G  D+EHF++LAV EDL ++LRPGP+IC +RD GGFP WLL   P I L
Sbjct:    81 HNPRDGVYVWSGIADLEHFIRLAVGEDLLVILRPGPYICAERDMGGFPYWLLNKYPGIQL 140

Query:   191 RQNHPVYQRYVTRWFQELFPRIQKYLYGNDRPIILVQVENEYGSDAECDPAHAVWLRDLL 250
             R     Y   +  W+ +LF ++ KYLYGN  PII+VQVENEYGS   CD  +  WLRD  
Sbjct:   141 RTADVNYLSEIRIWYTQLFAKMNKYLYGNGGPIIMVQVENEYGSFYACDLNYRNWLRDET 200

Query:   251 RTYVQDKAVLYSTDGAFDAYLRC-TVDGVYSTVDFTVFKDVNVSFQAQRTRAPQGPLVNA 309
              ++V+ +AVL++ DG   + LRC  + GV +T+DF    D+   +   R   P+GPLVNA
Sbjct:   201 ESHVKGQAVLFTNDGP--SVLRCGKIQGVLATMDFGATNDLKPIWAKFRRYQPKGPLVNA 258

Query:   310 EF 311
             E+
Sbjct:   259 EY 260
GO:0004565 "beta-galactosidase activity" evidence=ISS
GO:0005764 "lysosome" evidence=ISS
GO:0035071 "salivary gland cell autophagic cell death" evidence=IEP
GO:0048102 "autophagic cell death" evidence=IEP
GO:0005975 "carbohydrate metabolic process" evidence=IEA
FB|FBgn0001089 Gal "beta galactosidase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050410-9 glb1 "galactosidase, beta 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1MUF4 GLB1 "Beta-galactosidase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q58D55 GLB1 "Beta-galactosidase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:88151 Glb1 "galactosidase, beta 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q9TRY9 GLB1 "Beta-galactosidase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|1597145 Glb1 "galactosidase, beta 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1PWH9 GLB1 "Beta-galactosidase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P16278 GLB1 "Beta-galactosidase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.2.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query323
pfam01301318 pfam01301, Glyco_hydro_35, Glycosyl hydrolases fam 2e-76
PLN03059 840 PLN03059, PLN03059, beta-galactosidase; Provisiona 6e-26
COG1874 673 COG1874, LacA, Beta-galactosidase [Carbohydrate tr 3e-20
pfam02449 376 pfam02449, Glyco_hydro_42, Beta-galactosidase 2e-11
>gnl|CDD|216423 pfam01301, Glyco_hydro_35, Glycosyl hydrolases family 35 Back     alignment and domain information 
 Score =  236 bits (605), Expect = 2e-76
 Identities = 97/233 (41%), Positives = 134/233 (57%), Gaps = 5/233 (2%)

Query: 82  TFRLNEDPFQFVSGSFHYFRAPPGRWCWIMRAMRAAGLNALSTYVEWRSHEVHPGHYHYD 141
           +F ++   F+ +SGS HYFR PP  W   ++  +A GLN + TYV W  HE  PG Y + 
Sbjct: 1   SFLIDGQRFRLISGSIHYFRIPPEMWPDRLQKAKALGLNTIETYVFWNLHEPEPGQYDFS 60

Query: 142 GHRDIEHFLQLAVEEDLYILLRPGPFICGKRDFGGFPPWLLKVAPDILLRQNHPVYQRYV 201
           G  D+  F++LA E  LY++LRPGP+IC + DFGG P WLL+V P I LR + P +   V
Sbjct: 61  GILDLVKFIKLAQEAGLYVILRPGPYICAEWDFGGLPAWLLRV-PGIRLRTSDPPFLEAV 119

Query: 202 TRWFQELFPRIQKYLYGNDRPIILVQVENEYGSDAECDPAHAVWLRDLLRTYVQDKAVLY 261
            R+   L P+++     N  PIILVQ+ENEYGS    D A+   LR L R +  D AVL+
Sbjct: 120 DRYLTALLPKMKPLQATNGGPIILVQIENEYGSYG-VDKAYLQALRKLYREWGADMAVLF 178

Query: 262 STDGAFDAYLRCTV---DGVYSTVDFTVFKDVNVSFQAQRTRAPQGPLVNAEF 311
           +TDG +   L+C       +Y+T  F    +    F   R  +P GPL+ +EF
Sbjct: 179 TTDGPWGMCLQCGDLPDPVIYTTNGFGCGANPTSIFGLLRPFSPNGPLMWSEF 231

Length = 318
>gnl|CDD|166698 PLN03059, PLN03059, beta-galactosidase; Provisional Back     alignment and domain information
>gnl|CDD|224786 COG1874, LacA, Beta-galactosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|217042 pfam02449, Glyco_hydro_42, Beta-galactosidase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 323
PLN03059 840 beta-galactosidase; Provisional 100.0
PF01301319 Glyco_hydro_35: Glycosyl hydrolases family 35; Int 100.0
KOG0496|consensus 649 100.0
COG1874 673 LacA Beta-galactosidase [Carbohydrate transport an 99.97
PF02449 374 Glyco_hydro_42: Beta-galactosidase; InterPro: IPR0 99.91
KOG0496|consensus649 99.8
PF02836298 Glyco_hydro_2_C: Glycosyl hydrolases family 2, TIM 99.76
PLN03059840 beta-galactosidase; Provisional 99.76
PRK10150604 beta-D-glucuronidase; Provisional 99.71
PRK10340 1021 ebgA cryptic beta-D-galactosidase subunit alpha; R 99.58
PRK09525 1027 lacZ beta-D-galactosidase; Reviewed 99.57
PF00150281 Cellulase: Cellulase (glycosyl hydrolase family 5) 99.5
COG3250 808 LacZ Beta-galactosidase/beta-glucuronidase [Carboh 99.44
TIGR03356 427 BGL beta-galactosidase. 99.41
PLN02998 497 beta-glucosidase 99.38
PLN02814 504 beta-glucosidase 99.37
PRK09593 478 arb 6-phospho-beta-glucosidase; Reviewed 99.36
PRK09589 476 celA 6-phospho-beta-glucosidase; Reviewed 99.36
PRK15014 477 6-phospho-beta-glucosidase BglA; Provisional 99.34
PLN02849 503 beta-glucosidase 99.34
PRK13511 469 6-phospho-beta-galactosidase; Provisional 99.33
TIGR01233 467 lacG 6-phospho-beta-galactosidase. This enzyme is 99.31
PF00232 455 Glyco_hydro_1: Glycosyl hydrolase family 1; InterP 99.29
PRK09852 474 cryptic 6-phospho-beta-glucosidase; Provisional 99.29
COG2723 460 BglB Beta-glucosidase/6-phospho-beta-glucosidase/b 99.23
PF03198314 Glyco_hydro_72: Glucanosyltransferase; InterPro: I 98.85
smart00633254 Glyco_10 Glycosyl hydrolase family 10. 98.81
KOG0626|consensus 524 98.79
PF13364111 BetaGal_dom4_5: Beta-galactosidase jelly roll doma 98.71
PF13204289 DUF4038: Protein of unknown function (DUF4038); PD 98.51
PLN02801 517 beta-amylase 98.29
PLN02803 548 beta-amylase 98.29
PLN00197 573 beta-amylase; Provisional 98.28
PLN02161 531 beta-amylase 98.27
PLN02705 681 beta-amylase 98.27
PF07745332 Glyco_hydro_53: Glycosyl hydrolase family 53; Inte 98.25
PLN02905 702 beta-amylase 98.25
PF01373 402 Glyco_hydro_14: Glycosyl hydrolase family 14; Inte 98.23
COG3693345 XynA Beta-1,4-xylanase [Carbohydrate transport and 98.2
PF00331320 Glyco_hydro_10: Glycosyl hydrolase family 10; Inte 98.18
PF14488166 DUF4434: Domain of unknown function (DUF4434) 98.16
COG2730 407 BglC Endoglucanase [Carbohydrate transport and met 98.05
COG3934 587 Endo-beta-mannanase [Carbohydrate transport and me 97.42
COG3867 403 Arabinogalactan endo-1,4-beta-galactosidase [Carbo 97.05
PF14871132 GHL6: Hypothetical glycosyl hydrolase 6 96.64
KOG2230|consensus 867 96.4
PF01229 486 Glyco_hydro_39: Glycosyl hydrolases family 39; Int 96.23
PF02638311 DUF187: Glycosyl hydrolase like GH101; InterPro: I 95.71
PRK09936296 hypothetical protein; Provisional 95.28
smart00642166 Aamy Alpha-amylase domain. 95.06
COG3623287 SgaU Putative L-xylulose-5-phosphate 3-epimerase [ 94.82
TIGR01515 613 branching_enzym alpha-1,4-glucan:alpha-1,4-glucan 94.73
PF02055 496 Glyco_hydro_30: O-Glycosyl hydrolase family 30; In 93.79
PRK05402 726 glycogen branching enzyme; Provisional 93.77
PF14587384 Glyco_hydr_30_2: O-Glycosyl hydrolase family 30; P 93.76
COG1649 418 Uncharacterized protein conserved in bacteria [Fun 93.49
PRK14705 1224 glycogen branching enzyme; Provisional 93.23
PF00128316 Alpha-amylase: Alpha amylase, catalytic domain; In 93.01
PRK12568 730 glycogen branching enzyme; Provisional 92.83
PRK14706 639 glycogen branching enzyme; Provisional 92.72
COG0296 628 GlgB 1,4-alpha-glucan branching enzyme [Carbohydra 92.39
PRK09441 479 cytoplasmic alpha-amylase; Reviewed 92.07
PF05913 357 DUF871: Bacterial protein of unknown function (DUF 91.91
cd06565301 GH20_GcnA-like Glycosyl hydrolase family 20 (GH20) 91.72
PLN02447 758 1,4-alpha-glucan-branching enzyme 91.71
TIGR01531 1464 glyc_debranch glycogen debranching enzymye. glycog 91.21
PRK12313 633 glycogen branching enzyme; Provisional 91.21
COG5309305 Exo-beta-1,3-glucanase [Carbohydrate transport and 90.7
TIGR02402 542 trehalose_TreZ malto-oligosyltrehalose trehalohydr 90.29
PF01261213 AP_endonuc_2: Xylose isomerase-like TIM barrel; In 89.94
cd02742303 GH20_hexosaminidase Beta-N-acetylhexosaminidases o 89.88
PF1287688 Cellulase-like: Sugar-binding cellulase-like; Inte 88.78
cd06568329 GH20_SpHex_like A subgroup of the Glycosyl hydrola 88.36
cd06563357 GH20_chitobiase-like The chitobiase of Serratia ma 88.34
cd06564326 GH20_DspB_LnbB-like Glycosyl hydrolase family 20 ( 88.26
PRK10785 598 maltodextrin glucosidase; Provisional 88.22
TIGR02104 605 pulA_typeI pullulanase, type I. Pullulan is an unu 88.14
PLN02960 897 alpha-amylase 88.0
PRK09856275 fructoselysine 3-epimerase; Provisional 87.81
TIGR00542279 hxl6Piso_put hexulose-6-phosphate isomerase, putat 87.78
PF03659 386 Glyco_hydro_71: Glycosyl hydrolase family 71 ; Int 87.63
PF02065 394 Melibiase: Melibiase; InterPro: IPR000111 O-Glycos 87.5
PRK13210284 putative L-xylulose 5-phosphate 3-epimerase; Revie 86.97
PRK01060281 endonuclease IV; Provisional 86.56
PRK10933 551 trehalose-6-phosphate hydrolase; Provisional 86.28
PRK13398266 3-deoxy-7-phosphoheptulonate synthase; Provisional 86.12
PF13200316 DUF4015: Putative glycosyl hydrolase domain 85.9
COG3589 360 Uncharacterized conserved protein [Function unknow 85.7
PF02679244 ComA: (2R)-phospho-3-sulfolactate synthase (ComA); 85.67
TIGR02403 543 trehalose_treC alpha,alpha-phosphotrehalase. Treha 85.37
PRK09505 683 malS alpha-amylase; Reviewed 84.99
PF02837167 Glyco_hydro_2_N: Glycosyl hydrolases family 2, sug 84.8
TIGR03849237 arch_ComA phosphosulfolactate synthase. This model 84.75
TIGR03234254 OH-pyruv-isom hydroxypyruvate isomerase. This enzy 84.62
smart00812384 Alpha_L_fucos Alpha-L-fucosidase. O-Glycosyl hydro 84.43
TIGR02103 898 pullul_strch alpha-1,6-glucosidases, pullulanase-t 83.77
PLN02361 401 alpha-amylase 83.1
TIGR02456 539 treS_nterm trehalose synthase. Trehalose synthase 83.05
PF07488328 Glyco_hydro_67M: Glycosyl hydrolase family 67 midd 82.45
cd0490866 ACT_Bt0572_1 N-terminal ACT domain of a novel prot 82.22
TIGR02100 688 glgX_debranch glycogen debranching enzyme GlgX. Th 81.88
cd06593308 GH31_xylosidase_YicI YicI alpha-xylosidase is a gl 81.65
PRK03705 658 glycogen debranching enzyme; Provisional 80.7
>PLN03059 beta-galactosidase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=5.1e-70  Score=566.47  Aligned_cols=242  Identities=26%  Similarity=0.457  Sum_probs=220.1

Q ss_pred             ccccccceEEEEecCCeEEeCCeeeEEeeeeecCCCCChhcHHHHHHHHHHhCCCEEEEEEeCCCcccCCCeecccccch
Q psy13819         66 RRARMSRTFAIDLAGDTFRLNEDPFQFVSGSFHYFRAPPGRWCWIMRAMRAAGLNALSTYVEWRSHEVHPGHYHYDGHRD  145 (323)
Q Consensus        66 ~~~~~~~~~~v~~~~~~~~~dGk~~~i~~g~~Hy~r~p~~~W~~~l~~mk~~G~N~Vr~yv~W~~hEP~~G~fdf~g~~d  145 (323)
                      +.+.......|+||+++|+|||||++|+||++||||+||++|+|+|+|||++|+|||+|||+||.|||+||+|||+|.+|
T Consensus        20 ~~~~~~~~~~v~~d~~~f~idG~p~~i~sG~iHY~R~~p~~W~d~L~k~Ka~GlNtV~tYV~Wn~HEp~~G~~dF~G~~D   99 (840)
T PLN03059         20 SSWVSHGSASVSYDHRAFIINGQRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHEPSPGNYYFEDRYD   99 (840)
T ss_pred             hhhhccceeEEEEeCCEEEECCEEEEEEEeCcccCcCCHHHHHHHHHHHHHcCCCeEEEEecccccCCCCCeeeccchHH
Confidence            34455556678999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHCCCeEEEccCCccccccCCCCCcccccccCCCeeecCCCHhHHHHHHHHHHHHHHHHH--hhhccCCCcE
Q psy13819        146 IEHFLQLAVEEDLYILLRPGPFICGKRDFGGFPPWLLKVAPDILLRQNHPVYQRYVTRWFQELFPRIQ--KYLYGNDRPI  223 (323)
Q Consensus       146 l~~fl~~a~e~GL~vilr~GPyi~aEw~~gg~P~Wl~~~~p~~~~R~~~~~f~~~~~~~~~~l~~~i~--~~~~~n~g~V  223 (323)
                      |++||++|+|.||+|||||||||||||++||+|.||++ .|+|.+|++||.|++++++|+++|+++|+  ++++++||||
T Consensus       100 L~~Fl~la~e~GLyvilRpGPYIcAEw~~GGlP~WL~~-~~~i~~Rs~d~~fl~~v~~~~~~l~~~l~~~~l~~~~GGPI  178 (840)
T PLN03059        100 LVKFIKVVQAAGLYVHLRIGPYICAEWNFGGFPVWLKY-VPGIEFRTDNGPFKAAMQKFTEKIVDMMKSEKLFEPQGGPI  178 (840)
T ss_pred             HHHHHHHHHHcCCEEEecCCcceeeeecCCCCchhhhc-CCCcccccCCHHHHHHHHHHHHHHHHHHhhcceeecCCCcE
Confidence            99999999999999999999999999999999999987 69999999999999999999999999996  6889999999


Q ss_pred             EEEccCCCcCCCC----CChHHHHHHHHHHHHHhcCCceEEEeeCCCCccccccccCceEEeecCCCCCchhHHHHHHHh
Q psy13819        224 ILVQVENEYGSDA----ECDPAHAVWLRDLLRTYVQDKAVLYSTDGAFDAYLRCTVDGVYSTVDFTVFKDVNVSFQAQRT  299 (323)
Q Consensus       224 i~~QieNE~g~~~----~~~~~Y~~~l~~~~~~~~g~~~~l~t~dg~~~~~~~~~~~g~~~~~nfg~~~~~~~~~~~~r~  299 (323)
                      ||+|||||||+|.    .+|++|++||++++++ .|++||+||||++.      ++++++.|+| |   ...+.|..   
T Consensus       179 ImvQIENEYGs~~~~~~~~d~~Yl~~l~~~~~~-~Gi~VPl~t~dg~~------~~~~v~~t~N-g---~~~~~f~~---  244 (840)
T PLN03059        179 ILSQIENEYGPVEWEIGAPGKAYTKWAADMAVK-LGTGVPWVMCKQED------APDPVIDTCN-G---FYCENFKP---  244 (840)
T ss_pred             EEEEecccccceecccCcchHHHHHHHHHHHHH-cCCCcceEECCCCC------CCccceecCC-C---chhhhccc---
Confidence            9999999999973    5689999999999999 59999999999874      3578998999 3   22344443   


Q ss_pred             hCCCCCeEEEEecccccccccCC
Q psy13819        300 RAPQGPLVNAEFEFFPMLLWAGM  322 (323)
Q Consensus       300 ~~p~~Plm~~E~~~gw~~~W~~~  322 (323)
                      ..+.+|+|+||||+|||++||+.
T Consensus       245 ~~~~~P~m~tE~w~GWf~~wG~~  267 (840)
T PLN03059        245 NKDYKPKMWTEAWTGWYTEFGGA  267 (840)
T ss_pred             CCCCCCcEEeccCchhHhhcCCC
Confidence            23457999999999999999973

>PF01301 Glyco_hydro_35: Glycosyl hydrolases family 35; InterPro: IPR001944 O-Glycosyl hydrolases 3 Back     alignment and domain information
>KOG0496|consensus Back     alignment and domain information
>COG1874 LacA Beta-galactosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF02449 Glyco_hydro_42: Beta-galactosidase; InterPro: IPR013529 O-Glycosyl hydrolases 3 Back     alignment and domain information
>KOG0496|consensus Back     alignment and domain information
>PF02836 Glyco_hydro_2_C: Glycosyl hydrolases family 2, TIM barrel domain; InterPro: IPR006103 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PLN03059 beta-galactosidase; Provisional Back     alignment and domain information
>PRK10150 beta-D-glucuronidase; Provisional Back     alignment and domain information
>PRK10340 ebgA cryptic beta-D-galactosidase subunit alpha; Reviewed Back     alignment and domain information
>PRK09525 lacZ beta-D-galactosidase; Reviewed Back     alignment and domain information
>PF00150 Cellulase: Cellulase (glycosyl hydrolase family 5); InterPro: IPR001547 O-Glycosyl hydrolases 3 Back     alignment and domain information
>COG3250 LacZ Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03356 BGL beta-galactosidase Back     alignment and domain information
>PLN02998 beta-glucosidase Back     alignment and domain information
>PLN02814 beta-glucosidase Back     alignment and domain information
>PRK09593 arb 6-phospho-beta-glucosidase; Reviewed Back     alignment and domain information
>PRK09589 celA 6-phospho-beta-glucosidase; Reviewed Back     alignment and domain information
>PRK15014 6-phospho-beta-glucosidase BglA; Provisional Back     alignment and domain information
>PLN02849 beta-glucosidase Back     alignment and domain information
>PRK13511 6-phospho-beta-galactosidase; Provisional Back     alignment and domain information
>TIGR01233 lacG 6-phospho-beta-galactosidase Back     alignment and domain information
>PF00232 Glyco_hydro_1: Glycosyl hydrolase family 1; InterPro: IPR001360 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PRK09852 cryptic 6-phospho-beta-glucosidase; Provisional Back     alignment and domain information
>COG2723 BglB Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF03198 Glyco_hydro_72: Glucanosyltransferase; InterPro: IPR004886 This family is a group of yeast glycolipid proteins anchored to the membrane Back     alignment and domain information
>smart00633 Glyco_10 Glycosyl hydrolase family 10 Back     alignment and domain information
>KOG0626|consensus Back     alignment and domain information
>PF13364 BetaGal_dom4_5: Beta-galactosidase jelly roll domain; PDB: 1TG7_A 1XC6_A 3OGS_A 3OGV_A 3OGR_A 3OG2_A Back     alignment and domain information
>PF13204 DUF4038: Protein of unknown function (DUF4038); PDB: 3KZS_D Back     alignment and domain information
>PLN02801 beta-amylase Back     alignment and domain information
>PLN02803 beta-amylase Back     alignment and domain information
>PLN00197 beta-amylase; Provisional Back     alignment and domain information
>PLN02161 beta-amylase Back     alignment and domain information
>PLN02705 beta-amylase Back     alignment and domain information
>PF07745 Glyco_hydro_53: Glycosyl hydrolase family 53; InterPro: IPR011683 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PLN02905 beta-amylase Back     alignment and domain information
>PF01373 Glyco_hydro_14: Glycosyl hydrolase family 14; InterPro: IPR001554 O-Glycosyl hydrolases 3 Back     alignment and domain information
>COG3693 XynA Beta-1,4-xylanase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF00331 Glyco_hydro_10: Glycosyl hydrolase family 10; InterPro: IPR001000 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF14488 DUF4434: Domain of unknown function (DUF4434) Back     alignment and domain information
>COG2730 BglC Endoglucanase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3934 Endo-beta-mannanase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3867 Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF14871 GHL6: Hypothetical glycosyl hydrolase 6 Back     alignment and domain information
>KOG2230|consensus Back     alignment and domain information
>PF01229 Glyco_hydro_39: Glycosyl hydrolases family 39; InterPro: IPR000514 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF02638 DUF187: Glycosyl hydrolase like GH101; InterPro: IPR003790 This entry describes proteins of unknown function Back     alignment and domain information
>PRK09936 hypothetical protein; Provisional Back     alignment and domain information
>smart00642 Aamy Alpha-amylase domain Back     alignment and domain information
>COG3623 SgaU Putative L-xylulose-5-phosphate 3-epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01515 branching_enzym alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase Back     alignment and domain information
>PF02055 Glyco_hydro_30: O-Glycosyl hydrolase family 30; InterPro: IPR001139 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PRK05402 glycogen branching enzyme; Provisional Back     alignment and domain information
>PF14587 Glyco_hydr_30_2: O-Glycosyl hydrolase family 30; PDB: 3CLW_B Back     alignment and domain information
>COG1649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK14705 glycogen branching enzyme; Provisional Back     alignment and domain information
>PF00128 Alpha-amylase: Alpha amylase, catalytic domain; InterPro: IPR006047 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PRK12568 glycogen branching enzyme; Provisional Back     alignment and domain information
>PRK14706 glycogen branching enzyme; Provisional Back     alignment and domain information
>COG0296 GlgB 1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09441 cytoplasmic alpha-amylase; Reviewed Back     alignment and domain information
>PF05913 DUF871: Bacterial protein of unknown function (DUF871); InterPro: IPR008589 This family consists of several conserved hypothetical proteins from bacteria and archaea Back     alignment and domain information
>cd06565 GH20_GcnA-like Glycosyl hydrolase family 20 (GH20) catalytic domain of N-acetyl-beta-D-glucosaminidase (GcnA, also known as BhsA) and related proteins Back     alignment and domain information
>PLN02447 1,4-alpha-glucan-branching enzyme Back     alignment and domain information
>TIGR01531 glyc_debranch glycogen debranching enzymye Back     alignment and domain information
>PRK12313 glycogen branching enzyme; Provisional Back     alignment and domain information
>COG5309 Exo-beta-1,3-glucanase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02402 trehalose_TreZ malto-oligosyltrehalose trehalohydrolase Back     alignment and domain information
>PF01261 AP_endonuc_2: Xylose isomerase-like TIM barrel; InterPro: IPR012307 This TIM alpha/beta barrel structure is found in xylose isomerase (P19148 from SWISSPROT) and in endonuclease IV (P12638 from SWISSPROT, 3 Back     alignment and domain information
>cd02742 GH20_hexosaminidase Beta-N-acetylhexosaminidases of glycosyl hydrolase family 20 (GH20) catalyze the removal of beta-1,4-linked N-acetyl-D-hexosamine residues from the non-reducing ends of N-acetyl-beta-D-hexosaminides including N-acetylglucosides and N-acetylgalactosides Back     alignment and domain information
>PF12876 Cellulase-like: Sugar-binding cellulase-like; InterPro: IPR024778 O-Glycosyl hydrolases 3 Back     alignment and domain information
>cd06568 GH20_SpHex_like A subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the N-acetylhexosaminidase from Streptomyces plicatus (SpHex) Back     alignment and domain information
>cd06563 GH20_chitobiase-like The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin Back     alignment and domain information
>cd06564 GH20_DspB_LnbB-like Glycosyl hydrolase family 20 (GH20) catalytic domain of dispersin B (DspB), lacto-N-biosidase (LnbB) and related proteins Back     alignment and domain information
>PRK10785 maltodextrin glucosidase; Provisional Back     alignment and domain information
>TIGR02104 pulA_typeI pullulanase, type I Back     alignment and domain information
>PLN02960 alpha-amylase Back     alignment and domain information
>PRK09856 fructoselysine 3-epimerase; Provisional Back     alignment and domain information
>TIGR00542 hxl6Piso_put hexulose-6-phosphate isomerase, putative Back     alignment and domain information
>PF03659 Glyco_hydro_71: Glycosyl hydrolase family 71 ; InterPro: IPR005197 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF02065 Melibiase: Melibiase; InterPro: IPR000111 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PRK13210 putative L-xylulose 5-phosphate 3-epimerase; Reviewed Back     alignment and domain information
>PRK01060 endonuclease IV; Provisional Back     alignment and domain information
>PRK10933 trehalose-6-phosphate hydrolase; Provisional Back     alignment and domain information
>PRK13398 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>PF13200 DUF4015: Putative glycosyl hydrolase domain Back     alignment and domain information
>COG3589 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF02679 ComA: (2R)-phospho-3-sulfolactate synthase (ComA); InterPro: IPR003830 Methanogenic archaea produce methane via the anaerobic reduction of acetate or single carbon compounds [] Back     alignment and domain information
>TIGR02403 trehalose_treC alpha,alpha-phosphotrehalase Back     alignment and domain information
>PRK09505 malS alpha-amylase; Reviewed Back     alignment and domain information
>PF02837 Glyco_hydro_2_N: Glycosyl hydrolases family 2, sugar binding domain; InterPro: IPR006104 O-Glycosyl hydrolases 3 Back     alignment and domain information
>TIGR03849 arch_ComA phosphosulfolactate synthase Back     alignment and domain information
>TIGR03234 OH-pyruv-isom hydroxypyruvate isomerase Back     alignment and domain information
>smart00812 Alpha_L_fucos Alpha-L-fucosidase Back     alignment and domain information
>TIGR02103 pullul_strch alpha-1,6-glucosidases, pullulanase-type Back     alignment and domain information
>PLN02361 alpha-amylase Back     alignment and domain information
>TIGR02456 treS_nterm trehalose synthase Back     alignment and domain information
>PF07488 Glyco_hydro_67M: Glycosyl hydrolase family 67 middle domain; InterPro: IPR011100 Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans Back     alignment and domain information
>cd04908 ACT_Bt0572_1 N-terminal ACT domain of a novel protein composed almost entirely of two tandem ACT domains Back     alignment and domain information
>TIGR02100 glgX_debranch glycogen debranching enzyme GlgX Back     alignment and domain information
>cd06593 GH31_xylosidase_YicI YicI alpha-xylosidase is a glycosyl hydrolase family 31 (GH31) enzyme that catalyzes the release of an alpha-xylosyl residue from the non-reducing end of alpha-xyloside substrates such as alpha-xylosyl fluoride and isoprimeverose Back     alignment and domain information
>PRK03705 glycogen debranching enzyme; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query323
3thc_A 654 Crystal Structure Of Human Beta-Galactosidase In Co 3e-54
4e8c_A 595 Crystal Structure Of Streptococcal Beta-Galactosida 9e-32
3d3a_A 612 Crystal Structure Of A Beta-Galactosidase From Bact 8e-29
1tg7_A 971 Native Structure Of Beta-Galactosidase From Penicil 2e-19
3og2_A 1003 Native Crystal Structure Of Trichoderma Reesei Beta 3e-19
>pdb|3THC|A Chain A, Crystal Structure Of Human Beta-Galactosidase In Complex With Galactose Length = 654 Back     alignment and structure 
Iteration: 1

 Score =  208 bits (530), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 106/246 (43%), Positives = 150/246 (60%), Gaps = 2/246 (0%)
Query: 67  RARMSRTFAIDLAGDTFRLNEDPFQFVSGSFHYFRAPPGRWCWIMRAMRAAGLNALSTYV 126
           R    R F ID + D+F  +  PF+++SGS HY R P   W   +  M+ AGLNA+ TYV
Sbjct: 2   RNATQRMFEIDYSRDSFLKDGQPFRYISGSIHYSRVPRFYWKDRLLKMKMAGLNAIQTYV 61
Query: 127 EWRSHEVHPGHYHYDGHRDIEHFLQLAVEEDLYILLRPGPFICGKRDFGGFPPWLLKVAP 186
            W  HE  PG Y +    D+E+FL+LA E  L ++LRPGP+IC + + GG P WLL+   
Sbjct: 62  PWNFHEPWPGQYQFSEDHDVEYFLRLAHELGLLVILRPGPYICAEWEMGGLPAWLLE-KE 120
Query: 187 DILLRQNHPVYQRYVTRWFQELFPRIQKYLYGNDRPIILVQVENEYGSDAECDPAHAVWL 246
            ILLR + P Y   V +W   L P+++  LY N  P+I VQVENEYGS   CD  +  +L
Sbjct: 121 SILLRSSDPDYLAAVDKWLGVLLPKMKPLLYQNGGPVITVQVENEYGSYFACDFDYLRFL 180
Query: 247 RDLLRTYVQDKAVLYSTDGAFDAYLRC-TVDGVYSTVDFTVFKDVNVSFQAQRTRAPQGP 305
           +   R ++ D  VL++TDGA   +L+C  + G+Y+TVDF    ++  +F +QR   P+GP
Sbjct: 181 QKRFRHHLGDDVVLFTTDGAHKTFLKCGALQGLYTTVDFGTGSNITDAFLSQRKCEPKGP 240
Query: 306 LVNAEF 311
           L+N+EF
Sbjct: 241 LINSEF 246
>pdb|4E8C|A Chain A, Crystal Structure Of Streptococcal Beta-Galactosidase In Complex With Galactose Length = 595 Back     alignment and structure
>pdb|3D3A|A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron Length = 612 Back     alignment and structure
>pdb|1TG7|A Chain A, Native Structure Of Beta-Galactosidase From Penicillium Sp. Length = 971 Back     alignment and structure
>pdb|3OG2|A Chain A, Native Crystal Structure Of Trichoderma Reesei Beta-Galactosidase Length = 1003 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query323
3thd_A 654 Beta-galactosidase; TIM-barrel domain, glycosyl hy 1e-71
3thd_A654 Beta-galactosidase; TIM-barrel domain, glycosyl hy 2e-13
3d3a_A 612 Beta-galactosidase; protein structure initiative I 1e-68
3d3a_A612 Beta-galactosidase; protein structure initiative I 4e-14
4e8d_A 595 Glycosyl hydrolase, family 35; TIM barrel, beta-pr 4e-64
4e8d_A595 Glycosyl hydrolase, family 35; TIM barrel, beta-pr 2e-13
3og2_A 1003 Beta-galactosidase; TIM barrel domain, glycoside h 6e-60
3og2_A1003 Beta-galactosidase; TIM barrel domain, glycoside h 7e-05
1tg7_A 971 Beta-galactosidase; TIM barrel domain, glycoside h 6e-58
1tg7_A971 Beta-galactosidase; TIM barrel domain, glycoside h 2e-05
3u7v_A 552 Beta-galactosidase; structural genomics, PSI-biolo 4e-39
3tty_A 675 Beta-GAL, beta-galactosidase; TIM barrel, glycosid 3e-10
1kwg_A 645 Beta-galactosidase; TIM barrel, glycoside hydrolas 1e-09
>3thd_A Beta-galactosidase; TIM-barrel domain, glycosyl hydrolase, glycosylation, hydrolase; HET: NAG DGJ; 1.79A {Homo sapiens} PDB: 3thc_A* Length = 654 Back     alignment and structure
 Score =  233 bits (594), Expect = 1e-71
 Identities = 105/241 (43%), Positives = 149/241 (61%), Gaps = 2/241 (0%)

Query: 72  RTFAIDLAGDTFRLNEDPFQFVSGSFHYFRAPPGRWCWIMRAMRAAGLNALSTYVEWRSH 131
           R F ID + D+F  +  PF+++SGS HY R P   W   +  M+ AGLNA+ TYV W  H
Sbjct: 7   RMFEIDYSRDSFLKDGQPFRYISGSIHYSRVPRFYWKDRLLKMKMAGLNAIQTYVPWNFH 66

Query: 132 EVHPGHYHYDGHRDIEHFLQLAVEEDLYILLRPGPFICGKRDFGGFPPWLLKVAPDILLR 191
           E  PG Y +    D+E+FL+LA E  L ++LRPGP+IC + + GG P WLL+    ILLR
Sbjct: 67  EPWPGQYQFSEDHDVEYFLRLAHELGLLVILRPGPYICAEWEMGGLPAWLLEK-ESILLR 125

Query: 192 QNHPVYQRYVTRWFQELFPRIQKYLYGNDRPIILVQVENEYGSDAECDPAHAVWLRDLLR 251
            + P Y   V +W   L P+++  LY N  P+I VQVENEYGS   CD  +  +L+   R
Sbjct: 126 SSDPDYLAAVDKWLGVLLPKMKPLLYQNGGPVITVQVENEYGSYFACDFDYLRFLQKRFR 185

Query: 252 TYVQDKAVLYSTDGAFDAYLRC-TVDGVYSTVDFTVFKDVNVSFQAQRTRAPQGPLVNAE 310
            ++ D  VL++TDGA   +L+C  + G+Y+TVDF    ++  +F +QR   P+GPL+N+E
Sbjct: 186 HHLGDDVVLFTTDGAHKTFLKCGALQGLYTTVDFGTGSNITDAFLSQRKCEPKGPLINSE 245

Query: 311 F 311
           F
Sbjct: 246 F 246
>3thd_A Beta-galactosidase; TIM-barrel domain, glycosyl hydrolase, glycosylation, hydrolase; HET: NAG DGJ; 1.79A {Homo sapiens} PDB: 3thc_A* Length = 654 Back     alignment and structure
>3d3a_A Beta-galactosidase; protein structure initiative II, PSI II, NYSGXRC, 11092F, structural genomics; 2.15A {Bacteroides thetaiotaomicron vpi-5482} Length = 612 Back     alignment and structure
>3d3a_A Beta-galactosidase; protein structure initiative II, PSI II, NYSGXRC, 11092F, structural genomics; 2.15A {Bacteroides thetaiotaomicron vpi-5482} Length = 612 Back     alignment and structure
>4e8d_A Glycosyl hydrolase, family 35; TIM barrel, beta-propeller, glycohydrolase; 1.80A {Streptococcus pneumoniae} PDB: 4e8c_A Length = 595 Back     alignment and structure
>4e8d_A Glycosyl hydrolase, family 35; TIM barrel, beta-propeller, glycohydrolase; 1.80A {Streptococcus pneumoniae} PDB: 4e8c_A Length = 595 Back     alignment and structure
>3og2_A Beta-galactosidase; TIM barrel domain, glycoside hydrolase, family 35, glycoprot hydrolase; HET: NAG BMA MAN GLC; 1.20A {Trichoderma reesei} PDB: 3ogr_A* 3ogs_A* 3ogv_A* Length = 1003 Back     alignment and structure
>3og2_A Beta-galactosidase; TIM barrel domain, glycoside hydrolase, family 35, glycoprot hydrolase; HET: NAG BMA MAN GLC; 1.20A {Trichoderma reesei} PDB: 3ogr_A* 3ogs_A* 3ogv_A* Length = 1003 Back     alignment and structure
>1tg7_A Beta-galactosidase; TIM barrel domain, glycoside hydrolase, family GH35, glycopr penicillium, hydrolase; HET: NAG BMA MAN; 1.90A {Penicillium SP} SCOP: b.149.1.1 b.18.1.27 b.18.1.27 b.71.1.5 c.1.8.14 PDB: 1xc6_A* Length = 971 Back     alignment and structure
>1tg7_A Beta-galactosidase; TIM barrel domain, glycoside hydrolase, family GH35, glycopr penicillium, hydrolase; HET: NAG BMA MAN; 1.90A {Penicillium SP} SCOP: b.149.1.1 b.18.1.27 b.18.1.27 b.71.1.5 c.1.8.14 PDB: 1xc6_A* Length = 971 Back     alignment and structure
>3u7v_A Beta-galactosidase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, TIM barrel, glyco_hydro_42; HET: MSE; 1.80A {Caulobacter crescentus} Length = 552 Back     alignment and structure
>3tty_A Beta-GAL, beta-galactosidase; TIM barrel, glycoside hydrolase, hydrolase; HET: GLA; 2.25A {Bacillus circulans subsp} PDB: 3tts_A* Length = 675 Back     alignment and structure
>1kwg_A Beta-galactosidase; TIM barrel, glycoside hydrolase family 42, trimer, hydrolase; 1.60A {Thermus thermophilus} SCOP: b.71.1.1 c.1.8.1 c.23.16.5 PDB: 1kwk_A* Length = 645 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query323
3thd_A 654 Beta-galactosidase; TIM-barrel domain, glycosyl hy 100.0
4e8d_A 595 Glycosyl hydrolase, family 35; TIM barrel, beta-pr 100.0
3og2_A 1003 Beta-galactosidase; TIM barrel domain, glycoside h 100.0
1tg7_A 971 Beta-galactosidase; TIM barrel domain, glycoside h 100.0
3d3a_A 612 Beta-galactosidase; protein structure initiative I 100.0
3u7v_A 552 Beta-galactosidase; structural genomics, PSI-biolo 100.0
3tty_A 675 Beta-GAL, beta-galactosidase; TIM barrel, glycosid 99.93
1vem_A 516 Beta-amylase; beta-alpha-barrels, optimum PH, hydr 99.92
3pzg_A383 Mannan endo-1,4-beta-mannosidase. glycosyl hydrol 99.9
1kwg_A 645 Beta-galactosidase; TIM barrel, glycoside hydrolas 99.9
1rh9_A373 Endo-beta-mannanase; endo-beta-mannase, retaining, 99.88
4e8d_A595 Glycosyl hydrolase, family 35; TIM barrel, beta-pr 99.85
3thd_A654 Beta-galactosidase; TIM-barrel domain, glycosyl hy 99.85
3d3a_A612 Beta-galactosidase; protein structure initiative I 99.83
1qnr_A344 Endo-1,4-B-D-mannanase; hydrolase, anomalous scatt 99.82
1uuq_A 440 Mannosyl-oligosaccharide glucosidase; hydrolase, m 99.82
3fn9_A 692 Putative beta-galactosidase; structural genomics, 99.81
2osx_A 481 Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel 99.81
3cmg_A 667 Putative beta-galactosidase; structural genomics, 99.81
3lpf_A605 Beta-glucuronidase; alpha/beta barrel, sugar-bindi 99.78
3gm8_A 801 Glycoside hydrolase family 2, candidate beta-GLYC; 99.77
3hn3_A613 Beta-G1, beta-glucuronidase; lysosomal enzyme, aci 99.75
2w61_A 555 GAS2P, glycolipid-anchored surface protein 2; glyc 99.72
1yq2_A 1024 Beta-galactosidase; glycosyl hydrolase family 2, T 99.72
3vup_A351 Beta-1,4-mannanase; TIM barrel, digestive fluid, H 99.71
4hty_A359 Cellulase; (alpha/beta)8 barrel, family 5 endogluc 99.71
2c0h_A353 Mannan endo-1,4-beta-mannosidase; hydrolase, signa 99.7
4awe_A387 Endo-beta-D-1,4-mannanase; hydrolase, endo-mannana 99.68
3oba_A 1032 Beta-galactosidase; TIM barrel, tetramer, GH2, gly 99.66
1tvn_A293 Cellulase, endoglucanase G; glycoside hydrolase, C 99.65
1egz_A291 Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CL 99.65
3pzt_A327 Endoglucanase; alpha/beta barrel, glycosyl hydrola 99.63
1ece_A358 Endocellulase E1; glycosyl hydrolase; HET: BGC; 2. 99.62
1bqc_A302 Protein (beta-mannanase); glycosyl hydrolase, fami 99.6
1jz7_A 1023 Lactase, beta-galactosidase, LACZ; TIM barrel (alp 99.58
3bga_A 1010 Beta-galactosidase; NYSGXRC, protein structure ini 99.58
3aof_A317 Endoglucanase; glycosyl hydrolase family 5, cellul 99.57
3jug_A345 Beta-mannanase; TIM-barrel, glycosidase, hydrolase 99.56
2whl_A294 Beta-mannanase, baman5; glycoside hydrolase, hydro 99.55
3nco_A320 Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1 99.54
7a3h_A303 Endoglucanase; hydrolase, cellulose degradation, g 99.54
1vjz_A341 Endoglucanase; TM1752, structural genomics, JCSG, 99.52
1edg_A380 Endoglucanase A; family A, cellulases, xylanases, 99.46
3qho_A 458 Endoglucanase, 458AA long hypothetical endo-1,4-be 99.46
2cks_A306 Endoglucanase E-5; carbohydrate metabolism, polysa 99.46
1wcg_A 464 Thioglucosidase, myrosinase; aphid, beta-glucosida 99.46
1vff_A 423 Beta-glucosidase; glycosyl hydrolase, membrane-bou 99.45
3ndz_A345 Endoglucanase D; cellotriose, xylanase, carbohydra 99.45
1qox_A 449 Beta-glucosidase; hydrolase, cellulose degradation 99.43
1h4p_A 408 Glucan 1,3-beta-glucosidase I/II; hydrolase, gluca 99.43
1h1n_A305 Endo type cellulase ENGI; hydrolase, glycosyl hydr 99.43
3ahy_A 473 Beta-glucosidase; cellulases, glycosyl hydrolase, 99.42
1v08_A 512 Beta-glucosidase; glycoside hydrolase, dimboa-gluc 99.42
2je8_A 848 Beta-mannosidase; glycoside hydrolase, hydrolase; 99.41
2o9p_A 454 Beta-glucosidase B; family 1 glycoside hydrolase; 99.41
2jf7_A 532 Strictosidine-O-beta-D-glucosidase; alkaloid, hydr 99.4
1e4m_M 501 Myrosinase MA1; hydrolase, family 1 glycosyl hydro 99.4
1xyz_A347 1,4-beta-D-xylan-xylanohydrolase; glycosyl hydrola 99.4
1ceo_A 343 Cellulase CELC; glycosyl hydrolase, family A/5 of 99.39
2e9l_A 469 Cytosolic beta-glucosidase; novel cytosolic neutra 99.39
3ahx_A 453 Beta-glucosidase A; cellulases, glycosyl hydrolase 99.39
1wky_A 464 Endo-beta-1,4-mannanase; TIM barrel, catalytic dom 99.39
3l55_A353 B-1,4-endoglucanase/cellulase; putative beta-1,4-e 99.39
3cui_A315 EXO-beta-1,4-glucanase; CEX, xylanase, isofagomine 99.39
2e3z_A 465 Beta-glucosidase; TIM barrel, glycoside hydrolase 99.38
3n9k_A 399 Glucan 1,3-beta-glucosidase; aromatic entranceway/ 99.38
3fj0_A 465 Beta-glucosidase; BGLB,BGL, hydrolase, glycosidase 99.38
2dga_A 565 Beta-glucosidase; alpha/beta barrel, hydrolase; 1. 99.37
1cbg_A 490 Cyanogenic beta-glucosidase; hydrolase (O-glycosyl 99.36
1e4i_A 447 Beta-glucosidase; hydrolase, family 1 glycosyl hyd 99.36
2j78_A 468 Beta-glucosidase A; family 1, hydrolase, inhibitor 99.36
2jep_A 395 Xyloglucanase; family 5, plant cell WALL, hydrolas 99.36
4b3l_A 479 Beta-glucosidase; hydrolase, glycosidase, carbohyd 99.36
3icg_A 515 Endoglucanase D; cellulase, xylanase, carbohydrate 99.35
3apg_A 473 Beta-glucosidase; TIM barrel, hydrolase, sugar bin 99.35
2uwf_A356 Endoxylanase, alkaline active endoxylanase; hydrol 99.35
3gnp_A 488 OS03G0212800 protein; beta-alpha barrel, glycosida 99.34
3f5l_A 481 Beta-glucosidase; beta-alpha-barrels, glycosidase, 99.34
1qvb_A 481 Beta-glycosidase; TIM-barrel, thermostable, hydrol 99.34
2xhy_A 479 BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, 99.33
1v02_A 565 Dhurrinase, dhurrinase-1; beta-glucosidase, dhurri 99.33
2dep_A356 Xylanase B, thermostable celloxylanase; glycosidas 99.32
1pbg_A 468 PGAL, 6-phospho-beta-D-galactosidase; hydrolase (g 99.32
3ayr_A 376 Endoglucanase; TIM barrel, hydrolase, carbohydrate 99.32
2vzs_A 1032 CSXA, EXO-beta-D-glucosaminidase; hydrolase, GH2, 99.32
3ta9_A 458 Glycoside hydrolase family 1; TIM barrel, glucosid 99.32
1ug6_A 431 Beta-glycosidase; glucosidase, atomic resolution, 99.32
1n82_A331 Xylanase, intra-cellular xylanase; hydrolase; 1.45 99.31
4hz8_A 444 Beta-glucosidase; BGLB,BGL, hydrolase, glycosid ba 99.31
3ptm_A 505 Beta-glucosidase OS4BGlu12; beta-alpha barrel, gly 99.3
3vii_A 487 Beta-glucosidase; cellulases, glycosyl hydrolase, 99.3
1g01_A 364 Endoglucanase; alpha/beta barrel, TIM barrel, hydr 99.3
3qr3_A340 Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A 99.3
1us2_A 530 Xylanase10C, endo-beta-1,4-xylanase; hydrolase, ca 99.3
3qom_A 481 6-phospho-beta-glucosidase; structural genomics, P 99.3
1v0l_A313 Endo-1,4-beta-xylanase A; glycoside hydrolase fami 99.3
1nq6_A302 XYS1; glycoside hydrolase family 10, xylanase, xyl 99.29
1gnx_A 479 Beta-glucosidase; hydrolase, glycosyltransferase, 99.28
4atd_A 513 Raucaffricine-O-beta-D-glucosidase; alkaloid, hydr 99.28
4a3y_A 540 Raucaffricine-O-beta-D-glucosidase; hydrolase, alk 99.27
4dde_A 480 6-phospho-beta-glucosidase; structural genomics, P 99.26
1ur1_A 378 Endoxylanase; hydrolase, family 10, glycoside hydr 99.26
1ta3_B303 Endo-1,4-beta-xylanase; beta alpha barrel (XIP-I), 99.25
2d1z_A 436 Endo-1,4-beta-D-xylanase; TIM-barrel, retaining en 99.25
1r85_A 379 Endo-1,4-beta-xylanase; hydrolase; HET: GOL; 1.45A 99.24
2y8k_A 491 Arabinoxylanase, carbohydrate binding family 6; hy 99.2
1i1w_A303 Endo-1,4-beta-xylanase; xylan degradation, hydrola 99.18
1uwi_A 489 Beta-galactosidase; hydrolase, beta-glycosidase, g 99.17
1w32_A348 Endo-1,4-beta-xylanase A precursor; mutant, calciu 99.17
4ha4_A 489 Beta-galactosidase; TIM barrel, beta-glycosidase, 99.13
1fob_A 334 Beta-1,4-galactanase; B/A barrel, glycosyl hydrola 99.12
3civ_A343 Endo-beta-1,4-mannanase; TIM barrel, hydrolase; 1. 99.04
1hjs_A332 Beta-1,4-galactanase; 4-galactanases, family 53 gl 98.96
1ur4_A 399 Galactanase; hydrolase, beta-1, glycoside hydrolas 98.89
1tg7_A971 Beta-galactosidase; TIM barrel domain, glycoside h 98.82
3kzs_A 463 Glycosyl hydrolase family 5; structural genomics, 98.72
3emz_A331 Xylanase, endo-1,4-beta-xylanase; (alpha/beta)8 ba 98.72
1w91_A 503 Beta-xylosidase; MAD, seMet, tetramer, hydrolase; 98.69
1uhv_A 500 Beta-xylosidase; family 39 glycoside hydrolase, xy 98.61
3niy_A341 Endo-1,4-beta-xylanase; TIM-barrel, hydrolase; 1.5 98.53
1wdp_A 495 Beta-amylase; (beta/alpha)8 barrel, hydrolase; 1.2 98.49
4f8x_A335 Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET 98.49
3u7b_A327 Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET 98.48
2xfr_A 535 Beta-amylase; hydrolase, carbohydrate metabolism, 98.46
1fa2_A 498 Beta-amylase; TIM barrel, hydrolase; HET: DOM; 2.3 98.45
4ekj_A 500 Beta-xylosidase; TIM-barrel fold, hemicellulase, h 98.38
4h41_A340 Putative alpha-L-fucosidase; hydrolase, carbohydra 98.36
3ro8_A341 Endo-1,4-beta-xylanase; glycosyl hydrolase family 98.13
2w5f_A540 Endo-1,4-beta-xylanase Y; cellulosome, glycosidase 98.11
2nt0_A 497 Glucosylceramidase; cerezyme, glucocerebrosidase, 97.56
3clw_A 507 Conserved exported protein; structural genomics, u 97.45
2wnw_A 447 Activated by transcription factor SSRB; hydrolase, 97.43
3zr5_A 656 Galactocerebrosidase; hydrolase, GALC, glycosyl hy 97.15
3gyc_A 393 Putative glycoside hydrolase; YP_001304622.1, stru 96.87
3kl0_A 401 Glucuronoxylanase XYNC; alpha beta barrel, (beta/a 96.53
2y24_A 383 Xylanase; hydrolase, GH5 family, aldotetraouronic 96.5
3og2_A1003 Beta-galactosidase; TIM barrel domain, glycoside h 95.22
1ghs_A 306 1,3-beta-glucanase; hydrolase; 2.30A {Hordeum vulg 95.15
1ua7_A 422 Alpha-amylase; beta-alpha-barrels, acarbose, greek 94.52
3dhu_A 449 Alpha-amylase; structural genomics, hydrolase, gly 93.83
3k1d_A 722 1,4-alpha-glucan-branching enzyme; mycobacterium t 93.57
2cyg_A 312 Beta-1, 3-glucananse; endo-beta-1,3-glucanase, (be 93.37
3ur8_A 323 Glucan endo-1,3-beta-D-glucosidase; glucoside hydr 93.35
1aq0_A 306 1,3-1,4-beta-glucanase; hydrolase, glycosidase, gl 93.32
3mi6_A 745 Alpha-galactosidase; NESG, structural genomics, PS 93.13
3zss_A 695 Putative glucanohydrolase PEP1A; alpha-glucan bios 92.87
1hvx_A 515 Alpha-amylase; hydrolase, glycosyltransferase, the 92.71
2yfo_A 720 Alpha-galactosidase-sucrose kinase agask; hydrolas 92.59
1g94_A 448 Alpha-amylase; beta-alpha-8-barrel, 3 domain struc 92.55
4gqr_A 496 Pancreatic alpha-amylase; glycosyl hydrolase, diab 92.53
3bh4_A 483 Alpha-amylase; calcium, carbohydrate metabolism, g 92.2
2p0o_A 372 Hypothetical protein DUF871; structural genomics, 91.83
1wpc_A 485 Glucan 1,4-alpha-maltohexaosidase; maltohexaose-pr 91.61
1gqi_A 708 Alpha-glucuronidase; (alpha-beta)8 barrel, glycosi 91.57
1gcy_A 527 Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-b 91.38
1mxg_A 435 Alpha amylase; hyperthermostable, family 13 glycos 91.23
1ud2_A 480 Amylase, alpha-amylase; calcium-free, alkaline, hy 91.19
3edf_A 601 FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin c 91.14
1lwj_A 441 4-alpha-glucanotransferase; alpha-amylase family, 90.96
1ht6_A 405 AMY1, alpha-amylase isozyme 1; barley, beta-alpha- 90.91
4aie_A 549 Glucan 1,6-alpha-glucosidase; hydrolase, glycoside 90.8
2y2w_A 574 Arabinofuranosidase; hydrolase, arabinoxylan, glyc 90.61
2z1k_A 475 (NEO)pullulanase; hydrolase, structural genomics, 90.19
3bc9_A 599 AMYB, alpha amylase, catalytic region; acarbose, t 89.91
3m07_A 618 Putative alpha amylase; IDP00968, csgid, structura 89.9
1jae_A 471 Alpha-amylase; glycosidase, carbohydrate metabolis 89.89
2guy_A 478 Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; 89.44
2wc7_A 488 Alpha amylase, catalytic region; CD/PUL-hydrolyzin 89.44
2ze0_A 555 Alpha-glucosidase; TIM barrel, glucoside hydrolase 89.16
1x7f_A 385 Outer surface protein; structural genomics, unknow 89.13
3ktc_A333 Xylose isomerase; putative sugar isomerase, struct 88.93
1qw9_A 502 Arabinosidase, alpha-L-arabinofuranosidase; hydrol 88.86
4aef_A 645 Neopullulanase (alpha-amylase II); hydrolase, ther 88.75
3faw_A 877 Reticulocyte binding protein; TIM barrel, beta bar 88.67
1gjw_A 637 Maltodextrin glycosyltransferase; alpha-amylase, m 88.44
2aaa_A 484 Alpha-amylase; glycosidase; 2.10A {Aspergillus nig 88.31
1j0h_A 588 Neopullulanase; beta-alpha-barrels, hydrolase; 1.9 88.31
2dh2_A 424 4F2 cell-surface antigen heavy chain; TIM-barrel, 88.2
1wzl_A 585 Alpha-amylase II; pullulan, GH-13, alpha-amylase f 88.16
1qtw_A285 Endonuclease IV; DNA repair enzyme, TIM barrel, tr 88.12
1zja_A 557 Trehalulose synthase; sucrose isomerase, alpha-amy 88.09
1m53_A 570 Isomaltulose synthase; klebsiella SP. LX3, sucrose 88.03
2c7f_A 513 Alpha-L-arabinofuranosidase; glycosidase, xylan, a 87.94
2xn2_A 732 Alpha-galactosidase; hydrolase, glycosidase; HET: 87.91
2e8y_A 718 AMYX protein, pullulanase; multiple domain, beta-a 87.57
1ea9_C 583 Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A 87.39
2v5c_A 594 O-GLCNACASE NAGJ; glycosidase, GH84, GH84C, hydrol 87.33
4aio_A 884 Limit dextrinase; hydrolase, pullulanase, glycosid 87.31
1m7x_A 617 1,4-alpha-glucan branching enzyme; alpha/beta barr 87.22
4aee_A 696 Alpha amylase, catalytic region; hydrolase, hypert 86.99
1qho_A 686 Alpha-amylase; glycoside hydrolase, starch degrada 86.85
2zic_A 543 Dextran glucosidase; TIM barrel, (beta/alpha)8-bar 86.54
1zy9_A 564 Alpha-galactosidase; TM1192, struc genomics, joint 85.97
2wan_A 921 Pullulanase; hydrolase, glycoside hydrolase, polys 85.83
3vgf_A 558 Malto-oligosyltrehalose trehalohydrolase; alpha/be 85.65
3aj7_A 589 Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydro 85.6
2ya0_A 714 Putative alkaline amylopullulanase; hydrolase, gly 85.44
1uok_A 558 Oligo-1,6-glucosidase; sugar degradation, hydrolas 85.14
3em5_A 316 Beta-1,3-glucanase; glycoprotein, rossmann fold, ( 85.11
3czg_A 644 Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 85.06
2bhu_A 602 Maltooligosyltrehalose trehalohydrolase; alpha-amy 84.76
1wza_A 488 Alpha-amylase A; hydrolase, halophilic, thermophil 84.61
4acy_A382 Endo-alpha-mannosidase; hydrolase, endomannosidase 84.32
1g5a_A 628 Amylosucrase; glycosyltransferase, glycoside hydro 84.28
3kws_A287 Putative sugar isomerase; structural genomics, joi 83.98
2x7v_A287 Probable endonuclease 4; DNA repair protein, metal 83.43
1l8n_A 679 Alpha-D-glucuronidase; hydrolase; HET: GCW XYP; 1. 83.17
3aam_A270 Endonuclease IV, endoiv; DNA repair, base excision 82.93
1bf2_A 750 Isoamylase; hydrolase, glycosidase, debranching en 82.73
3aml_A 755 OS06G0726400 protein; starch-branching, transferas 82.6
1cyg_A 680 Cyclodextrin glucanotransferase; glycosyltransfera 82.46
4ad1_A380 Glycosyl hydrolase family 71; glycoside hydrolase 82.33
3ucq_A 655 Amylosucrase; thermostability, amylose synthesis, 82.28
3p14_A 424 L-rhamnose isomerase; TIM barrel; 2.51A {Bacillus 81.55
3gh5_A525 HEX1, beta-hexosaminidase; beta-N-acetylhexosamini 81.46
2vr5_A 718 Glycogen operon protein GLGX; hydrolase, glycosida 81.3
1qwg_A251 PSL synthase;, (2R)-phospho-3-sulfolactate synthas 81.18
3cqj_A295 L-ribulose-5-phosphate 3-epimerase ULAE; TIM-barre 81.07
1d3c_A 686 Cyclodextrin glycosyltransferase; alpha-amylase, p 81.0
3ug3_A 504 Alpha-L-arabinofuranosidase; TIM barrel, hydrolase 80.9
1ji1_A 637 Alpha-amylase I; beta/alpha barrel, hydrolase; 1.6 80.56
2vrq_A 496 Alpha-L-arabinofuranosidase; hydrolase, glycosidas 80.55
1yht_A367 DSPB; beta barrel, hydrolase; 2.00A {Aggregatibact 80.24
3vni_A294 Xylose isomerase domain protein TIM barrel; D-psic 80.15
2ya1_A 1014 Putative alkaline amylopullulanase; hydrolase, gly 80.04
>3thd_A Beta-galactosidase; TIM-barrel domain, glycosyl hydrolase, glycosylation, hydrolase; HET: NAG DGJ; 1.79A {Homo sapiens} PDB: 3thc_A* Back     alignment and structure
Probab=100.00  E-value=1.6e-75  Score=598.77  Aligned_cols=253  Identities=42%  Similarity=0.796  Sum_probs=244.2

Q ss_pred             cccceEEEEecCCeEEeCCeeeEEeeeeecCCCCChhcHHHHHHHHHHhCCCEEEEEEeCCCcccCCCeecccccchHHH
Q psy13819         69 RMSRTFAIDLAGDTFRLNEDPFQFVSGSFHYFRAPPGRWCWIMRAMRAAGLNALSTYVEWRSHEVHPGHYHYDGHRDIEH  148 (323)
Q Consensus        69 ~~~~~~~v~~~~~~~~~dGk~~~i~~g~~Hy~r~p~~~W~~~l~~mk~~G~N~Vr~yv~W~~hEP~~G~fdf~g~~dl~~  148 (323)
                      ...|+|+|+||+++|++||||++++||++||+|+|+++|+++|++||++|+|+|++||+|+.|||+||+|||++..||++
T Consensus         4 ~~~r~~~v~~d~~~f~ldGkp~~i~sG~~Hy~r~p~~~W~d~l~kmKa~G~NtV~~yv~W~~hEP~~G~fdF~g~~DL~~   83 (654)
T 3thd_A            4 ATQRMFEIDYSRDSFLKDGQPFRYISGSIHYSRVPRFYWKDRLLKMKMAGLNAIQTYVPWNFHEPWPGQYQFSEDHDVEY   83 (654)
T ss_dssp             --CCCEEEETTTTEEEETTEEECCEEEECCGGGSCGGGHHHHHHHHHHTTCSEEEEECCHHHHCSBTTBCCCSGGGCHHH
T ss_pred             cCCCcEEEEEcCCEEEECCEEEEEEEEecccccCCHHHHHHHHHHHHHcCCCEEEEEechhhcCCCCCccCccchHHHHH
Confidence            45789999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHCCCeEEEccCCccccccCCCCCcccccccCCCeeecCCCHhHHHHHHHHHHHHHHHHHhhhccCCCcEEEEcc
Q psy13819        149 FLQLAVEEDLYILLRPGPFICGKRDFGGFPPWLLKVAPDILLRQNHPVYQRYVTRWFQELFPRIQKYLYGNDRPIILVQV  228 (323)
Q Consensus       149 fl~~a~e~GL~vilr~GPyi~aEw~~gg~P~Wl~~~~p~~~~R~~~~~f~~~~~~~~~~l~~~i~~~~~~n~g~Vi~~Qi  228 (323)
                      ||++|+|+||+|||||||||||||++||+|.||.++ |++.+|+++|.|++++++|+++|+++|+++|+++|||||||||
T Consensus        84 fl~~a~~~GL~ViLr~GPyi~aEw~~GG~P~WL~~~-p~i~~Rt~~p~y~~~~~~~~~~l~~~l~~~~~~~ggpVI~~Qv  162 (654)
T 3thd_A           84 FLRLAHELGLLVILRPGPYICAEWEMGGLPAWLLEK-ESILLRSSDPDYLAAVDKWLGVLLPKMKPLLYQNGGPVITVQV  162 (654)
T ss_dssp             HHHHHHHTTCEEEEECCSCCCTTBGGGGCCGGGGGS-TTCCSSSCCHHHHHHHHHHHHHHHHHHGGGBGGGTSSEEEEEC
T ss_pred             HHHHHHHcCCEEEeccCCccccccCCCcCChHHhcC-CCceEecCCHHHHHHHHHHHHHHHHHhhhhhccCCCCEEEEEe
Confidence            999999999999999999999999999999999984 9999999999999999999999999999999999999999999


Q ss_pred             CCCcCCCCCChHHHHHHHHHHHHHhcCCceEEEeeCCCCcccccc-ccCceEEeecCCCCCchhHHHHHHHhhCCCCCeE
Q psy13819        229 ENEYGSDAECDPAHAVWLRDLLRTYVQDKAVLYSTDGAFDAYLRC-TVDGVYSTVDFTVFKDVNVSFQAQRTRAPQGPLV  307 (323)
Q Consensus       229 eNE~g~~~~~~~~Y~~~l~~~~~~~~g~~~~l~t~dg~~~~~~~~-~~~g~~~~~nfg~~~~~~~~~~~~r~~~p~~Plm  307 (323)
                      |||||+|+.||++||++|++++++++|++|||||||+++...+.| +++|+++|+|||+.++++..|+.+++++|++|+|
T Consensus       163 ENEyG~y~~~d~~Ym~~l~~~~~~~~Gi~v~l~t~D~~~~~~~~~g~~~g~~~t~~f~~~~~~~~~~~~~~~~~p~~P~~  242 (654)
T 3thd_A          163 ENEYGSYFACDFDYLRFLQKRFRHHLGDDVVLFTTDGAHKTFLKCGALQGLYTTVDFGTGSNITDAFLSQRKCEPKGPLI  242 (654)
T ss_dssp             SSCGGGSSCCCHHHHHHHHHHHHHHHCSSSEEEEEEESSHHHHHHHCBTTBEEEEECCTTSCHHHHHHHHHHHCSSSCCE
T ss_pred             cccccccccccHHHHHHHHHHHHHhcCCceeeEeecCCccccccCCCcCCcceecccCCCccHHHHHHHHHHhCCCCCeE
Confidence            999999999999999999999999779999999999998777899 9999999999998777889999999999999999


Q ss_pred             EEEecccccccccCC
Q psy13819        308 NAEFEFFPMLLWAGM  322 (323)
Q Consensus       308 ~~E~~~gw~~~W~~~  322 (323)
                      +||||+||||+||+.
T Consensus       243 ~~Ef~~Gwfd~WG~~  257 (654)
T 3thd_A          243 NSEFYTGWLDHWGQP  257 (654)
T ss_dssp             EEEEESSCCCCTTSC
T ss_pred             EeccccccCCcCCCC
Confidence            999999999999974
>4e8d_A Glycosyl hydrolase, family 35; TIM barrel, beta-propeller, glycohydrolase; 1.80A {Streptococcus pneumoniae} PDB: 4e8c_A Back     alignment and structure
>3og2_A Beta-galactosidase; TIM barrel domain, glycoside hydrolase, family 35, glycoprot hydrolase; HET: NAG BMA MAN GLC; 1.20A {Trichoderma reesei} PDB: 3ogr_A* 3ogs_A* 3ogv_A* Back     alignment and structure
>1tg7_A Beta-galactosidase; TIM barrel domain, glycoside hydrolase, family GH35, glycopr penicillium, hydrolase; HET: NAG BMA MAN; 1.90A {Penicillium SP} SCOP: b.149.1.1 b.18.1.27 b.18.1.27 b.71.1.5 c.1.8.14 PDB: 1xc6_A* Back     alignment and structure
>3d3a_A Beta-galactosidase; protein structure initiative II, PSI II, NYSGXRC, 11092F, structural genomics; 2.15A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3u7v_A Beta-galactosidase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, TIM barrel, glyco_hydro_42; HET: MSE; 1.80A {Caulobacter crescentus} Back     alignment and structure
>3tty_A Beta-GAL, beta-galactosidase; TIM barrel, glycoside hydrolase, hydrolase; HET: GLA; 2.25A {Bacillus circulans subsp} PDB: 3tts_A* Back     alignment and structure
>1vem_A Beta-amylase; beta-alpha-barrels, optimum PH, hydrolase; HET: GLC; 1.85A {Bacillus cereus} SCOP: b.3.1.1 c.1.8.1 PDB: 1b90_A* 1j0y_A* 1j0z_A* 1j10_A* 1b9z_A* 1j12_A* 1j18_A* 1j11_A* 5bca_A 1veo_A* 1itc_A* 1ven_A* 1vep_A* 1cqy_A Back     alignment and structure
>3pzg_A Mannan endo-1,4-beta-mannosidase. glycosyl hydrol 5; alpha/beta barrel, glycosyl hydrolase, sugar binding, secret hydrolase; 1.40A {Thermotoga petrophila} PDB: 3pz9_A 3pzi_A* 3pzm_A 3pzn_A* 3pzo_A* 3pzq_A* Back     alignment and structure
>1kwg_A Beta-galactosidase; TIM barrel, glycoside hydrolase family 42, trimer, hydrolase; 1.60A {Thermus thermophilus} SCOP: b.71.1.1 c.1.8.1 c.23.16.5 PDB: 1kwk_A* Back     alignment and structure
>1rh9_A Endo-beta-mannanase; endo-beta-mannase, retaining, glycoside hydrolase family 5; 1.50A {Solanum lycopersicum} SCOP: c.1.8.3 Back     alignment and structure
>4e8d_A Glycosyl hydrolase, family 35; TIM barrel, beta-propeller, glycohydrolase; 1.80A {Streptococcus pneumoniae} PDB: 4e8c_A Back     alignment and structure
>3thd_A Beta-galactosidase; TIM-barrel domain, glycosyl hydrolase, glycosylation, hydrolase; HET: NAG DGJ; 1.79A {Homo sapiens} PDB: 3thc_A* Back     alignment and structure
>3d3a_A Beta-galactosidase; protein structure initiative II, PSI II, NYSGXRC, 11092F, structural genomics; 2.15A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1qnr_A Endo-1,4-B-D-mannanase; hydrolase, anomalous scattering; HET: NAG MAB; 1.4A {Trichoderma reesei} SCOP: c.1.8.3 PDB: 1qno_A* 1qnq_A* 1qnp_A* 1qns_A* Back     alignment and structure
>1uuq_A Mannosyl-oligosaccharide glucosidase; hydrolase, mannosidase, mannan, glycoside hydrolase, family 5; 1.5A {Cellvibrio mixtus} SCOP: c.1.8.3 PDB: 1uz4_A* Back     alignment and structure
>3fn9_A Putative beta-galactosidase; structural genomics, glycosidas hydrolase, PSI-2, protein structure initiative; 2.70A {Bacteroides fragilis} Back     alignment and structure
>2osx_A Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel, hydrolase; HET: SIA GAL BGC 16C; 1.10A {Rhodococcus SP} PDB: 2oyk_A* 2osw_A* 2oyl_A* 2oym_A* 2osy_A* Back     alignment and structure
>3cmg_A Putative beta-galactosidase; structural genomics, PSI-2, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides fragilis} Back     alignment and structure
>3lpf_A Beta-glucuronidase; alpha/beta barrel, sugar-binding domain, beta-sandwich domai glycosyl hydrolase, glycosida hydrolase; HET: Z77; 2.26A {Escherichia coli} PDB: 3k46_A* 3k4d_A* 3lpg_A* 3k4a_A Back     alignment and structure
>3gm8_A Glycoside hydrolase family 2, candidate beta-GLYC; structural genomics, glycosidase, PSI-2, protein initiative; 2.40A {Bacteroides vulgatus} Back     alignment and structure
>3hn3_A Beta-G1, beta-glucuronidase; lysosomal enzyme, acid hydrolase, glycosidase, disease mutat glycoprotein, hydrolase, lysosome, mucopolysaccharidosis; HET: NDG NAG BMA MAN GUP; 1.70A {Homo sapiens} PDB: 1bhg_A* Back     alignment and structure
>2w61_A GAS2P, glycolipid-anchored surface protein 2; glycoprotein, cell membrane, fungal cell WALL, transglycosyl glucan, membrane, GPI-anchor; 1.62A {Saccharomyces cerevisiae} PDB: 2w62_A* 2w63_A* Back     alignment and structure
>1yq2_A Beta-galactosidase; glycosyl hydrolase family 2, TIM barrel, hexamer; 1.90A {Arthrobacter SP} SCOP: b.1.4.1 b.1.4.1 b.18.1.5 b.30.5.1 c.1.8.3 Back     alignment and structure
>3vup_A Beta-1,4-mannanase; TIM barrel, digestive fluid, HYD; 1.05A {Aplysia kurodai} Back     alignment and structure
>4hty_A Cellulase; (alpha/beta)8 barrel, family 5 endoglucanase, hydrolase; 2.00A {Uncultured bacterium} PDB: 4hu0_A* Back     alignment and structure
>2c0h_A Mannan endo-1,4-beta-mannosidase; hydrolase, signal, TIM alpha/beta barrel; 1.6A {Mytilus edulis} SCOP: c.1.8.3 Back     alignment and structure
>4awe_A Endo-beta-D-1,4-mannanase; hydrolase, endo-mannanase, glycosyl hydrolase, GH5; HET: NAG; 1.40A {Neurospora sitophila} Back     alignment and structure
>3oba_A Beta-galactosidase; TIM barrel, tetramer, GH2, glycosidase, hydrolase; 2.75A {Kluyveromyces lactis} PDB: 3ob8_A Back     alignment and structure
>1tvn_A Cellulase, endoglucanase G; glycoside hydrolase, CLAN GH-A, family 5-2; 1.41A {Pseudoalteromonas haloplanktis} SCOP: c.1.8.3 PDB: 1tvp_A* Back     alignment and structure
>1egz_A Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CLAN GH-A, family 5-2, cellulase; 2.30A {Erwinia chrysanthemi} SCOP: c.1.8.3 Back     alignment and structure
>3pzt_A Endoglucanase; alpha/beta barrel, glycosyl hydrolase, cellulose binding, HY; 1.97A {Bacillus subtilis subsp} PDB: 3pzu_A 3pzv_A Back     alignment and structure
>1ece_A Endocellulase E1; glycosyl hydrolase; HET: BGC; 2.40A {Acidothermus cellulolyticus} SCOP: c.1.8.3 PDB: 1vrx_A Back     alignment and structure
>1bqc_A Protein (beta-mannanase); glycosyl hydrolase, family 5, thermomonospora fusca; 1.50A {Thermobifida fusca} SCOP: c.1.8.3 PDB: 2man_A* 3man_A* Back     alignment and structure
>1jz7_A Lactase, beta-galactosidase, LACZ; TIM barrel (alpha/beta barrel), jelly-roll barrel, immunoglobulin, beta supersandwich, hydrolase; HET: GAL; 1.50A {Escherichia coli} SCOP: b.1.4.1 b.1.4.1 b.18.1.5 b.30.5.1 c.1.8.3 PDB: 1hn1_A 1jyx_A* 1jz3_A* 1jz4_A* 1jz5_A* 1jz6_A* 1dp0_A* 3iap_A* 1jz8_A* 1jyn_A* 1jyv_A* 1jyw_A* 3iaq_A* 1px3_A 1px4_A* 3czj_A* 3i3e_A 3i3d_A* 3i3b_A 3dym_A ... Back     alignment and structure
>3bga_A Beta-galactosidase; NYSGXRC, protein structure initiative II (PSI-II), glycosyl hydrolase family 2, jelly-roll fold; 2.10A {Bacteroides thetaiotaomicron vpi-5482} PDB: 3dec_A Back     alignment and structure
>3aof_A Endoglucanase; glycosyl hydrolase family 5, cellulase, biofuel, hyperthermo hydrolase; HET: BMA; 1.29A {Thermotoga maritima} PDB: 3amg_A* 3amc_A 3amd_A 3mmu_A 3mmw_A 3azs_A* 3azr_A* 3azt_A* Back     alignment and structure
>3jug_A Beta-mannanase; TIM-barrel, glycosidase, hydrolase; 1.60A {Bacillus} Back     alignment and structure
>2whl_A Beta-mannanase, baman5; glycoside hydrolase, hydrolase; HET: MAN BMA; 1.40A {Bacillus agaradhaerens} PDB: 2whj_A Back     alignment and structure
>3nco_A Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1, hydrolase; 1.50A {Fervidobacterium nodosum} PDB: 3rjx_A 3rjy_A* Back     alignment and structure
>7a3h_A Endoglucanase; hydrolase, cellulose degradation, glycoside H family 5, michaelis complex, SKEW-BOAT, distortion; 0.95A {Bacillus agaradhaerens} SCOP: c.1.8.3 PDB: 1h2j_A* 1hf6_A* 1ocq_A* 1w3k_A* 1h11_A* 4a3h_A* 5a3h_A* 6a3h_A* 1w3l_A 8a3h_A* 2v38_A* 1qhz_A 1qi0_A* 1e5j_A* 1qi2_A* 1h5v_A* 1a3h_A 2a3h_A* 3a3h_A* 1lf1_A Back     alignment and structure
>1vjz_A Endoglucanase; TM1752, structural genomics, JCSG, PSI, prote structure initiative, joint center for structural genomics; 2.05A {Thermotoga maritima} SCOP: c.1.8.3 Back     alignment and structure
>1edg_A Endoglucanase A; family A, cellulases, xylanases, family 5 of glycosyl hydrol cellulose degradation; 1.60A {Clostridium cellulolyticum} SCOP: c.1.8.3 Back     alignment and structure
>3qho_A Endoglucanase, 458AA long hypothetical endo-1,4-beta-glucanase; cellulase, catalytic domain, hydrolase; HET: CTT; 1.65A {Pyrococcus horikoshii} PDB: 3axx_A* 2zum_A 2zun_A* 3qhm_A* 3qhn_A* Back     alignment and structure
>2cks_A Endoglucanase E-5; carbohydrate metabolism, polysaccharide degradation, glycoside hydrolase family 5, hydrolase, glycosidase; HET: BEN; 1.6A {Thermobifida fusca} PDB: 2ckr_A* Back     alignment and structure
>1wcg_A Thioglucosidase, myrosinase; aphid, beta-glucosidase, insect, beta-barrel, hydrolase, glycosidase; 1.10A {Brevicoryne brassicae} SCOP: c.1.8.4 Back     alignment and structure
>1vff_A Beta-glucosidase; glycosyl hydrolase, membrane-bound enzyme, thermostability, TIM barrel, alkylglucosides; 2.50A {Pyrococcus horikoshii} SCOP: c.1.8.4 Back     alignment and structure
>3ndz_A Endoglucanase D; cellotriose, xylanase, carbohydrate binding D glucanase, hydrolase; HET: CT3; 2.08A {Clostridium cellulovorans} PDB: 3ndy_A* Back     alignment and structure
>1qox_A Beta-glucosidase; hydrolase, cellulose degradation; 2.7A {Bacillus circulans} SCOP: c.1.8.4 Back     alignment and structure
>1h4p_A Glucan 1,3-beta-glucosidase I/II; hydrolase, glucan degradation, hydrolyase, glycosidase; HET: NAG BMA MAN NDG; 1.75A {Saccharomyces cerevisiae} SCOP: c.1.8.3 Back     alignment and structure
>1h1n_A Endo type cellulase ENGI; hydrolase, glycosyl hydrolase, family 5, subtype, thermophilic, thermophIle, endoglucanase; 1.12A {Thermoascus aurantiacus} SCOP: c.1.8.3 PDB: 1gzj_A Back     alignment and structure
>3ahy_A Beta-glucosidase; cellulases, glycosyl hydrolase, manganese enhancement, hydro; 1.63A {Trichoderma reesei} Back     alignment and structure
>1v08_A Beta-glucosidase; glycoside hydrolase, dimboa-glucoside, inhibitor, PEST defense, family GH1, hydrolase, chloroplast, transit peptide, 3D-structure; HET: NTZ; 1.9A {Zea mays} SCOP: c.1.8.4 PDB: 1e4l_A* 1e4n_A* 1e56_A* 1e55_A* 1e1e_A 1e1f_A* 1h49_A* 1hxj_A Back     alignment and structure
>2je8_A Beta-mannosidase; glycoside hydrolase, hydrolase; HET: B3P; 1.7A {Bacteroides thetaiotaomicron} SCOP: b.1.4.1 b.1.4.1 b.1.4.1 b.18.1.5 c.1.8.3 PDB: 2vr4_A* 2vl4_A* 2vmf_A* 2vo5_A* 2vot_A* 2vqt_A* 2vjx_A* 2vqu_A* 2wbk_A* Back     alignment and structure
>2o9p_A Beta-glucosidase B; family 1 glycoside hydrolase; 2.10A {Paenibacillus polymyxa} PDB: 2o9t_A* 2z1s_A* 2jie_A* 2o9r_A* Back     alignment and structure
>2jf7_A Strictosidine-O-beta-D-glucosidase; alkaloid, hydrolase; 2.48A {Rauvolfia serpentina} PDB: 2jf6_A Back     alignment and structure
>1e4m_M Myrosinase MA1; hydrolase, family 1 glycosyl hydrolase, glucosinolate, TIM B; HET: NAG FUC BMA MAN; 1.2A {Sinapis alba} SCOP: c.1.8.4 PDB: 1e6q_M* 1e6s_M* 1e6x_M* 1e70_M* 1e71_M* 1e72_M* 1e73_M* 1w9b_M* 1w9d_M* 2wxd_M* 1dwa_M* 1dwf_M* 1dwg_M* 1dwh_M* 1dwi_M* 1dwj_M* 1myr_A* Back     alignment and structure
>1xyz_A 1,4-beta-D-xylan-xylanohydrolase; glycosyl hydrolase, xylanase, family F/10 of glycosyl hydrolases, glycosyltransferase; 1.40A {Clostridium thermocellum} SCOP: c.1.8.3 Back     alignment and structure
>1ceo_A Cellulase CELC; glycosyl hydrolase, family A/5 of glycosyl hydrolases, cellulose degradation; 1.90A {Clostridium thermocellum} SCOP: c.1.8.3 PDB: 1cen_A 1cec_A Back     alignment and structure
>2e9l_A Cytosolic beta-glucosidase; novel cytosolic neutral beta-glycosylceramidase, hydrolase; HET: BGC PLM OLA; 1.60A {Homo sapiens} PDB: 2e9m_A* 2zox_A* 2jfe_X* Back     alignment and structure
>3ahx_A Beta-glucosidase A; cellulases, glycosyl hydrolase, manganese enhancement, hydro; HET: 7PE; 1.90A {Clostridium cellulovorans} Back     alignment and structure
>1wky_A Endo-beta-1,4-mannanase; TIM barrel, catalytic domain, CBM, hydrolase; 1.65A {Bacillus SP} SCOP: b.18.1.31 c.1.8.3 Back     alignment and structure
>3cui_A EXO-beta-1,4-glucanase; CEX, xylanase, isofagomine inhibitor, TIM barrel, cellulose degradation, glycosidase, hydrolase; HET: X4S; 1.50A {Cellulomonas fimi} PDB: 3cug_A* 3cuh_A* 3cuf_A* 3cuj_A* 1fh9_A* 1fh7_A 1fh8_A 1exp_A* 1fhd_A* 1j01_A* 2exo_A 2xyl_A 2his_A* Back     alignment and structure
>2e3z_A Beta-glucosidase; TIM barrel, glycoside hydrolase family 1, CLAN GH-A, structural genomics, NPPSFA; 1.50A {Phanerochaete chrysosporium} PDB: 2e40_A* Back     alignment and structure
>3n9k_A Glucan 1,3-beta-glucosidase; aromatic entranceway/clamp, exoglucanase, glycoside hydrolas protein-carbohydrate interaction; HET: BGC; 1.70A {Candida albicans} SCOP: c.1.8.3 PDB: 2pc8_A* 2pb1_A* 2pbo_A 3o6a_A 2pf0_A 1cz1_A 1eqc_A* 1eqp_A Back     alignment and structure
>2dga_A Beta-glucosidase; alpha/beta barrel, hydrolase; 1.80A {Triticum aestivum} PDB: 3aiq_A* 3air_A* 3ais_A* 3aiu_A 3aiv_A* 3aiw_A* Back     alignment and structure
>1cbg_A Cyanogenic beta-glucosidase; hydrolase (O-glycosyl); 2.15A {Trifolium repens} SCOP: c.1.8.4 Back     alignment and structure
>1e4i_A Beta-glucosidase; hydrolase, family 1 glycosyl hydrolase, covalent enzyme-GLYC intermediate, alpha/beta barrel; HET: G2F NFG; 2.00A {Bacillus polymyxa} SCOP: c.1.8.4 PDB: 1tr1_A 1bgg_A* 1bga_A 1uyq_A* Back     alignment and structure
>2j78_A Beta-glucosidase A; family 1, hydrolase, inhibitor, glycosidase, polysaccharide degradation, transition state mimic, carbohydrate metabolism; HET: GOX; 1.65A {Thermotoga maritima} SCOP: c.1.8.4 PDB: 1oif_A* 1oim_A* 1oin_A* 1od0_A* 1w3j_A* 1uz1_A* 2cbv_A* 2ces_A* 2cet_A* 2j75_A* 2j77_A* 2cbu_A* 2j79_A* 2j7b_A* 2j7c_A* 2j7d_A* 2j7e_A* 2j7f_A* 2j7g_A* 2j7h_A* ... Back     alignment and structure
>2jep_A Xyloglucanase; family 5, plant cell WALL, hydrolase; 1.4A {Paenibacillus pabuli} PDB: 2jeq_A* Back     alignment and structure
>4b3l_A Beta-glucosidase; hydrolase, glycosidase, carbohydrate-active enzyme; 2.51A {Streptococcus pyogenes} PDB: 4b3k_A Back     alignment and structure
>3apg_A Beta-glucosidase; TIM barrel, hydrolase, sugar binding, hydrolysis; 2.35A {Pyrococcus furiosus} Back     alignment and structure
>2uwf_A Endoxylanase, alkaline active endoxylanase; hydrolase, xylan degradation, xylanase structure, glycosidase, alkaliphilic; 2.10A {Bacillus halodurans} PDB: 2f8q_A 2fgl_A* Back     alignment and structure
>3gnp_A OS03G0212800 protein; beta-alpha barrel, glycosidase, hydrolase; HET: SOG; 1.80A {Oryza sativa subsp} PDB: 3gno_A* 3gnr_A* Back     alignment and structure
>3f5l_A Beta-glucosidase; beta-alpha-barrels, glycosidase, hydrolase; HET: LB2 MES; 1.37A {Oryza sativa japonica group} PDB: 3aht_A* 3ahv_A* 3f5i_A* 3f5j_A* 3f5k_A* 3f4v_A* 2rgm_A* 2rgl_A* 3scr_A* 3scs_A* 3scp_A* 3scq_A* 3scu_A* 3scn_A* 3sco_A* 3sct_A* 3scv_A* 3scw_A* Back     alignment and structure
>1qvb_A Beta-glycosidase; TIM-barrel, thermostable, hydrolase; 2.40A {Thermosphaera aggregans} SCOP: c.1.8.4 Back     alignment and structure
>2xhy_A BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, glycosidase; 2.30A {Escherichia coli} Back     alignment and structure
>1v02_A Dhurrinase, dhurrinase-1; beta-glucosidase, dhurrin hydrolysis, PEST defense, family GH1, hydrolase; 1.9A {Sorghum bicolor} SCOP: c.1.8.4 PDB: 1v02_E 1v03_A* Back     alignment and structure
>2dep_A Xylanase B, thermostable celloxylanase; glycosidase, xylan degradation, family 10, structural genomics, NPPSFA; 1.80A {Clostridium stercorarium} Back     alignment and structure
>1pbg_A PGAL, 6-phospho-beta-D-galactosidase; hydrolase (glycosyl hydrolase); 2.30A {Lactococcus lactis} SCOP: c.1.8.4 PDB: 3pbg_A 2pbg_A 4pbg_A* Back     alignment and structure
>3ayr_A Endoglucanase; TIM barrel, hydrolase, carbohydrate/sugar binding; 2.00A {Piromyces rhizinflatus} PDB: 3ays_A* Back     alignment and structure
>2vzs_A CSXA, EXO-beta-D-glucosaminidase; hydrolase, GH2, glucosamine, glycoside hydrolase; HET: GCS; 1.85A {Amycolatopsis orientalis} SCOP: b.1.4.1 b.1.4.1 b.1.4.1 b.18.1.5 c.1.8.3 PDB: 2x05_A* 2x09_A* 2vzo_A 2vzt_A* 2vzv_A* 2vzu_A* Back     alignment and structure
>3ta9_A Glycoside hydrolase family 1; TIM barrel, glucosidase; 3.00A {Halothermothrix orenii} Back     alignment and structure
>1ug6_A Beta-glycosidase; glucosidase, atomic resolution, riken structural genomics/PR initiative, RSGI, structural genomics, hydrolase; 0.99A {Thermus thermophilus} SCOP: c.1.8.4 PDB: 1np2_A Back     alignment and structure
>1n82_A Xylanase, intra-cellular xylanase; hydrolase; 1.45A {Geobacillus stearothermophilus} SCOP: c.1.8.3 PDB: 3mua_A* 2q8x_A* 3msd_A* 3msg_A* 3mui_A* 3ms8_A Back     alignment and structure
>4hz8_A Beta-glucosidase; BGLB,BGL, hydrolase, glycosid barrel, carbohydrate/sugar binding; HET: BGC; 1.14A {Uncultured bacterium} PDB: 4hz7_A* 4hz6_A* 3fj0_A* 3cmj_A 3fiz_A* 3fiy_A* Back     alignment and structure
>3ptm_A Beta-glucosidase OS4BGlu12; beta-alpha barrel, glycosidase, hydrolase; HET: G2F; 2.40A {Oryza sativa} PDB: 3ptk_A* 3ptq_A* Back     alignment and structure
>3vii_A Beta-glucosidase; cellulases, glycosyl hydrolase, hydrolase; HET: BTB; 0.97A {Neotermes koshunensis} PDB: 3ahz_A* 3vif_A* 3vih_A 3vig_A* 3vim_A* 3ai0_A* 3vin_A* 3vio_A* 3vip_A* 3vij_A* 3vik_A* 3vil_A* Back     alignment and structure
>1g01_A Endoglucanase; alpha/beta barrel, TIM barrel, hydrolase; 1.90A {Bacillus SP} SCOP: c.1.8.3 PDB: 1g0c_A* Back     alignment and structure
>3qr3_A Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A {Hypocrea jecorina} Back     alignment and structure
>1us2_A Xylanase10C, endo-beta-1,4-xylanase; hydrolase, carbohydrate binding module, xylan degradation; HET: XYP; 1.85A {Cellvibrio japonicus} SCOP: b.18.1.11 c.1.8.3 PDB: 1us3_A Back     alignment and structure
>3qom_A 6-phospho-beta-glucosidase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycoside hydrolase, hydrolase; HET: BGC; 1.50A {Lactobacillus plantarum} SCOP: c.1.8.0 PDB: 4gze_A Back     alignment and structure
>1v0l_A Endo-1,4-beta-xylanase A; glycoside hydrolase family 10, xylan degradation, isofagomine, hydrolase; 0.98A {Streptomyces lividans} SCOP: c.1.8.3 PDB: 1e0x_A 1e0w_A* 1od8_A 1v0k_A 1v0m_A 1v0n_A 1e0v_A* 1xas_A 2g3i_A 2g3j_A* 2g4f_A 1v6y_A Back     alignment and structure
>1nq6_A XYS1; glycoside hydrolase family 10, xylanase, xylan degradation,, hydrolase; 1.78A {Streptomyces halstedii} SCOP: c.1.8.3 Back     alignment and structure
>1gnx_A Beta-glucosidase; hydrolase, glycosyltransferase, family 1 of glycosyl hydrolase; HET: SUC; 1.68A {Streptomyces SP} SCOP: c.1.8.4 PDB: 1gon_A Back     alignment and structure
>4atd_A Raucaffricine-O-beta-D-glucosidase; alkaloid, hydrolase; 2.10A {Rauvolfia serpentina} PDB: 4a3y_A 3u5u_A 3u57_A 3u5y_A* Back     alignment and structure
>4a3y_A Raucaffricine-O-beta-D-glucosidase; hydrolase, alkaloid; 2.15A {Rauvolfia serpentina} PDB: 3u5u_A 3u57_A 3u5y_A* Back     alignment and structure
>1ur1_A Endoxylanase; hydrolase, family 10, glycoside hydrolase, hemicellulose, xylan degradation; HET: XYS AHR; 1.43A {Cellvibrio mixtus} SCOP: c.1.8.3 PDB: 1uqy_A* 1uqz_A* 1ur2_A* 2cnc_A* Back     alignment and structure
>1ta3_B Endo-1,4-beta-xylanase; beta alpha barrel (XIP-I), beta alpha barrel (xylanase), HYD inhibitor-hydrolase complex; HET: NAG; 1.70A {Emericella nidulans} SCOP: c.1.8.3 Back     alignment and structure
>2d1z_A Endo-1,4-beta-D-xylanase; TIM-barrel, retaining enzyme, catalytic-site mutant, chemica hydrolase; 1.60A {Streptomyces olivaceoviridis} PDB: 2d20_A* 2d22_A 2d23_A 2d24_A* 1xyf_A 1isw_A* 1isx_A* 1isy_A* 1isv_A* 1it0_A* 1v6u_A* 1v6v_A* 1v6w_A* 1v6x_A* 1isz_A Back     alignment and structure
>1r85_A Endo-1,4-beta-xylanase; hydrolase; HET: GOL; 1.45A {Geobacillus stearothermophilus} SCOP: c.1.8.3 PDB: 1hiz_A* 1r87_A* 3mmd_A* 1r86_A Back     alignment and structure
>2y8k_A Arabinoxylanase, carbohydrate binding family 6; hydrolase; 1.47A {Clostridium thermocellum} Back     alignment and structure
>1i1w_A Endo-1,4-beta-xylanase; xylan degradation, hydrolase, glycosidase, enzyme, ultra HIG resolution, cryo temperature, 1; HET: PCA; 0.89A {Thermoascus aurantiacus} SCOP: c.1.8.3 PDB: 1i1x_A* 2bnj_A* 1gok_A 1gom_A 1goo_A 1goq_A* 1gor_A* 1k6a_A 3o2l_A 3nyd_A* 1tux_A 1b31_A 1b30_A 1b3v_A* 1b3w_A* 1b3x_A* 1b3y_A* 1b3z_A* 1bg4_A Back     alignment and structure
>1uwi_A Beta-galactosidase; hydrolase, beta-glycosidase, glycosidase; 2.55A {Sulfolobus solfataricus} SCOP: c.1.8.4 PDB: 1gow_A Back     alignment and structure
>1w32_A Endo-1,4-beta-xylanase A precursor; mutant, calcium ION, thermostable, glycosyle hydrolase, family 10, error prone PCR, hydrolase; 1.2A {Cellvibrio japonicus} SCOP: c.1.8.3 PDB: 1w2p_A 1w2v_A 1w3h_A 1clx_A 1e5n_A* 1xys_A Back     alignment and structure
>4ha4_A Beta-galactosidase; TIM barrel, beta-glycosidase, hydrolase; HET: GOL PG6; 1.37A {Acidilobus saccharovorans} PDB: 4ha3_A* 1uws_A* 1uwr_A* 1uwq_A* 1uwt_A* 1uwu_A* 2ceq_A* 2cer_A* 4eam_A 4ean_A Back     alignment and structure
>1fob_A Beta-1,4-galactanase; B/A barrel, glycosyl hydrolase, family 53, CLAN GH-A; 1.80A {Aspergillus aculeatus} SCOP: c.1.8.3 PDB: 1fhl_A Back     alignment and structure
>3civ_A Endo-beta-1,4-mannanase; TIM barrel, hydrolase; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>1hjs_A Beta-1,4-galactanase; 4-galactanases, family 53 glycoside hydrolase, thermostability, PH optimum, CLAN GH-A, thermophIle, alkalophIle; HET: NAG EPE; 1.87A {Thielavia heterothallica} SCOP: c.1.8.3 PDB: 1hju_A* 1hjq_A* Back     alignment and structure
>1ur4_A Galactanase; hydrolase, beta-1, glycoside hydrolase, substrate specificity, pectin, GH-A, family 53, plant cell WALL degradation; HET: B2G PGE; 2.2A {Bacillus licheniformis} SCOP: c.1.8.3 PDB: 1r8l_A* 1ur0_A* 2ccr_A* 2j74_A* 2gft_A* Back     alignment and structure
>1tg7_A Beta-galactosidase; TIM barrel domain, glycoside hydrolase, family GH35, glycopr penicillium, hydrolase; HET: NAG BMA MAN; 1.90A {Penicillium SP} SCOP: b.149.1.1 b.18.1.27 b.18.1.27 b.71.1.5 c.1.8.14 PDB: 1xc6_A* Back     alignment and structure
>3kzs_A Glycosyl hydrolase family 5; structural genomics, joint CENT structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 2.10A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3emz_A Xylanase, endo-1,4-beta-xylanase; (alpha/beta)8 barrel, GH10 enzyme complex, hydrolase; HET: HXH; 2.08A {Bacillus SP} SCOP: c.1.8.3 PDB: 3emq_A* 3emc_A* Back     alignment and structure
>1w91_A Beta-xylosidase; MAD, seMet, tetramer, hydrolase; 2.2A {Geobacillus stearothermophilus} SCOP: b.71.1.2 c.1.8.3 PDB: 2bs9_A 2bfg_A* Back     alignment and structure
>1uhv_A Beta-xylosidase; family 39 glycoside hydrolase, xylan, xylose, covalent glycosyl-enzyme intermediate; 2.10A {Thermoanaerobacterium saccharolyticum} SCOP: b.71.1.2 c.1.8.3 PDB: 1px8_A Back     alignment and structure
>3niy_A Endo-1,4-beta-xylanase; TIM-barrel, hydrolase; 1.58A {Thermotoga petrophila rku-1} SCOP: c.1.8.3 PDB: 3nj3_A* 1vbr_A* 1vbu_A Back     alignment and structure
>1wdp_A Beta-amylase; (beta/alpha)8 barrel, hydrolase; 1.27A {Glycine max} SCOP: c.1.8.1 PDB: 1bfn_A* 1q6c_A 1wdr_A* 1v3i_A* 1v3h_A* 1q6d_A* 1q6g_A* 1wdq_A* 1wds_A* 1q6e_A* 1q6f_A* 2dqx_A 1byb_A* 1bya_A* 1byc_A* 1byd_A* 1uko_A 1ukp_A 1btc_A* Back     alignment and structure
>4f8x_A Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET: NAG BMA; 1.47A {Penicillium canescens} Back     alignment and structure
>3u7b_A Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET: NAG BMA MAN; 1.94A {Fusarium oxysporum} Back     alignment and structure
>2xfr_A Beta-amylase; hydrolase, carbohydrate metabolism, glycosyl hydrolase famil starch degradation, germination; 0.97A {Hordeum vulgare} PDB: 2xff_A 2xfy_A* 2xg9_A* 2xgb_A* 2xgi_A* 1b1y_A* Back     alignment and structure
>1fa2_A Beta-amylase; TIM barrel, hydrolase; HET: DOM; 2.30A {Ipomoea batatas} SCOP: c.1.8.1 Back     alignment and structure
>4ekj_A Beta-xylosidase; TIM-barrel fold, hemicellulase, hydrolase; 2.50A {Caulobacter vibrioides} Back     alignment and structure
>4h41_A Putative alpha-L-fucosidase; hydrolase, carbohydrate metabolism, HOST glycans, structural genomics; HET: MSE 1PE PE4 PG4 PG6; 1.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ro8_A Endo-1,4-beta-xylanase; glycosyl hydrolase family 10, GH10, (beta/alpha)8 fold, XYLA hydrolase; 1.34A {Paenibacillus SP} PDB: 3rdk_A 4e4p_A Back     alignment and structure
>2w5f_A Endo-1,4-beta-xylanase Y; cellulosome, glycosidase, xylan degradation, hydrolase; HET: XYP; 1.90A {Clostridium thermocellum} PDB: 2wze_A* 2wys_A* Back     alignment and structure
>2nt0_A Glucosylceramidase; cerezyme, glucocerebrosidase, glucosylceramide, hydrolysis, disease, hydrolase; HET: NAG; 1.79A {Homo sapiens} SCOP: b.71.1.2 c.1.8.3 PDB: 1y7v_A* 2f61_A* 2j25_A* 2nsx_A* 1ogs_A* 2nt1_A* 3gxd_A* 3gxf_A* 3gxi_A* 3gxm_A* 3rik_A* 3ril_A* 2v3f_A* 2v3e_A* 2v3d_A* 2vt0_A* 2wcg_A* 2xwd_A* 2xwe_A* 2wkl_A* ... Back     alignment and structure
>3clw_A Conserved exported protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Bacteroides fragilis} Back     alignment and structure
>2wnw_A Activated by transcription factor SSRB; hydrolase, salmonella typhimurium, O-glycosyl hydrolase family 30; 2.00A {Salmonella enterica subsp} Back     alignment and structure
>3zr5_A Galactocerebrosidase; hydrolase, GALC, glycosyl hydrolase, krabbe disease, TIM BAR lectin domain; HET: NAG; 2.10A {Mus musculus} PDB: 3zr6_A* Back     alignment and structure
>3gyc_A Putative glycoside hydrolase; YP_001304622.1, structural GEN joint center for structural genomics, JCSG; HET: MSE; 1.85A {Parabacteroides distasonis atcc 8503} Back     alignment and structure
>3kl0_A Glucuronoxylanase XYNC; alpha beta barrel, (beta/alpha)8 barrel (beta/alpha)8 + beta motif family, hydrolase; HET: TAR HIS; 1.64A {Bacillus subtilis} PDB: 3gtn_A* 3kl3_A* 3kl5_A* Back     alignment and structure
>2y24_A Xylanase; hydrolase, GH5 family, aldotetraouronic acid; HET: XYP GCV PG4 PGE; 1.39A {Erwinia chrysanthemi} PDB: 1nof_A* Back     alignment and structure
>3og2_A Beta-galactosidase; TIM barrel domain, glycoside hydrolase, family 35, glycoprot hydrolase; HET: NAG BMA MAN GLC; 1.20A {Trichoderma reesei} PDB: 3ogr_A* 3ogs_A* 3ogv_A* Back     alignment and structure
>1ghs_A 1,3-beta-glucanase; hydrolase; 2.30A {Hordeum vulgare} SCOP: c.1.8.3 Back     alignment and structure
>1ua7_A Alpha-amylase; beta-alpha-barrels, acarbose, greek-KEY motif, hydrolase; HET: ACI GLD GLC G6D BGC; 2.21A {Bacillus subtilis} SCOP: b.71.1.1 c.1.8.1 PDB: 1bag_A* 3dc0_A Back     alignment and structure
>3dhu_A Alpha-amylase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>3k1d_A 1,4-alpha-glucan-branching enzyme; mycobacterium tuberculosis H37RV, mesophilic human pathogen, RV1326C gene, glycosyl transferase; 2.33A {Mycobacterium tuberculosis} Back     alignment and structure
>2cyg_A Beta-1, 3-glucananse; endo-beta-1,3-glucanase, (beta-alpha)8-TIM-barrel, B-cell epitopes, allergen, banana, hydrolase; 1.45A {Musa acuminata} SCOP: c.1.8.3 Back     alignment and structure
>3ur8_A Glucan endo-1,3-beta-D-glucosidase; glucoside hydrolase, GH17 family, pathogenesis-related class protein (PR-2), TIM barrel; 1.26A {Solanum tuberosum} PDB: 3ur7_A Back     alignment and structure
>1aq0_A 1,3-1,4-beta-glucanase; hydrolase, glycosidase, glycoprotein, glycosylated protein; HET: NAG; 2.00A {Hordeum vulgare} SCOP: c.1.8.3 PDB: 1ghr_A Back     alignment and structure
>3mi6_A Alpha-galactosidase; NESG, structural genomics, PSI-2, protein structure initiati northeast structural genomics consortium, hydrolase; 2.70A {Lactobacillus brevis} Back     alignment and structure
>3zss_A Putative glucanohydrolase PEP1A; alpha-glucan biosynthesis, glycoside hydrolase FA; 1.80A {Streptomyces coelicolor} PDB: 3zst_A* 3zt5_A* 3zt6_A* 3zt7_A* Back     alignment and structure
>1hvx_A Alpha-amylase; hydrolase, glycosyltransferase, thermostability; 2.00A {Geobacillus stearothermophilus} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>2yfo_A Alpha-galactosidase-sucrose kinase agask; hydrolase; HET: GLA GAL; 1.35A {Ruminococcus gnavus E1} PDB: 2yfn_A* Back     alignment and structure
>1g94_A Alpha-amylase; beta-alpha-8-barrel, 3 domain structure, hydrolase; HET: DAF GLC; 1.74A {Pseudoalteromonas haloplanktis} SCOP: b.71.1.1 c.1.8.1 PDB: 1g9h_A* 1l0p_A 1aqm_A* 1aqh_A* 1b0i_A 1jd7_A 1jd9_A 1kxh_A* Back     alignment and structure
>4gqr_A Pancreatic alpha-amylase; glycosyl hydrolase, diabetes, obesity, digestion, glycosidas inhibition, flavonol, drug design; HET: NAG MYC; 1.20A {Homo sapiens} PDB: 1cpu_A* 1bsi_A 1u2y_A* 1u30_A* 1u33_A* 1xcw_A* 1xcx_A* 1xd0_A* 1xd1_A* 2qmk_A* 2qv4_A* 3bai_A* 3baj_A* 3baw_A* 3ij7_A* 1hny_A* 3ij9_A* 3ij8_A* 4gqq_A* 1kgw_A* ... Back     alignment and structure
>3bh4_A Alpha-amylase; calcium, carbohydrate metabolism, glycosidase, hydrolase, metal-binding, secreted; 1.40A {Bacillus amyloliquefaciens} PDB: 1e43_A 1e3z_A* 1e40_A* 1e3x_A 1vjs_A 1ob0_A 1bli_A 1bpl_B 1bpl_A Back     alignment and structure
>2p0o_A Hypothetical protein DUF871; structural genomics, TIM barrel, PF05 2, protein structure initiative, midwest center for structu genomics; 2.15A {Enterococcus faecalis} Back     alignment and structure
>1wpc_A Glucan 1,4-alpha-maltohexaosidase; maltohexaose-producing amylase, alpha-amylase, acarbose, HYD; HET: ACI GLC GAL; 1.90A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1wp6_A* 2d3l_A* 2d3n_A* 2die_A 2gjp_A* 2gjr_A 1w9x_A* Back     alignment and structure
>1gqi_A Alpha-glucuronidase; (alpha-beta)8 barrel, glycoside hydrolase; 1.48A {Pseudomonas cellulosa} SCOP: c.1.8.10 d.92.2.2 PDB: 1gqj_A* 1gqk_A* 1gql_A* 1h41_A* Back     alignment and structure
>1gcy_A Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-barrel, beta sheet; 1.60A {Pseudomonas stutzeri} SCOP: b.71.1.1 c.1.8.1 PDB: 1jdc_A* 1jda_A* 1jdd_A* 1qi5_A* 1qi3_A* 1qi4_A* 2amg_A 1qpk_A* Back     alignment and structure
>1mxg_A Alpha amylase; hyperthermostable, family 13 glycosyl hydrola (beta/alpha)8-barrel, hydrolase; HET: ACR ETE; 1.60A {Pyrococcus woesei} SCOP: b.71.1.1 c.1.8.1 PDB: 1mwo_A* 1mxd_A* 3qgv_A* Back     alignment and structure
>1ud2_A Amylase, alpha-amylase; calcium-free, alkaline, hydrolase; 2.13A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1ud4_A 1ud5_A 1ud6_A 1ud8_A 1ud3_A Back     alignment and structure
>3edf_A FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin complex, glycosidase, hydrolase; HET: CE6 ACX; 1.65A {Flavobacterium SP} PDB: 3edj_A* 3edk_A* 3ede_A 3edd_A* 1h3g_A Back     alignment and structure
>1lwj_A 4-alpha-glucanotransferase; alpha-amylase family, acarbose, (beta/alpha)8 barrel; HET: ACG; 2.50A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1lwh_A* Back     alignment and structure
>1ht6_A AMY1, alpha-amylase isozyme 1; barley, beta-alpha-barrel, hydrolase; 1.50A {Hordeum vulgare} SCOP: b.71.1.1 c.1.8.1 PDB: 1p6w_A* 1rpk_A* 3bsg_A 2qpu_A* 1rp8_A* 1rp9_A* 2qps_A 3bsh_A* 1ava_A 1amy_A 1bg9_A* Back     alignment and structure
>4aie_A Glucan 1,6-alpha-glucosidase; hydrolase, glycoside hydrolase 13; HET: MES GOL; 2.05A {Lactobacillus acidophilus ncfm} Back     alignment and structure
>2y2w_A Arabinofuranosidase; hydrolase, arabinoxylan, glycoside hydrolase family 51; 2.50A {Bifidobacterium longum} Back     alignment and structure
>2z1k_A (NEO)pullulanase; hydrolase, structural genomics, NPPSFA, national project on structural and functional analyses; HET: GLC; 2.30A {Thermus thermophilus} Back     alignment and structure
>3bc9_A AMYB, alpha amylase, catalytic region; acarbose, thermostable, halophilic, N domain, starch binding, hydrolase; HET: G6D GLC ACI BGC ACR; 1.35A {Halothermothrix orenii} PDB: 3bcd_A* 3bcf_A Back     alignment and structure
>3m07_A Putative alpha amylase; IDP00968, csgid, structural genomics, center for structural genomics of infectious diseases, unknown function; HET: BTB PG4 PGE; 1.40A {Salmonella enterica subsp} Back     alignment and structure
>1jae_A Alpha-amylase; glycosidase, carbohydrate metabolism, 4-glucan-4-glucanohydrolase, hydrolase; 1.65A {Tenebrio molitor} SCOP: b.71.1.1 c.1.8.1 PDB: 1clv_A 1tmq_A 1viw_A* Back     alignment and structure
>2guy_A Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; HET: NAG BMA; 1.59A {Aspergillus oryzae} SCOP: b.71.1.1 c.1.8.1 PDB: 2gvy_A* 3kwx_A* 6taa_A 7taa_A* 2taa_A Back     alignment and structure
>2wc7_A Alpha amylase, catalytic region; CD/PUL-hydrolyzing enzymes, hydrolase, glycosidase, neopullu; 2.37A {Nostoc punctiforme} PDB: 2wcs_A 2wkg_A Back     alignment and structure
>2ze0_A Alpha-glucosidase; TIM barrel, glucoside hydrolase, extremophIle, hydrolase; 2.00A {Geobacillus SP} Back     alignment and structure
>1x7f_A Outer surface protein; structural genomics, unknown function, MCSG, PSI, midwest center for struct genomics; 2.30A {Bacillus cereus atcc 14579} SCOP: b.62.1.2 c.1.8.12 Back     alignment and structure
>3ktc_A Xylose isomerase; putative sugar isomerase, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.54A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>1qw9_A Arabinosidase, alpha-L-arabinofuranosidase; hydrolase; HET: KHP; 1.20A {Geobacillus stearothermophilus} SCOP: b.71.1.2 c.1.8.3 PDB: 1pz2_A* 1qw8_A* 1pz3_A Back     alignment and structure
>4aef_A Neopullulanase (alpha-amylase II); hydrolase, thermostability, high temperature; 2.34A {Pyrococcus furiosus} Back     alignment and structure
>3faw_A Reticulocyte binding protein; TIM barrel, beta barrel, hydrolase, cell WALL, peptidoglycan-anchor, secreted; 2.10A {Streptococcus agalactiae COH1} PDB: 3fax_A* Back     alignment and structure
>1gjw_A Maltodextrin glycosyltransferase; alpha-amylase, maltosyltransferase; HET: MAL GLC; 2.1A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1gju_A* Back     alignment and structure
>2aaa_A Alpha-amylase; glycosidase; 2.10A {Aspergillus niger} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>1j0h_A Neopullulanase; beta-alpha-barrels, hydrolase; 1.90A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1j0i_A* 1j0j_A* 1j0k_A* 1sma_A 1gvi_A* Back     alignment and structure
>2dh2_A 4F2 cell-surface antigen heavy chain; TIM-barrel, glycosidase like, antiparallel beta-sheet, greek terminal domain, extracellular domain; 2.10A {Homo sapiens} PDB: 2dh3_A Back     alignment and structure
>1wzl_A Alpha-amylase II; pullulan, GH-13, alpha-amylase family, hydrolase; 2.00A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1ji2_A 1bvz_A 1vfk_A* 3a6o_A* 1wzm_A 1jf6_A 1wzk_A 2d2o_A* 1jib_A* 1jl8_A* 1vb9_A* 1g1y_A* 1vfo_A* 1vfm_A* 1vfu_A* 1jf5_A Back     alignment and structure
>1qtw_A Endonuclease IV; DNA repair enzyme, TIM barrel, trinuclear Zn cluster, hydrolase; 1.02A {Escherichia coli} SCOP: c.1.15.1 PDB: 1qum_A* 2nqh_A 2nqj_A* 2nq9_A* Back     alignment and structure
>1zja_A Trehalulose synthase; sucrose isomerase, alpha-amylase family, (beta/alpha)8 barrel; 1.60A {Pseudomonas mesoacidophila} PDB: 1zjb_A 2pwd_A* 2pwh_A 2pwg_A 2pwe_A* 2pwf_A* 3gbe_A* 3gbd_A* Back     alignment and structure
>1m53_A Isomaltulose synthase; klebsiella SP. LX3, sucrose isomerization, isomerase; 2.20A {Klebsiella SP} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>2c7f_A Alpha-L-arabinofuranosidase; glycosidase, xylan, arabinan, hydrolase; HET: AHR; 2.7A {Clostridium thermocellum} SCOP: b.71.1.2 c.1.8.3 PDB: 2c8n_A Back     alignment and structure
>2xn2_A Alpha-galactosidase; hydrolase, glycosidase; HET: SME GLA IMD; 1.58A {Lactobacillus acidophilus ncfm} PDB: 2xn1_A* 2xn0_A* Back     alignment and structure
>2e8y_A AMYX protein, pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, HY; 2.11A {Bacillus subtilis} PDB: 2e8z_A* 2e9b_A* Back     alignment and structure
>1ea9_C Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A {Bacillus SP} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 Back     alignment and structure
>2v5c_A O-GLCNACASE NAGJ; glycosidase, GH84, GH84C, hydrolase, coiled coil, family 84 glycoside hydrolase, carbohydrate binding module; 2.10A {Clostridium perfringens} PDB: 2cbj_A* 2cbi_A 2vur_A* 2x0y_A* 2j62_A* 2wb5_A* 2xpk_A* 2yds_A* 2ydr_A* 2ydq_A* Back     alignment and structure
>4aio_A Limit dextrinase; hydrolase, pullulanase, glycoside hydrolase family 13; 1.90A {Hordeum vulgare} PDB: 2x4c_A* 2y4s_A* 2y5e_A* 2x4b_A Back     alignment and structure
>1m7x_A 1,4-alpha-glucan branching enzyme; alpha/beta barrel, beta sandwich, transferase; 2.30A {Escherichia coli} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 3o7y_A* 3o7z_A* Back     alignment and structure
>4aee_A Alpha amylase, catalytic region; hydrolase, hyperthermostable, cyclodextrin hydrolase, GH13; 2.28A {Staphylothermus marinus} Back     alignment and structure
>1qho_A Alpha-amylase; glycoside hydrolase, starch degradation; HET: MAL ABD; 1.70A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1qhp_A* Back     alignment and structure
>2zic_A Dextran glucosidase; TIM barrel, (beta/alpha)8-barrel, hydrolase; 2.20A {Streptococcus mutans} PDB: 2zid_A* Back     alignment and structure
>1zy9_A Alpha-galactosidase; TM1192, struc genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI, hydrolase; 2.34A {Thermotoga maritima} SCOP: b.30.5.11 c.1.8.13 Back     alignment and structure
>2wan_A Pullulanase; hydrolase, glycoside hydrolase, polysaccharide, amylase, starch, carbohydrate; 1.65A {Bacillus acidopullulyticus} Back     alignment and structure
>3vgf_A Malto-oligosyltrehalose trehalohydrolase; alpha/beta barrel, alpha-amylas hydrolase; HET: GLC FLC; 2.30A {Sulfolobus solfataricus} PDB: 3vge_A* 3vgd_A* 3vgb_A* 1eh9_A* 3vgh_A* 3vgg_A* 1eha_A Back     alignment and structure
>3aj7_A Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydrolase; 1.30A {Saccharomyces cerevisiae} PDB: 3a4a_A* 3a47_A 3axi_A* 3axh_A* Back     alignment and structure
>2ya0_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; 1.85A {Streptococcus pneumoniae} PDB: 2ya2_A* Back     alignment and structure
>1uok_A Oligo-1,6-glucosidase; sugar degradation, hydrolase, TIM-barrel glycosidase; 2.00A {Bacillus cereus} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>3em5_A Beta-1,3-glucanase; glycoprotein, rossmann fold, (beta-alpha)8-TIM-barrel, glyco hydrolase, allergen; HET: NAG FUC MAN; 2.50A {Hevea brasiliensis} SCOP: c.1.8.3 PDB: 3f55_A* Back     alignment and structure
>3czg_A Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 1.80A {Xanthomonas axonopodis PV} PDB: 3cze_A* 3czl_A* 3czk_A* 2wpg_A Back     alignment and structure
>2bhu_A Maltooligosyltrehalose trehalohydrolase; alpha-amylase, protein-carbohydrate complex, desiccation resistance; HET: TRS PGE; 1.1A {Deinococcus radiodurans} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 2bhy_A* 2bhz_A* 2bxy_A* 2bxz_A* 2by0_A* 2by1_A* 2by2_A* 2by3_A* Back     alignment and structure
>1wza_A Alpha-amylase A; hydrolase, halophilic, thermophilic; 1.60A {Halothermothrix orenii} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>4acy_A Endo-alpha-mannosidase; hydrolase, endomannosidase, glycoside hydrolase, CAZY, enzyme-carbohydrate interaction, mannose; HET: MSE; 1.69A {Bacteroides thetaiotaomicron} PDB: 4acz_A 4ad0_A* 4acz_B Back     alignment and structure
>1g5a_A Amylosucrase; glycosyltransferase, glycoside hydrolase, (beta-alpha)8 barrel; HET: EPE; 1.40A {Neisseria polysaccharea} SCOP: b.71.1.1 c.1.8.1 PDB: 1jg9_A* 1mw1_A* 1mw2_A* 1mw3_A* 3ueq_A* 1jgi_A* 1mvy_A* 1mw0_A* 1s46_A* 1zs2_A* Back     alignment and structure
>3kws_A Putative sugar isomerase; structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 1.68A {Parabacteroides distasonis atcc 8503} Back     alignment and structure
>2x7v_A Probable endonuclease 4; DNA repair protein, metal-binding, hydrolase, DNA damage, DN; 2.30A {Thermotoga maritima MSB8} PDB: 2x7w_A* Back     alignment and structure
>1l8n_A Alpha-D-glucuronidase; hydrolase; HET: GCW XYP; 1.50A {Geobacillus stearothermophilus} SCOP: c.1.8.10 d.92.2.2 PDB: 1k9d_A* 1mqq_A* 1mqp_A 1mqr_A* 1k9f_A* 1k9e_A* Back     alignment and structure
>3aam_A Endonuclease IV, endoiv; DNA repair, base excision repair, BER, TIM barrel, endonucle hydrolase, structural genomics, NPPSFA; 1.58A {Thermus thermophilus} Back     alignment and structure
>1bf2_A Isoamylase; hydrolase, glycosidase, debranching enzyme; 2.00A {Pseudomonas amyloderamosa} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 Back     alignment and structure
>3aml_A OS06G0726400 protein; starch-branching, transferase; HET: EPE; 1.70A {Oryza sativa japonica group} PDB: 3amk_A Back     alignment and structure
>1cyg_A Cyclodextrin glucanotransferase; glycosyltransferase; 2.50A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 Back     alignment and structure
>4ad1_A Glycosyl hydrolase family 71; glycoside hydrolase GH99, CAZY, enzyme-carbohydra interaction, mannose glycosidase inhibition; 1.90A {Bacteroides xylanisolvens} PDB: 4ad2_A* 4ad3_A* 4ad4_A* 4ad5_A* Back     alignment and structure
>3ucq_A Amylosucrase; thermostability, amylose synthesis, sucrose isomerization, beta/alpha-barrel, carbohydrate binding, transferase; 1.97A {Deinococcus geothermalis} PDB: 3uer_A* Back     alignment and structure
>3p14_A L-rhamnose isomerase; TIM barrel; 2.51A {Bacillus halodurans} SCOP: c.1.15.2 PDB: 3uu0_A 3uva_A 3uxi_A Back     alignment and structure
>3gh5_A HEX1, beta-hexosaminidase; beta-N-acetylhexosaminidase, glycosphingolipids, paenibacill GH20, hydrolase, structural genomics, NPPSFA; HET: NAG; 1.60A {Paenibacillus SP} PDB: 3gh4_A* 3gh7_A* 3sur_A* 3sus_A* 3sut_A* 3suu_A* 3suv_A* 3suw_A* Back     alignment and structure
>2vr5_A Glycogen operon protein GLGX; hydrolase, glycosidase, glycosyl hydrolase, glycogen debraching; HET: GLC A16; 2.8A {Sulfolobus solfataricus} PDB: 2vnc_A* 2vuy_A Back     alignment and structure
>1qwg_A PSL synthase;, (2R)-phospho-3-sulfolactate synthase; beta-alpha-barrel, lyase; 1.60A {Methanocaldococcus jannaschii} SCOP: c.1.27.1 Back     alignment and structure
>3cqj_A L-ribulose-5-phosphate 3-epimerase ULAE; TIM-barrel, isomerase, phosphate-binding motif; 2.04A {Escherichia coli} PDB: 3cqi_A 3cqh_A 3cqk_A Back     alignment and structure
>1d3c_A Cyclodextrin glycosyltransferase; alpha-amylase, product complex, oligosaccharide, family 13 glycosyl hydrolase, transglycosylation; HET: GLC; 1.78A {Bacillus circulans} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1cxf_A* 1cxk_A* 1cdg_A* 1cxe_A* 1cxh_A* 1cxi_A* 2cxg_A* 1cgv_A* 2dij_A* 1cgy_A* 1kck_A* 1cgx_A* 1cxl_A* 1cgw_A* 1tcm_A 1kcl_A* 1eo5_A* 1eo7_A* 1dtu_A* 1ot1_A* ... Back     alignment and structure
>3ug3_A Alpha-L-arabinofuranosidase; TIM barrel, hydrolase; 1.80A {Thermotoga maritima} PDB: 3ug4_A* 3ug5_A* 3s2c_A 4atw_A Back     alignment and structure
>1ji1_A Alpha-amylase I; beta/alpha barrel, hydrolase; 1.60A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1uh3_A* 2d0f_A* 1izj_A 1uh4_A* 1uh2_A* 2d0g_A* 2d0h_A* 1izk_A Back     alignment and structure
>2vrq_A Alpha-L-arabinofuranosidase; hydrolase, glycosidase; HET: XYP; 2.00A {Thermobacillus xylanilyticus} PDB: 2vrk_A Back     alignment and structure
>1yht_A DSPB; beta barrel, hydrolase; 2.00A {Aggregatibacter actinomycetemcomitans} SCOP: c.1.8.6 Back     alignment and structure
>3vni_A Xylose isomerase domain protein TIM barrel; D-psicose 3-epimerase, ketohexose; 1.98A {Clostridium cellulolyticum} PDB: 3vnj_A* 3vnl_A* 3vnk_A* 3vnm_A* Back     alignment and structure
>2ya1_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; HET: BGC GLC; 2.25A {Streptococcus pneumoniae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 323
d1tg7a5354 c.1.8.14 (A:41-394) Beta-galactosidase LacA, N-ter 1e-45
d1kwga2 393 c.1.8.1 (A:1-393) A4 beta-galactosidase {Thermus t 5e-09
d1rh9a1 370 c.1.8.3 (A:30-399) Beta-mannanase {Tomato (Lycoper 3e-06
d2vzsa5 339 c.1.8.3 (A:336-674) Exochitosanase CsxA {Amycolato 2e-05
d1qnra_344 c.1.8.3 (A:) Beta-mannanase {Trichoderma reesei [T 3e-04
d1uuqa_ 410 c.1.8.3 (A:) Exomannosidase {Cellvibrio mixtus [Ta 0.004
>d1tg7a5 c.1.8.14 (A:41-394) Beta-galactosidase LacA, N-terminal domain {Penicillium sp. [TaxId: 5081]} Length = 354 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Glycosyl hydrolases family 35 catalytic domain
domain: Beta-galactosidase LacA, N-terminal domain
species: Penicillium sp. [TaxId: 5081]

 Score =  156 bits (395), Expect = 1e-45
 Identities = 58/216 (26%), Positives = 88/216 (40%), Gaps = 13/216 (6%)

Query: 80  GDTFRLNEDPFQFVSGSFHYFRAP-PGRWCWIMRAMRAAGLNALSTYVEWRSHEVHPGHY 138
             +  +N +     SG  H +R P    +  I   ++A G N +S YV+W   E +PGHY
Sbjct: 10  EHSIFVNGERLMIFSGEVHPYRLPVASLYIDIFEKVKALGFNCVSFYVDWALLEGNPGHY 69

Query: 139 HYDGHRDIEHFLQLAVEEDLYILLRPGPFICGKRDFGGFPPWLLKVAPDILLRQNHPVYQ 198
             +G  D++ F   A E  +Y+L RPGP+I  +   GGFP WL +   D +LR +   Y 
Sbjct: 70  SAEGIFDLQPFFDAAKEAGIYLLARPGPYINAEVSGGGFPGWLQR--VDGILRTSDEAYL 127

Query: 199 RYVTRWFQELFPRIQKYLYGNDRPIILVQVENEYGSDAECDP-----AHAVWLRDLLRTY 253
           +    +   +   I K    N  PIIL Q ENEY             ++  ++ D  R  
Sbjct: 128 KATDNYASNIAATIAKAQITNGGPIILYQPENEYSGACCGYNGFPDGSYMQYIEDHARDA 187

Query: 254 VQDKAVLYSTDGAFDAYLRCT----VDGVYSTVDFT 285
                   S D     +           +Y    + 
Sbjct: 188 GIV-VPFISNDAWAAGHNAPGTGAGAVDIYGHDSYP 222
>d1kwga2 c.1.8.1 (A:1-393) A4 beta-galactosidase {Thermus thermophilus [TaxId: 274]} Length = 393 Back     information, alignment and structure
>d1rh9a1 c.1.8.3 (A:30-399) Beta-mannanase {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Length = 370 Back     information, alignment and structure
>d2vzsa5 c.1.8.3 (A:336-674) Exochitosanase CsxA {Amycolatopsis orientalis [TaxId: 31958]} Length = 339 Back     information, alignment and structure
>d1qnra_ c.1.8.3 (A:) Beta-mannanase {Trichoderma reesei [TaxId: 51453]} Length = 344 Back     information, alignment and structure
>d1uuqa_ c.1.8.3 (A:) Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} Length = 410 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query323
d1tg7a5354 Beta-galactosidase LacA, N-terminal domain {Penici 100.0
d1kwga2 393 A4 beta-galactosidase {Thermus thermophilus [TaxId 99.85
d2vzsa5 339 Exochitosanase CsxA {Amycolatopsis orientalis [Tax 99.85
d1rh9a1370 Beta-mannanase {Tomato (Lycopersicon esculentum) [ 99.83
d1uuqa_ 410 Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} 99.77
d1bhga3304 beta-Glucuronidase, domain 3 {Human (Homo sapiens) 99.75
d1qnra_344 Beta-mannanase {Trichoderma reesei [TaxId: 51453]} 99.75
d1jz8a5292 beta-Galactosidase, domain 3 {Escherichia coli [Ta 99.7
d1yq2a5297 beta-Galactosidase, domain 3 {Arthrobacter sp. c2- 99.7
d2c0ha1350 endo-1,4-beta-mannosidase {Blue mussel (Mytilus ed 99.66
d1bqca_302 Beta-mannanase {Thermomonospora fusca [TaxId: 2021 99.64
d1wkya2297 Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 2449 99.64
d1tvna1293 Endoglucanase Cel5a {Pseudoalteromonas haloplankti 99.62
d1egza_291 Endoglucanase Cel5a {Erwinia chrysanthemi [TaxId: 99.6
d2je8a5 348 Five-domain beta-mannosidase, domain 3 {Bacteroide 99.56
d1ecea_358 Endocellulase E1 {Acidothermus cellulolyticus [Tax 99.49
d1ceoa_ 340 Endoglucanase CelC {Clostridium thermocellum [TaxI 99.47
d1gnxa_ 464 Beta-glucosidase A {Streptomyces sp. [TaxId: 1931] 99.45
d2j78a1 443 Beta-glucosidase A {Thermotoga maritima [TaxId: 23 99.44
d1vffa1 423 Beta-glucosidase A {Archaeon Pyrococcus horikoshii 99.43
d1e4ia_ 447 Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406 99.43
d7a3ha_300 Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId 99.43
d1ug6a_ 426 Beta-glucosidase A {Thermus thermophilus [TaxId: 2 99.42
d2pb1a1 394 Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) 99.4
d1qoxa_ 449 Beta-glucosidase A {Bacillus circulans, subsp. alk 99.38
d1cbga_ 490 Plant beta-glucosidase (myrosinase) {Creeping whit 99.38
d1vjza_325 Endoglucanase homologue TM1752 {Thermotoga maritim 99.37
d1vema2 417 Bacterial beta-amylase {Bacillus cereus [TaxId: 13 99.36
d1wcga1 462 Thioglucosidase {Cabbage aphid (Brevicoryne brassi 99.35
d1e4mm_ 499 Plant beta-glucosidase (myrosinase) {White mustard 99.34
d1v02a_ 484 Plant beta-glucosidase (myrosinase) {Sorghum bicol 99.33
d1pbga_ 468 6-phospho-beta-D-galactosidase, PGAL {Lactococcus 99.3
d1h4pa_ 408 Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharom 99.29
d1g01a_ 357 Alkaline cellulase K catalytic domain {Bacillus sp 99.27
d1uwsa_ 489 beta-Glycosidase {Archaeon Sulfolobus solfataricus 99.26
d1h1na_305 Endocellulase EngI {Thermoascus aurantiacus [TaxId 99.23
d1qvba_ 481 beta-Glycosidase {Archaeon Thermosphaera aggregans 99.19
d1ur4a_ 387 Beta-1,4-galactanase {Bacillus licheniformis [TaxI 99.1
d1edga_ 380 Endoglucanase CelA {Clostridium cellulolyticum [Ta 99.06
d1hjsa_332 Beta-1,4-galactanase {Thielavia heterothallica, ak 99.01
d1foba_334 Beta-1,4-galactanase {Fungus (Aspergillus aculeatu 98.94
d1uhva2 346 Beta-D-xylosidase, catalytic domain {Thermoanaerob 98.91
d1fh9a_312 Xylanase A, catalytic core {Cellulomonas fimi [Tax 98.89
d1nq6a_302 Xylanase A, catalytic core {Streptomyces halstedii 98.82
d1vbua1324 Xylanase {Thermotoga maritima [TaxId: 2336]} 98.73
d1xyza_320 Xylanase {Clostridium thermocellum, XynZ [TaxId: 1 98.62
d1r85a_ 371 Xylanase {Bacillus stearothermophilus, Xt6 [TaxId: 98.55
d1n82a_330 Xylanase {Bacillus stearothermophilus, Ixt6 [TaxId 98.55
d1ta3b_301 Xylanase A, catalytic core {Emericella nidulans (A 98.51
d1v0la_302 Xylanase A, catalytic core {Streptomyces lividans 98.5
d1us3a2364 Xylanase 10c {Cellvibrio japonicus [TaxId: 155077] 98.48
d1i1wa_303 Xylanase A, catalytic core {Thermoascus aurantiacu 98.38
d1b1ya_ 500 beta-Amylase {Barley (Hordeum vulgare) [TaxId: 451 98.33
d1fa2a_ 498 beta-Amylase {Sweet potato (Ipomoea batatas) [TaxI 98.26
d1wdpa1 490 beta-Amylase {Soybean (Glycine max) [TaxId: 3847]} 98.24
d1ur1a_350 Xylanase {Cellvibrio mixtus [TaxId: 39650]} 98.0
d1w32a_ 346 Xylanase A, catalytic core {Pseudomonas fluorescen 97.87
d1nofa2277 Glycosyl hydrolase family 5 xylanase, catalytic do 97.15
d1ud2a2 390 Bacterial alpha-amylase {Bacillus sp., ksm-k38 [Ta 96.85
d1tg7a3163 Beta-galactosidase LacA, domains 4 and 5 {Penicill 96.46
d2nt0a2354 Glucosylceramidase, catalytic domain {Human (Homo 95.56
d1hvxa2 393 Bacterial alpha-amylase {Bacillus stearothermophil 95.51
d1gcya2357 G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase 95.37
d1ua7a2344 Bacterial alpha-amylase {Bacillus subtilis [TaxId: 95.26
d1e43a2 393 Bacterial alpha-amylase {Chimera (Bacillus amyloli 95.25
d2d3na2 394 Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 95.24
d1jaea2 378 Animal alpha-amylase {Yellow mealworm (Tenebrio mo 95.17
d1g94a2 354 Bacterial alpha-amylase {Pseudoalteromonas halopla 95.07
d1ht6a2347 Plant alpha-amylase {Barley (Hordeum vulgare), AMY 95.01
d1mxga2361 Bacterial alpha-amylase {Archaeon Pyrococcus woese 94.96
d1h3ga3 422 Cyclomaltodextrinase, central domain {Flavobacteri 94.25
d1qhoa4 407 Cyclodextrin glycosyltransferase {Bacillus stearot 94.06
d1bf2a3 475 Isoamylase, central domain {Pseudomonas amyloderam 93.89
d1m53a2 478 Isomaltulose synthase PalI {Klebsiella sp., lx3 [T 93.64
d2bhua3 420 Glycosyltrehalose trehalohydrolase, central domain 93.54
d1gjwa2 572 Maltosyltransferase {Thermotoga maritima [TaxId: 2 93.45
d1zy9a2 348 Alpha-galactosidase GalA catalytic domain {Thermot 93.27
d1ghsa_ 306 Plant beta-glucanases {Barley (Hordeum vulgare), 1 93.06
d1hx0a2 403 Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 982 92.99
d2guya2 381 Fungal alpha-amylases {Aspergillus oryzae, Taka-am 92.93
d1uoka2 479 Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 13 92.78
d1x7fa2244 Outer surface protein, N-terminal domain {Bacillus 92.75
d2aaaa2 381 Fungal alpha-amylases {Aspergillus niger, acid amy 92.67
d1wzla3 382 Maltogenic amylase, central domain {Thermoactinomy 92.46
d1ea9c3 382 Maltogenic amylase, central domain {Bacillus sp., 91.57
d3bmva4 406 Cyclodextrin glycosyltransferase {Thermoanaerobact 91.54
d1eh9a3 400 Glycosyltrehalose trehalohydrolase, central domain 91.44
d1lwha2 391 4-alpha-glucanotransferase {Thermotoga maritima [T 90.98
d1j0ha3 382 Neopullulanase, central domain {Bacillus stearothe 90.85
d2cyga1 312 Plant beta-glucanases {Banana (Musa acuminata), 1, 90.38
d1wzaa2 409 Bacterial alpha-amylase {Halothermothrix orenii [T 90.14
d1m7xa3 396 1,4-alpha-glucan branching enzyme, central domain 89.99
d1qw9a2367 Alpha-L-arabinofuranosidase, catalytic domain {Bac 88.21
d2q02a1271 Putative cytoplasmic protein STM4435 {Salmonella t 87.2
d1h41a1 561 alpha-D-glucuronidase catalytic domain {Pseudomona 86.99
d1jaka1356 beta-N-acetylhexosaminidase {Streptomyces plicatus 86.79
d1g5aa2 554 Amylosucrase {Neisseria polysaccharea [TaxId: 489] 86.13
d1qtwa_285 Endonuclease IV {Escherichia coli [TaxId: 562]} 85.34
d1iv8a2 653 Maltooligosyl trehalose synthase {Archaeon Sulfolo 84.79
d1ojxa_251 Archaeal fructose 1,6-bisphosphate aldolase {Archa 84.6
d2fhfa5 563 Pullulanase PulA {Klebsiella pneumoniae [TaxId: 57 84.09
d1aq0a_ 306 Plant beta-glucanases {Barley (Hordeum vulgare), 1 82.63
d2cbia2317 Hyaluronidase catalytic domain {Clostridium perfri 80.93
>d1tg7a5 c.1.8.14 (A:41-394) Beta-galactosidase LacA, N-terminal domain {Penicillium sp. [TaxId: 5081]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Glycosyl hydrolases family 35 catalytic domain
domain: Beta-galactosidase LacA, N-terminal domain
species: Penicillium sp. [TaxId: 5081]

Probab=100.00  E-value=2.7e-55  Score=421.40  Aligned_cols=244  Identities=27%  Similarity=0.414  Sum_probs=213.7

Q ss_pred             EEecCCeEEeCCeeeEEeeeeecCCCCC-hhcHHHHHHHHHHhCCCEEEEEEeCCCcccCCCeecccccchHHHHHHHHH
Q psy13819         76 IDLAGDTFRLNEDPFQFVSGSFHYFRAP-PGRWCWIMRAMRAAGLNALSTYVEWRSHEVHPGHYHYDGHRDIEHFLQLAV  154 (323)
Q Consensus        76 v~~~~~~~~~dGk~~~i~~g~~Hy~r~p-~~~W~~~l~~mk~~G~N~Vr~yv~W~~hEP~~G~fdf~g~~dl~~fl~~a~  154 (323)
                      |++|+++|+|||||++|+||++||+|+| +++|+++|++||++|+|+|||||+|+.|||+||+|||++.+||++||++|+
T Consensus         6 v~~d~~~~~~~G~~~~~~~~~~h~~r~~~~~~w~~~l~~mk~~G~n~vr~~~~W~~~ep~~g~~df~~~~~l~~~l~~a~   85 (354)
T d1tg7a5           6 VTWDEHSIFVNGERLMIFSGEVHPYRLPVASLYIDIFEKVKALGFNCVSFYVDWALLEGNPGHYSAEGIFDLQPFFDAAK   85 (354)
T ss_dssp             EEECSSCEEETTEEECEEEEECCGGGSCCGGGHHHHHHHHHTTTCCEEEEECCHHHHCSBTTBCCCCGGGCSHHHHHHHH
T ss_pred             EEEeCCEEEECCEEEEEEEEecCCCCCCCHHHHHHHHHHHHHcCCCEEEEecchhccCCCCCcccccchhhHHHHHHHHH
Confidence            7889999999999999999999999997 789999999999999999999999999999999999999999999999999


Q ss_pred             HCCCeEEEccCCccccccCCCCCcccccccCCCeeecCCCHhHHHHHHHHHHHHHHHHHhhhccCCCcEEEEccCCCcCC
Q psy13819        155 EEDLYILLRPGPFICGKRDFGGFPPWLLKVAPDILLRQNHPVYQRYVTRWFQELFPRIQKYLYGNDRPIILVQVENEYGS  234 (323)
Q Consensus       155 e~GL~vilr~GPyi~aEw~~gg~P~Wl~~~~p~~~~R~~~~~f~~~~~~~~~~l~~~i~~~~~~n~g~Vi~~QieNE~g~  234 (323)
                      |+||+|||++|||+|+||..+++|.|+..+ + ..+|+++|.|++++++|++++++++++++++|+|+||||||+||||+
T Consensus        86 ~~Gl~vil~~g~~~~~~w~~~~~p~~~~~~-~-~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~n~~~ii~wqi~NE~g~  163 (354)
T d1tg7a5          86 EAGIYLLARPGPYINAEVSGGGFPGWLQRV-D-GILRTSDEAYLKATDNYASNIAATIAKAQITNGGPIILYQPENEYSG  163 (354)
T ss_dssp             HHTCEEEEECCSCCCTTBGGGGCCGGGGGC-S-SCTTSSCHHHHHHHHHHHHHHHHHHHHTBGGGTSSEEEECCSSCCCC
T ss_pred             HcCCEEEEcCCCCcCcccccCCCCcccccC-C-CcccCCCHHHHHHHHHHHHHHHHHHHHHHhccCCCceEEEeccccCc
Confidence            999999999999999999999999999873 4 45899999999999999999999999999999999999999999997


Q ss_pred             CC-----CChHHHHHHHHHHHHHhcCCceEEEeeCCCCcccccc-cc------------CceEEeecCCC---CCchhHH
Q psy13819        235 DA-----ECDPAHAVWLRDLLRTYVQDKAVLYSTDGAFDAYLRC-TV------------DGVYSTVDFTV---FKDVNVS  293 (323)
Q Consensus       235 ~~-----~~~~~Y~~~l~~~~~~~~g~~~~l~t~dg~~~~~~~~-~~------------~g~~~~~nfg~---~~~~~~~  293 (323)
                      ++     .++++|+++|++++++ .+.++|++|+|+.......+ .+            ++.+.+.++..   .+..+..
T Consensus       164 ~~~~~~~~~~~~~~~~l~~~~~~-~~~~~p~~~~~~~~~~~~~~g~~~~~~d~yg~~~~~~~~~~~~~~~~~~~~~~~~~  242 (354)
T d1tg7a5         164 ACCGYNGFPDGSYMQYIEDHARD-AGIVVPFISNDAWAAGHNAPGTGAGAVDIYGHDSYPLGFDCANPSTWPSGNLPTYF  242 (354)
T ss_dssp             BCTTCCCCSCHHHHHHHHHHHHH-TTCCSCBBCCBSSSSCTTCTTSCTTCCSBCEEEECTTCSCCSCTTCCCTTCSCCCH
T ss_pred             cccccccchHHHHHHHHHhhhhc-cCcccceEeccchhhccCCCCcccccccccccccCCCccccCCcccccccccchHH
Confidence            63     3568999999999998 58999999998765433332 22            22222233221   1234456


Q ss_pred             HHHHHhhCCCCCeEEEEecccccccccCC
Q psy13819        294 FQAQRTRAPQGPLVNAEFEFFPMLLWAGM  322 (323)
Q Consensus       294 ~~~~r~~~p~~Plm~~E~~~gw~~~W~~~  322 (323)
                      +...++.+|.+|+|++|||.||++.||+.
T Consensus       243 ~~~~~~~~p~~p~~~~E~~~g~~~~wG~~  271 (354)
T d1tg7a5         243 HTSHEQQSPSTPYSLVEFQGGAFDPWGGV  271 (354)
T ss_dssp             HHHHHHHCTTSCCEEEEEESSCCCCTTCC
T ss_pred             HHHHhhcCCccceeeeccccccccccCCC
Confidence            77888999999999999999999999963
>d1kwga2 c.1.8.1 (A:1-393) A4 beta-galactosidase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2vzsa5 c.1.8.3 (A:336-674) Exochitosanase CsxA {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1rh9a1 c.1.8.3 (A:30-399) Beta-mannanase {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Back     information, alignment and structure
>d1uuqa_ c.1.8.3 (A:) Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} Back     information, alignment and structure
>d1bhga3 c.1.8.3 (A:329-632) beta-Glucuronidase, domain 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qnra_ c.1.8.3 (A:) Beta-mannanase {Trichoderma reesei [TaxId: 51453]} Back     information, alignment and structure
>d1jz8a5 c.1.8.3 (A:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yq2a5 c.1.8.3 (A:313-609) beta-Galactosidase, domain 3 {Arthrobacter sp. c2-2 [TaxId: 192168]} Back     information, alignment and structure
>d2c0ha1 c.1.8.3 (A:18-367) endo-1,4-beta-mannosidase {Blue mussel (Mytilus edulis) [TaxId: 6550]} Back     information, alignment and structure
>d1bqca_ c.1.8.3 (A:) Beta-mannanase {Thermomonospora fusca [TaxId: 2021]} Back     information, alignment and structure
>d1wkya2 c.1.8.3 (A:34-330) Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 244966]} Back     information, alignment and structure
>d1tvna1 c.1.8.3 (A:1-293) Endoglucanase Cel5a {Pseudoalteromonas haloplanktis [TaxId: 228]} Back     information, alignment and structure
>d1egza_ c.1.8.3 (A:) Endoglucanase Cel5a {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d2je8a5 c.1.8.3 (A:331-678) Five-domain beta-mannosidase, domain 3 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1ecea_ c.1.8.3 (A:) Endocellulase E1 {Acidothermus cellulolyticus [TaxId: 28049]} Back     information, alignment and structure
>d1ceoa_ c.1.8.3 (A:) Endoglucanase CelC {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1gnxa_ c.1.8.4 (A:) Beta-glucosidase A {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d2j78a1 c.1.8.4 (A:3-445) Beta-glucosidase A {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vffa1 c.1.8.4 (A:1-423) Beta-glucosidase A {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1e4ia_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406]} Back     information, alignment and structure
>d7a3ha_ c.1.8.3 (A:) Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId: 76935]} Back     information, alignment and structure
>d1ug6a_ c.1.8.4 (A:) Beta-glucosidase A {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2pb1a1 c.1.8.3 (A:7-400) Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
>d1qoxa_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Back     information, alignment and structure
>d1cbga_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Creeping white clover (Trifolium repens) [TaxId: 3899]} Back     information, alignment and structure
>d1vjza_ c.1.8.3 (A:) Endoglucanase homologue TM1752 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vema2 c.1.8.1 (A:1-417) Bacterial beta-amylase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1wcga1 c.1.8.4 (A:3-464) Thioglucosidase {Cabbage aphid (Brevicoryne brassicae) [TaxId: 69196]} Back     information, alignment and structure
>d1e4mm_ c.1.8.4 (M:) Plant beta-glucosidase (myrosinase) {White mustard (Sinapis alba) [TaxId: 3728]} Back     information, alignment and structure
>d1v02a_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Sorghum bicolor [TaxId: 4558]} Back     information, alignment and structure
>d1pbga_ c.1.8.4 (A:) 6-phospho-beta-D-galactosidase, PGAL {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1h4pa_ c.1.8.3 (A:) Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g01a_ c.1.8.3 (A:) Alkaline cellulase K catalytic domain {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1uwsa_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1h1na_ c.1.8.3 (A:) Endocellulase EngI {Thermoascus aurantiacus [TaxId: 5087]} Back     information, alignment and structure
>d1qvba_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Thermosphaera aggregans [TaxId: 54254]} Back     information, alignment and structure
>d1ur4a_ c.1.8.3 (A:) Beta-1,4-galactanase {Bacillus licheniformis [TaxId: 1402]} Back     information, alignment and structure
>d1edga_ c.1.8.3 (A:) Endoglucanase CelA {Clostridium cellulolyticum [TaxId: 1521]} Back     information, alignment and structure
>d1hjsa_ c.1.8.3 (A:) Beta-1,4-galactanase {Thielavia heterothallica, aka Myceliophthora thermophila [TaxId: 78579]} Back     information, alignment and structure
>d1foba_ c.1.8.3 (A:) Beta-1,4-galactanase {Fungus (Aspergillus aculeatus) [TaxId: 5053]} Back     information, alignment and structure
>d1uhva2 c.1.8.3 (A:14-359) Beta-D-xylosidase, catalytic domain {Thermoanaerobacterium saccharolyticum [TaxId: 28896]} Back     information, alignment and structure
>d1fh9a_ c.1.8.3 (A:) Xylanase A, catalytic core {Cellulomonas fimi [TaxId: 1708]} Back     information, alignment and structure
>d1nq6a_ c.1.8.3 (A:) Xylanase A, catalytic core {Streptomyces halstedii [TaxId: 1944]} Back     information, alignment and structure
>d1vbua1 c.1.8.3 (A:517-840) Xylanase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xyza_ c.1.8.3 (A:) Xylanase {Clostridium thermocellum, XynZ [TaxId: 1515]} Back     information, alignment and structure
>d1r85a_ c.1.8.3 (A:) Xylanase {Bacillus stearothermophilus, Xt6 [TaxId: 1422]} Back     information, alignment and structure
>d1n82a_ c.1.8.3 (A:) Xylanase {Bacillus stearothermophilus, Ixt6 [TaxId: 1422]} Back     information, alignment and structure
>d1ta3b_ c.1.8.3 (B:) Xylanase A, catalytic core {Emericella nidulans (Aspergillus nidulans) [TaxId: 162425]} Back     information, alignment and structure
>d1v0la_ c.1.8.3 (A:) Xylanase A, catalytic core {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1us3a2 c.1.8.3 (A:243-606) Xylanase 10c {Cellvibrio japonicus [TaxId: 155077]} Back     information, alignment and structure
>d1i1wa_ c.1.8.3 (A:) Xylanase A, catalytic core {Thermoascus aurantiacus [TaxId: 5087]} Back     information, alignment and structure
>d1b1ya_ c.1.8.1 (A:) beta-Amylase {Barley (Hordeum vulgare) [TaxId: 4513]} Back     information, alignment and structure
>d1fa2a_ c.1.8.1 (A:) beta-Amylase {Sweet potato (Ipomoea batatas) [TaxId: 4120]} Back     information, alignment and structure
>d1wdpa1 c.1.8.1 (A:6-495) beta-Amylase {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1ur1a_ c.1.8.3 (A:) Xylanase {Cellvibrio mixtus [TaxId: 39650]} Back     information, alignment and structure
>d1w32a_ c.1.8.3 (A:) Xylanase A, catalytic core {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1nofa2 c.1.8.3 (A:44-320) Glycosyl hydrolase family 5 xylanase, catalytic domain {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1ud2a2 c.1.8.1 (A:1-390) Bacterial alpha-amylase {Bacillus sp., ksm-k38 [TaxId: 1409]} Back     information, alignment and structure
>d1tg7a3 b.18.1.27 (A:849-1011) Beta-galactosidase LacA, domains 4 and 5 {Penicillium sp. [TaxId: 5081]} Back     information, alignment and structure
>d2nt0a2 c.1.8.3 (A:78-431) Glucosylceramidase, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hvxa2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1gcya2 c.1.8.1 (A:1-357) G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) {Pseudomonas stutzeri [TaxId: 316]} Back     information, alignment and structure
>d1ua7a2 c.1.8.1 (A:4-347) Bacterial alpha-amylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1e43a2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Chimera (Bacillus amyloliquefaciens) and (Bacillus licheniformis) [TaxId: 1390]} Back     information, alignment and structure
>d2d3na2 c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 1416]} Back     information, alignment and structure
>d1jaea2 c.1.8.1 (A:1-378) Animal alpha-amylase {Yellow mealworm (Tenebrio molitor), larva [TaxId: 7067]} Back     information, alignment and structure
>d1g94a2 c.1.8.1 (A:1-354) Bacterial alpha-amylase {Pseudoalteromonas haloplanktis (Alteromonas haloplanktis) [TaxId: 228]} Back     information, alignment and structure
>d1ht6a2 c.1.8.1 (A:1-347) Plant alpha-amylase {Barley (Hordeum vulgare), AMY1 isozyme [TaxId: 4513]} Back     information, alignment and structure
>d1mxga2 c.1.8.1 (A:1-361) Bacterial alpha-amylase {Archaeon Pyrococcus woesei [TaxId: 2262]} Back     information, alignment and structure
>d1h3ga3 c.1.8.1 (A:96-517) Cyclomaltodextrinase, central domain {Flavobacterium sp. 92 [TaxId: 197856]} Back     information, alignment and structure
>d1qhoa4 c.1.8.1 (A:1-407) Cyclodextrin glycosyltransferase {Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId: 1422]} Back     information, alignment and structure
>d1bf2a3 c.1.8.1 (A:163-637) Isoamylase, central domain {Pseudomonas amyloderamosa [TaxId: 32043]} Back     information, alignment and structure
>d1m53a2 c.1.8.1 (A:43-520) Isomaltulose synthase PalI {Klebsiella sp., lx3 [TaxId: 576]} Back     information, alignment and structure
>d2bhua3 c.1.8.1 (A:111-530) Glycosyltrehalose trehalohydrolase, central domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1gjwa2 c.1.8.1 (A:1-572) Maltosyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zy9a2 c.1.8.13 (A:178-525) Alpha-galactosidase GalA catalytic domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ghsa_ c.1.8.3 (A:) Plant beta-glucanases {Barley (Hordeum vulgare), 1,3-beta-glucanase [TaxId: 4513]} Back     information, alignment and structure
>d1hx0a2 c.1.8.1 (A:1-403) Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2guya2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus oryzae, Taka-amylase [TaxId: 5062]} Back     information, alignment and structure
>d1uoka2 c.1.8.1 (A:1-479) Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1x7fa2 c.1.8.12 (A:1-244) Outer surface protein, N-terminal domain {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2aaaa2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus niger, acid amylase [TaxId: 5061]} Back     information, alignment and structure
>d1wzla3 c.1.8.1 (A:121-502) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]} Back     information, alignment and structure
>d1ea9c3 c.1.8.1 (C:122-503) Maltogenic amylase, central domain {Bacillus sp., cyclomaltodextrinase [TaxId: 1409]} Back     information, alignment and structure
>d3bmva4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Thermoanaerobacterium [TaxId: 28895]} Back     information, alignment and structure
>d1eh9a3 c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrolase, central domain {Archaeon Sulfolobus solfataricus, km1 [TaxId: 2287]} Back     information, alignment and structure
>d1lwha2 c.1.8.1 (A:1-391) 4-alpha-glucanotransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1j0ha3 c.1.8.1 (A:124-505) Neopullulanase, central domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2cyga1 c.1.8.3 (A:29-340) Plant beta-glucanases {Banana (Musa acuminata), 1,3-beta-glucanase [TaxId: 4641]} Back     information, alignment and structure
>d1wzaa2 c.1.8.1 (A:28-436) Bacterial alpha-amylase {Halothermothrix orenii [TaxId: 31909]} Back     information, alignment and structure
>d1m7xa3 c.1.8.1 (A:227-622) 1,4-alpha-glucan branching enzyme, central domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qw9a2 c.1.8.3 (A:18-384) Alpha-L-arabinofuranosidase, catalytic domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2q02a1 c.1.15.4 (A:1-271) Putative cytoplasmic protein STM4435 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1h41a1 c.1.8.10 (A:152-712) alpha-D-glucuronidase catalytic domain {Pseudomonas cellulosa [TaxId: 155077]} Back     information, alignment and structure
>d1jaka1 c.1.8.6 (A:151-506) beta-N-acetylhexosaminidase {Streptomyces plicatus [TaxId: 1922]} Back     information, alignment and structure
>d1g5aa2 c.1.8.1 (A:1-554) Amylosucrase {Neisseria polysaccharea [TaxId: 489]} Back     information, alignment and structure
>d1qtwa_ c.1.15.1 (A:) Endonuclease IV {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iv8a2 c.1.8.1 (A:1-653) Maltooligosyl trehalose synthase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1ojxa_ c.1.10.1 (A:) Archaeal fructose 1,6-bisphosphate aldolase {Archaeon Thermoproteus tenax [TaxId: 2271]} Back     information, alignment and structure
>d2fhfa5 c.1.8.1 (A:403-965) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1aq0a_ c.1.8.3 (A:) Plant beta-glucanases {Barley (Hordeum vulgare), 1,3-1,4-beta-glucanase [TaxId: 4513]} Back     information, alignment and structure
>d2cbia2 c.1.8.10 (A:179-495) Hyaluronidase catalytic domain {Clostridium perfringens [TaxId: 1502]} Back     information, alignment and structure