Psyllid ID: psy13946


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90
MFKGQQPQSEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKADPRIVQALSLGDSSNVAPSGSSPASASAASPLVLERDIMAERTPK
ccccccccccccccHHHHHHHHHHHHcccccccccHHHHHHHHHccHHHHHHHccccccccccccccccccccccHHHHHHHHHHHcccc
cccccccccHHHccHHHHHHHHHHHHccccccEEcHHHHHHHHHHcHHHHHHHccccccccccccccccHHHcHHHHHHHHHHHHHcccc
mfkgqqpqsedentpqkrVDKIFDQMDKNHDDRLTLEEfregskadpRIVQAlslgdssnvapsgsspasasaasplvlerdimaertpk
mfkgqqpqsedentpqkrvdKIFDQMDKNHDDRLTLEefregskadpRIVQALSLGDSSnvapsgsspasasaasplvlerdimaertpk
MFKGQQPQSEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKADPRIVQALSLGDssnvapsgsspasasaaspLVLERDIMAERTPK
******************************************************************************************
****************KRVDKIFDQMDKNHDDRLTLEEFREGSKADPRIVQALS**********************LVLERDIMA*****
****************KRVDKIFDQMDKNHDDRLTLEEFREGSKADPRIVQALSLGD*****************SPLVLERDIMAERTPK
************NTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKADPRIVQALSLGDSSNV**S*SSP*********VLERDIMAER***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFKGQQPQSEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKADPRIVQALSLGDSSNVAPSGSSPASASAASPLVLERDIMAERTPK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query90 2.2.26 [Sep-21-2011]
P37236187 Frequenin-1 OS=Drosophila yes N/A 0.588 0.283 0.962 6e-24
Q91614190 Neuronal calcium sensor 1 N/A N/A 0.544 0.257 0.734 4e-14
Q5RC90190 Neuronal calcium sensor 1 yes N/A 0.544 0.257 0.734 4e-14
P62168190 Neuronal calcium sensor 1 yes N/A 0.544 0.257 0.734 4e-14
Q8BNY6190 Neuronal calcium sensor 1 yes N/A 0.544 0.257 0.734 4e-14
P62166190 Neuronal calcium sensor 1 yes N/A 0.544 0.257 0.734 4e-14
P62167190 Neuronal calcium sensor 1 yes N/A 0.544 0.257 0.734 4e-14
Q2V8Y7190 Neuronal calcium sensor 1 yes N/A 0.544 0.257 0.714 7e-14
P36608191 Neuronal calcium sensor 1 yes N/A 0.511 0.240 0.739 2e-13
Q16981191 Aplycalcin OS=Aplysia cal N/A N/A 0.555 0.261 0.66 5e-13
>sp|P37236|FREQ_DROME Frequenin-1 OS=Drosophila melanogaster GN=Frq1 PE=2 SV=2 Back     alignment and function desciption
 Score =  109 bits (272), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 52/53 (98%)

Query: 4   GQQPQSEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKADPRIVQALSLG 56
           GQQPQSEDENTPQKRVDKIFDQMDKNHD +LTLEEFREGSKADPRIVQALSLG
Sbjct: 133 GQQPQSEDENTPQKRVDKIFDQMDKNHDGKLTLEEFREGSKADPRIVQALSLG 185




Ca(2+)-dependent modulation of synaptic efficacy.
Drosophila melanogaster (taxid: 7227)
>sp|Q91614|NCS1_XENLA Neuronal calcium sensor 1 OS=Xenopus laevis GN=ncs1 PE=2 SV=2 Back     alignment and function description
>sp|Q5RC90|NCS1_PONAB Neuronal calcium sensor 1 OS=Pongo abelii GN=NCS1 PE=2 SV=3 Back     alignment and function description
>sp|P62168|NCS1_RAT Neuronal calcium sensor 1 OS=Rattus norvegicus GN=Ncs1 PE=1 SV=2 Back     alignment and function description
>sp|Q8BNY6|NCS1_MOUSE Neuronal calcium sensor 1 OS=Mus musculus GN=Ncs1 PE=2 SV=3 Back     alignment and function description
>sp|P62166|NCS1_HUMAN Neuronal calcium sensor 1 OS=Homo sapiens GN=NCS1 PE=1 SV=2 Back     alignment and function description
>sp|P62167|NCS1_CHICK Neuronal calcium sensor 1 OS=Gallus gallus GN=NCS1 PE=1 SV=2 Back     alignment and function description
>sp|Q2V8Y7|NCS1_BOVIN Neuronal calcium sensor 1 OS=Bos taurus GN=NCS1 PE=1 SV=3 Back     alignment and function description
>sp|P36608|NCS1_CAEEL Neuronal calcium sensor 1 OS=Caenorhabditis elegans GN=ncs-1 PE=2 SV=2 Back     alignment and function description
>sp|Q16981|APLC_APLCA Aplycalcin OS=Aplysia californica PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query90
322795221188 hypothetical protein SINV_80056 [Solenop 0.622 0.297 0.946 1e-24
195553768 197 GD24687 [Drosophila simulans] gi|1942027 0.7 0.319 0.841 2e-23
195432226 251 GK20001 [Drosophila willistoni] gi|19416 0.588 0.211 0.981 2e-23
328702594106 PREDICTED: frequenin-1-like [Acyrthosiph 0.733 0.622 0.797 2e-23
17933604187 frequenin 2, isoform A [Drosophila melan 0.588 0.283 0.981 3e-23
170067830144 conserved hypothetical protein [Culex qu 0.588 0.368 0.981 4e-23
15712257267 hypothetical protein AaeL_AAEL009327 [Ae 0.588 0.791 0.981 5e-23
30720004867 Frequenin-1 [Harpegnathos saltator] 0.588 0.791 0.981 6e-23
347965020111 AGAP013126-PA [Anopheles gambiae str. PE 0.588 0.477 0.981 6e-23
383862271187 PREDICTED: frequenin-1-like [Megachile r 0.588 0.283 0.962 1e-22
>gi|322795221|gb|EFZ18043.1| hypothetical protein SINV_80056 [Solenopsis invicta] Back     alignment and taxonomy information
 Score =  116 bits (291), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 53/56 (94%), Positives = 56/56 (100%)

Query: 1   MFKGQQPQSEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKADPRIVQALSLG 56
           MF+GQQPQ+EDENTPQKRVDKIFDQMDKNHDD+LTLEEFREGSKADPRIVQALSLG
Sbjct: 131 MFQGQQPQAEDENTPQKRVDKIFDQMDKNHDDKLTLEEFREGSKADPRIVQALSLG 186




Source: Solenopsis invicta

Species: Solenopsis invicta

Genus: Solenopsis

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|195553768|ref|XP_002076743.1| GD24687 [Drosophila simulans] gi|194202733|gb|EDX16309.1| GD24687 [Drosophila simulans] Back     alignment and taxonomy information
>gi|195432226|ref|XP_002064127.1| GK20001 [Drosophila willistoni] gi|194160212|gb|EDW75113.1| GK20001 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|328702594|ref|XP_003241944.1| PREDICTED: frequenin-1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|17933604|ref|NP_525093.1| frequenin 2, isoform A [Drosophila melanogaster] gi|45555908|ref|NP_996501.1| frequenin 2, isoform C [Drosophila melanogaster] gi|45555920|ref|NP_996502.1| frequenin 2, isoform B [Drosophila melanogaster] gi|442616821|ref|NP_001259675.1| frequenin 2, isoform D [Drosophila melanogaster] gi|125980636|ref|XP_001354341.1| GA19219 [Drosophila pseudoobscura pseudoobscura] gi|194766758|ref|XP_001965491.1| GF22428 [Drosophila ananassae] gi|194892314|ref|XP_001977638.1| GG19154 [Drosophila erecta] gi|195058886|ref|XP_001995518.1| GH17718 [Drosophila grimshawi] gi|195130385|ref|XP_002009632.1| GI15466 [Drosophila mojavensis] gi|195172103|ref|XP_002026841.1| GL26965 [Drosophila persimilis] gi|195345393|ref|XP_002039253.1| GM22886 [Drosophila sechellia] gi|195392872|ref|XP_002055078.1| GJ19176 [Drosophila virilis] gi|195481261|ref|XP_002101579.1| GE17713 [Drosophila yakuba] gi|7293433|gb|AAF48809.1| frequenin 2, isoform A [Drosophila melanogaster] gi|45447047|gb|AAS65399.1| frequenin 2, isoform B [Drosophila melanogaster] gi|45447048|gb|AAS65400.1| frequenin 2, isoform C [Drosophila melanogaster] gi|54642649|gb|EAL31394.1| GA19219 [Drosophila pseudoobscura pseudoobscura] gi|190619482|gb|EDV35006.1| GF22428 [Drosophila ananassae] gi|190649287|gb|EDV46565.1| GG19154 [Drosophila erecta] gi|193896304|gb|EDV95170.1| GH17718 [Drosophila grimshawi] gi|193908082|gb|EDW06949.1| GI15466 [Drosophila mojavensis] gi|194111780|gb|EDW33823.1| GL26965 [Drosophila persimilis] gi|194134479|gb|EDW55995.1| GM22886 [Drosophila sechellia] gi|194149588|gb|EDW65279.1| GJ19176 [Drosophila virilis] gi|194189103|gb|EDX02687.1| GE17713 [Drosophila yakuba] gi|381140071|gb|AFF57512.1| FI18190p1 [Drosophila melanogaster] gi|440216907|gb|AGB95517.1| frequenin 2, isoform D [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|170067830|ref|XP_001868634.1| conserved hypothetical protein [Culex quinquefasciatus] gi|167863897|gb|EDS27280.1| conserved hypothetical protein [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|157122572|ref|XP_001659930.1| hypothetical protein AaeL_AAEL009327 [Aedes aegypti] gi|108874591|gb|EAT38816.1| AAEL009327-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|307200048|gb|EFN80394.1| Frequenin-1 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|347965020|ref|XP_003437186.1| AGAP013126-PA [Anopheles gambiae str. PEST] gi|333469509|gb|EGK97317.1| AGAP013126-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|383862271|ref|XP_003706607.1| PREDICTED: frequenin-1-like [Megachile rotundata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query90
FB|FBgn0083228187 Frq2 "Frequenin 2" [Drosophila 0.588 0.283 0.981 1.1e-23
FB|FBgn0030897187 Frq1 "Frequenin 1" [Drosophila 0.588 0.283 0.962 6.1e-23
UNIPROTKB|Q91614190 ncs1 "Neuronal calcium sensor 0.533 0.252 0.75 1.8e-14
UNIPROTKB|F1NWD8168 NCS1 "Neuronal calcium sensor 0.533 0.285 0.75 2.3e-14
UNIPROTKB|P62167190 NCS1 "Neuronal calcium sensor 0.533 0.252 0.75 2.3e-14
UNIPROTKB|F1MZQ0160 NCS1 "Neuronal calcium sensor 0.533 0.3 0.75 2.3e-14
UNIPROTKB|F1PET6160 NCS1 "Uncharacterized protein" 0.533 0.3 0.75 2.3e-14
UNIPROTKB|P62166190 NCS1 "Neuronal calcium sensor 0.533 0.252 0.75 2.3e-14
UNIPROTKB|F1S0Y2160 LOC100523661 "Uncharacterized 0.533 0.3 0.75 2.3e-14
UNIPROTKB|Q5RC90190 NCS1 "Neuronal calcium sensor 0.533 0.252 0.75 2.3e-14
FB|FBgn0083228 Frq2 "Frequenin 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 272 (100.8 bits), Expect = 1.1e-23, P = 1.1e-23
 Identities = 52/53 (98%), Positives = 53/53 (100%)

Query:     4 GQQPQSEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKADPRIVQALSLG 56
             GQQPQ+EDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKADPRIVQALSLG
Sbjct:   133 GQQPQTEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKADPRIVQALSLG 185




GO:0007269 "neurotransmitter secretion" evidence=NAS
GO:0008021 "synaptic vesicle" evidence=NAS
GO:0016192 "vesicle-mediated transport" evidence=NAS
GO:0005509 "calcium ion binding" evidence=IEA
GO:0007268 "synaptic transmission" evidence=IMP
GO:0007528 "neuromuscular junction development" evidence=IMP
GO:0046928 "regulation of neurotransmitter secretion" evidence=IGI
FB|FBgn0030897 Frq1 "Frequenin 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q91614 ncs1 "Neuronal calcium sensor 1" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|F1NWD8 NCS1 "Neuronal calcium sensor 1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P62167 NCS1 "Neuronal calcium sensor 1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MZQ0 NCS1 "Neuronal calcium sensor 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PET6 NCS1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P62166 NCS1 "Neuronal calcium sensor 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1S0Y2 LOC100523661 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q5RC90 NCS1 "Neuronal calcium sensor 1" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q06389NCS1_YEASTNo assigned EC number0.63260.54440.2578yesN/A
P62168NCS1_RATNo assigned EC number0.73460.54440.2578yesN/A
Q8BNY6NCS1_MOUSENo assigned EC number0.73460.54440.2578yesN/A
P62167NCS1_CHICKNo assigned EC number0.73460.54440.2578yesN/A
P62166NCS1_HUMANNo assigned EC number0.73460.54440.2578yesN/A
P36608NCS1_CAEELNo assigned EC number0.73910.51110.2408yesN/A
Q2V8Y7NCS1_BOVINNo assigned EC number0.71420.54440.2578yesN/A
Q5RC90NCS1_PONABNo assigned EC number0.73460.54440.2578yesN/A
P37236FREQ_DROMENo assigned EC number0.96220.58880.2834yesN/A
Q09711NCS1_SCHPONo assigned EC number0.72910.53330.2526yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query90
COG5126160 COG5126, FRQ1, Ca2+-binding protein (EF-Hand super 2e-05
cd0005163 cd00051, EFh, EF-hand, calcium binding motif; A di 3e-04
pfam1349960 pfam13499, EF_hand_5, EF-hand domain pair 0.002
pfam0003629 pfam00036, efhand, EF hand 0.003
pfam1340530 pfam13405, EF_hand_4, EF-hand domain 0.004
>gnl|CDD|227455 COG5126, FRQ1, Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
 Score = 40.0 bits (94), Expect = 2e-05
 Identities = 12/43 (27%), Positives = 22/43 (51%)

Query: 7   PQSEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKADPRI 49
            +S  E    + V+K+  + D++ D  +  EEF++  K  P I
Sbjct: 118 LKSLGERLSDEEVEKLLKEYDEDGDGEIDYEEFKKLIKDSPTI 160


Length = 160

>gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>gnl|CDD|222177 pfam13499, EF_hand_5, EF-hand domain pair Back     alignment and domain information
>gnl|CDD|200946 pfam00036, efhand, EF hand Back     alignment and domain information
>gnl|CDD|205583 pfam13405, EF_hand_4, EF-hand domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 90
KOG0044|consensus193 99.22
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 98.61
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 98.47
PF1320225 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ 98.34
KOG0034|consensus187 98.13
PTZ00183158 centrin; Provisional 98.0
cd00252116 SPARC_EC SPARC_EC; extracellular Ca2+ binding doma 97.97
PF1340531 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J 97.91
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 97.91
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 97.9
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 97.87
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 97.85
cd0005267 EH Eps15 homology domain; found in proteins implic 97.8
KOG0027|consensus151 97.79
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 97.77
PTZ00184149 calmodulin; Provisional 97.74
PTZ00183158 centrin; Provisional 97.69
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 97.68
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 97.68
KOG0027|consensus151 97.66
cd0021388 S-100 S-100: S-100 domain, which represents the la 97.6
cd00252116 SPARC_EC SPARC_EC; extracellular Ca2+ binding doma 97.58
KOG0037|consensus221 97.56
PTZ00184149 calmodulin; Provisional 97.56
KOG0044|consensus193 97.55
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 97.54
smart0005429 EFh EF-hand, calcium binding motif. EF-hands are c 97.52
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 97.5
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 97.43
cd0502491 S-100A10 S-100A10: A subgroup of the S-100A10 doma 97.42
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 97.4
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 97.38
cd0503088 calgranulins Calgranulins: S-100 domain found in p 97.34
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 97.29
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 97.26
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 97.22
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 97.2
PRK12309391 transaldolase/EF-hand domain-containing protein; P 97.19
PLN02964 644 phosphatidylserine decarboxylase 97.16
KOG0036|consensus 463 97.03
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 97.0
KOG0034|consensus187 96.99
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 96.95
cd0005267 EH Eps15 homology domain; found in proteins implic 96.92
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 96.91
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 96.88
KOG4251|consensus 362 96.81
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 96.78
KOG0377|consensus631 96.56
cd0021388 S-100 S-100: S-100 domain, which represents the la 96.55
KOG4223|consensus325 96.28
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 96.14
PRK12309391 transaldolase/EF-hand domain-containing protein; P 96.1
KOG4223|consensus325 95.98
PF1478851 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA 95.97
PF10591113 SPARC_Ca_bdg: Secreted protein acidic and rich in 95.91
cd0503088 calgranulins Calgranulins: S-100 domain found in p 95.82
KOG0028|consensus172 95.74
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 95.69
KOG0036|consensus 463 95.36
KOG4065|consensus144 95.34
PF12763104 EF-hand_4: Cytoskeletal-regulatory complex EF hand 95.02
PF10591113 SPARC_Ca_bdg: Secreted protein acidic and rich in 94.71
KOG0028|consensus172 94.48
KOG0041|consensus244 94.38
KOG0038|consensus189 94.25
KOG0037|consensus221 93.62
PLN02964 644 phosphatidylserine decarboxylase 93.36
KOG0031|consensus171 92.84
cd0502491 S-100A10 S-100A10: A subgroup of the S-100A10 doma 90.83
PF1465866 EF-hand_9: EF-hand domain 90.73
KOG3555|consensus 434 90.48
PF12763104 EF-hand_4: Cytoskeletal-regulatory complex EF hand 88.9
KOG2643|consensus489 87.6
KOG2643|consensus 489 85.06
KOG4578|consensus421 84.61
KOG1029|consensus 1118 81.24
>KOG0044|consensus Back     alignment and domain information
Probab=99.22  E-value=1.8e-11  Score=90.27  Aligned_cols=55  Identities=58%  Similarity=0.899  Sum_probs=50.4

Q ss_pred             CCCCCCCCCcccHHHHHHHHHHhcCCCCCCccCHHHHHhhhhCCHHHHHHhhccc
Q psy13946          3 KGQQPQSEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKADPRIVQALSLGD   57 (90)
Q Consensus         3 ~G~~~~p~de~tpe~~vdkiF~~mD~N~DG~IS~eEFi~~~~~d~~Il~~L~~~~   57 (90)
                      +|+...|.++.+|++++++||++||+|+||+||++||+++|+.|++|+.+|+.+.
T Consensus       133 ~~~~~~~~~~~~~~~~v~~if~k~D~n~Dg~lT~eef~~~~~~d~~i~~~l~~~~  187 (193)
T KOG0044|consen  133 TGSKALPEDEETPEERVDKIFSKMDKNKDGKLTLEEFIEGCKADPSILRALEQDP  187 (193)
T ss_pred             cccccCCcccccHHHHHHHHHHHcCCCCCCcccHHHHHHHhhhCHHHHHHhhhcc
Confidence            4666667889999999999999999999999999999999999999999997655



>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A Back     alignment and domain information
>KOG0034|consensus Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) Back     alignment and domain information
>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>KOG0027|consensus Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>KOG0027|consensus Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) Back     alignment and domain information
>KOG0037|consensus Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>KOG0044|consensus Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>smart00054 EFh EF-hand, calcium binding motif Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>KOG0036|consensus Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>KOG0034|consensus Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>KOG4251|consensus Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>KOG0377|consensus Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>KOG4223|consensus Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional Back     alignment and domain information
>KOG4223|consensus Back     alignment and domain information
>PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A Back     alignment and domain information
>PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins Back     alignment and domain information
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 Back     alignment and domain information
>KOG0028|consensus Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>KOG0036|consensus Back     alignment and domain information
>KOG4065|consensus Back     alignment and domain information
>PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A Back     alignment and domain information
>PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins Back     alignment and domain information
>KOG0028|consensus Back     alignment and domain information
>KOG0041|consensus Back     alignment and domain information
>KOG0038|consensus Back     alignment and domain information
>KOG0037|consensus Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>KOG0031|consensus Back     alignment and domain information
>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>PF14658 EF-hand_9: EF-hand domain Back     alignment and domain information
>KOG3555|consensus Back     alignment and domain information
>PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A Back     alignment and domain information
>KOG2643|consensus Back     alignment and domain information
>KOG2643|consensus Back     alignment and domain information
>KOG4578|consensus Back     alignment and domain information
>KOG1029|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query90
1g8i_A190 Crystal Structure Of Human Frequenin (Neuronal Calc 4e-15
2l2e_A190 Solution Nmr Structure Of Myristoylated Ncs1p In Ap 1e-13
1fpw_A190 Structure Of Yeast Frequenin Length = 190 1e-11
1bjf_A193 Crystal Structure Of Recombinant Bovine Neurocalcin 5e-10
2d8n_A207 Crystal Structure Of Human Recoverin At 2.2 A Resol 6e-06
2i94_A202 Nmr Structure Of Recoverin Bound To Rhodopsin Kinas 2e-05
2het_A189 Non-Myristoylated Bovine Recoverin (Truncated At C- 2e-05
1omv_A201 Non-Myristoylated Bovine Recoverin (E85q Mutant) Wi 2e-05
1omr_A201 Non-Myristoylated Wild-Type Bovine Recoverin With C 2e-05
1la3_A201 Solution Structure Of Recoverin Mutant, E85q Length 2e-05
1jsa_A201 Myristoylated Recoverin With Two Calciums Bound, Nm 2e-05
2i2r_E180 Crystal Structure Of The Kchip1KV4.3 T1 COMPLEX Len 8e-05
1s1e_A224 Crystal Structure Of Kv Channel-Interacting Protein 8e-05
2nz0_A180 Crystal Structure Of Potassium Channel Kv4.3 In Com 8e-05
1s6c_A183 Crystal Structure Of The Complex Between Kchip1 And 1e-04
2e6w_A100 Solution Structure And Calcium Binding Properties O 3e-04
1jba_A204 Unmyristoylated Gcap-2 With Three Calcium Ions Boun 6e-04
>pdb|1G8I|A Chain A, Crystal Structure Of Human Frequenin (Neuronal Calcium Sensor 1) Length = 190 Back     alignment and structure

Iteration: 1

Score = 76.3 bits (186), Expect = 4e-15, Method: Compositional matrix adjust. Identities = 36/48 (75%), Positives = 42/48 (87%) Query: 10 EDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKADPRIVQALSLGD 57 E+ENTP+KRVD+IF MDKN D +LTL+EF+EGSKADP IVQALSL D Sbjct: 140 EEENTPEKRVDRIFAMMDKNADGKLTLQEFQEGSKADPSIVQALSLYD 187
>pdb|2L2E|A Chain A, Solution Nmr Structure Of Myristoylated Ncs1p In Apo Form Length = 190 Back     alignment and structure
>pdb|1FPW|A Chain A, Structure Of Yeast Frequenin Length = 190 Back     alignment and structure
>pdb|1BJF|A Chain A, Crystal Structure Of Recombinant Bovine Neurocalcin Delta At 2.4 Angstroms Length = 193 Back     alignment and structure
>pdb|2D8N|A Chain A, Crystal Structure Of Human Recoverin At 2.2 A Resolution Length = 207 Back     alignment and structure
>pdb|2I94|A Chain A, Nmr Structure Of Recoverin Bound To Rhodopsin Kinase Length = 202 Back     alignment and structure
>pdb|2HET|A Chain A, Non-Myristoylated Bovine Recoverin (Truncated At C-Terminus) With Calcium Bound To Ef-Hand 3 Length = 189 Back     alignment and structure
>pdb|1OMV|A Chain A, Non-Myristoylated Bovine Recoverin (E85q Mutant) With Calcium Bound To Ef-Hand 3 Length = 201 Back     alignment and structure
>pdb|1OMR|A Chain A, Non-Myristoylated Wild-Type Bovine Recoverin With Calcium Bound To Ef- Hand 3 Length = 201 Back     alignment and structure
>pdb|1LA3|A Chain A, Solution Structure Of Recoverin Mutant, E85q Length = 201 Back     alignment and structure
>pdb|1JSA|A Chain A, Myristoylated Recoverin With Two Calciums Bound, Nmr, 24 Structures Length = 201 Back     alignment and structure
>pdb|2I2R|E Chain E, Crystal Structure Of The Kchip1KV4.3 T1 COMPLEX Length = 180 Back     alignment and structure
>pdb|1S1E|A Chain A, Crystal Structure Of Kv Channel-Interacting Protein 1 (Kchip-1) Length = 224 Back     alignment and structure
>pdb|2NZ0|A Chain A, Crystal Structure Of Potassium Channel Kv4.3 In Complex With Its Regulatory Subunit Kchip1 (Casp Target) Length = 180 Back     alignment and structure
>pdb|1S6C|A Chain A, Crystal Structure Of The Complex Between Kchip1 And Kv4.2 N1-30 Length = 183 Back     alignment and structure
>pdb|2E6W|A Chain A, Solution Structure And Calcium Binding Properties Of Ef- Hands 3 And 4 Of Calsenilin Length = 100 Back     alignment and structure
>pdb|1JBA|A Chain A, Unmyristoylated Gcap-2 With Three Calcium Ions Bound Length = 204 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query90
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 2e-17
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 7e-17
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 1e-16
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 1e-16
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 3e-16
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 4e-16
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 1e-15
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 2e-15
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 3e-15
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 2e-14
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 5e-14
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 5e-14
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 5e-14
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 6e-14
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 1e-13
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 3e-12
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 2e-06
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 5e-06
3a4u_B143 Multiple coagulation factor deficiency protein 2; 8e-04
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Length = 190 Back     alignment and structure
 Score = 71.4 bits (175), Expect = 2e-17
 Identities = 36/58 (62%), Positives = 41/58 (70%)

Query: 1   MFKGQQPQSEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKADPRIVQALSLGDS 58
           M        EDE+TP+KRV+KIF+ MDKN D +LTLEEF EGSK DP IV ALSL D 
Sbjct: 131 MVGSMVKLPEDEDTPEKRVNKIFNMMDKNKDGQLTLEEFCEGSKRDPTIVSALSLYDG 188


>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Length = 183 Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Length = 193 Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Length = 190 Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Length = 190 Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Length = 229 Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Length = 207 Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Length = 204 Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Length = 224 Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Length = 207 Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Length = 183 Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Length = 198 Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Length = 256 Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Length = 226 Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Length = 211 Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Length = 214 Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Length = 208 Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Length = 103 Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Length = 143 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query90
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 98.77
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 98.67
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 98.67
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 98.61
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 98.59
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 98.57
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 98.56
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 98.53
2lv7_A100 Calcium-binding protein 7; metal binding protein; 98.52
3li6_A66 Calcium-binding protein; calcium signaling protein 98.52
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 98.5
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 98.47
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 98.45
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 98.44
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 98.42
1y1x_A191 Leishmania major homolog of programmed cell death 98.42
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 98.42
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 98.42
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 98.41
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 98.41
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 98.4
1c07_A95 Protein (epidermal growth factor receptor pathway 98.39
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 98.39
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 98.38
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 98.38
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 98.37
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 98.36
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 98.35
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 98.35
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 98.35
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 98.34
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 98.33
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 98.33
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 98.33
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 98.33
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 98.33
1avs_A90 Troponin C; muscle contraction, calcium-activated, 98.32
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 98.32
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 98.32
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 98.32
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 98.31
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 98.31
1y1x_A191 Leishmania major homolog of programmed cell death 98.31
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 98.31
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 98.31
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 98.31
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 98.3
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 98.3
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 98.3
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 98.3
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 98.3
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 98.29
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 98.29
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 98.29
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 98.29
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 98.29
3akb_A166 Putative calcium binding protein; EF-hand, metal b 98.29
1exr_A148 Calmodulin; high resolution, disorder, metal trans 98.28
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 98.28
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 98.28
3fwb_A161 Cell division control protein 31; gene gating, com 98.28
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 98.28
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 98.28
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 98.28
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 98.28
3akb_A166 Putative calcium binding protein; EF-hand, metal b 98.28
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 98.28
2jnf_A158 Troponin C; stretch activated muscle contraction, 98.27
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 98.27
3a4u_B143 Multiple coagulation factor deficiency protein 2; 98.27
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 98.26
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 98.26
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 98.25
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 98.25
3a4u_B143 Multiple coagulation factor deficiency protein 2; 98.25
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 98.24
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 98.24
1qjt_A99 EH1, epidermal growth factor receptor substrate su 98.23
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 98.23
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 98.23
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 98.22
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 98.22
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 98.22
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 98.22
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 98.21
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 98.21
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 98.2
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 98.2
2f33_A 263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 98.2
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 98.2
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 98.19
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 98.19
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 98.19
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 98.18
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 98.18
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 98.18
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 98.18
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 98.18
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 98.18
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 98.18
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 98.18
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 98.17
3fwb_A161 Cell division control protein 31; gene gating, com 98.17
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 98.17
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 98.16
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 98.16
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 98.16
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 98.16
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 98.15
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 98.15
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 98.15
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 98.15
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 98.15
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 98.15
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 98.15
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 98.15
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 98.14
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 98.14
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 98.13
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 98.13
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 98.13
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 98.13
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 98.13
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 98.13
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 98.12
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 98.12
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 98.12
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 98.12
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 98.12
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 98.11
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 98.11
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 98.1
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 98.1
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 98.1
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 98.1
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 98.1
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 98.1
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 98.09
1exr_A148 Calmodulin; high resolution, disorder, metal trans 98.09
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 98.09
2jnf_A158 Troponin C; stretch activated muscle contraction, 98.08
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 98.08
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 98.08
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 98.07
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 98.07
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 98.07
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 98.07
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 98.06
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 98.06
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 98.06
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 98.06
2hps_A186 Coelenterazine-binding protein with bound coelent; 98.06
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 98.05
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 98.05
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 98.05
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 98.05
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 98.05
2be4_A 272 Hypothetical protein LOC449832; DR.36843, BC083168 98.05
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 98.05
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 98.05
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 98.04
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 98.03
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 98.03
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 98.03
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 98.03
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 98.03
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 98.03
3lij_A494 Calcium/calmodulin dependent protein kinase with A 98.02
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 98.01
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 98.01
1s6i_A 188 CDPK, calcium-dependent protein kinase SK5; EF-han 98.01
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 98.01
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 98.0
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 98.0
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 98.0
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 97.99
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 97.99
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 97.98
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 97.98
3lij_A494 Calcium/calmodulin dependent protein kinase with A 97.97
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 97.97
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 97.97
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 97.97
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 97.97
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 97.96
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 97.96
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 97.96
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 97.94
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 97.94
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 97.93
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 97.93
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 97.93
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 97.92
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 97.92
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 97.92
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 97.91
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 97.91
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 97.91
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 97.91
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 97.9
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 97.9
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 97.88
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 97.88
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 97.88
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 97.87
3li6_A66 Calcium-binding protein; calcium signaling protein 97.87
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 97.87
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 97.87
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 97.86
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 97.85
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 97.84
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 97.84
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 97.84
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 97.84
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 97.83
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 97.83
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 97.82
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 97.81
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 97.81
2jq6_A139 EH domain-containing protein 1; metal binding prot 97.8
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 97.8
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 97.79
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 97.79
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 97.79
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 97.79
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 97.78
1sra_A151 Sparc; extracellular matrix protein, calcium-bindi 97.77
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 97.76
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 97.75
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 97.75
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 97.74
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 97.73
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 97.72
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 97.72
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 97.71
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 97.69
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 97.68
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 97.67
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 97.66
1qxp_A900 MU-like calpain; M-calpain, MU-calpain, catalytic 97.65
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 97.64
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 97.64
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 97.63
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 97.62
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 97.61
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 97.57
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 97.54
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 97.53
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 97.53
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 97.51
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 97.51
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 97.5
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 97.48
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 97.47
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 97.45
2hps_A186 Coelenterazine-binding protein with bound coelent; 97.44
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 97.43
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 97.42
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 97.42
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 97.42
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 97.42
1avs_A90 Troponin C; muscle contraction, calcium-activated, 97.4
2lv7_A100 Calcium-binding protein 7; metal binding protein; 97.39
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 97.39
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 97.37
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 97.36
1qxp_A 900 MU-like calpain; M-calpain, MU-calpain, catalytic 97.35
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 97.34
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 97.33
1qjt_A99 EH1, epidermal growth factor receptor substrate su 97.33
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 97.32
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 97.31
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 97.31
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 97.31
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 97.29
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 97.29
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 97.27
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 97.26
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 97.25
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 97.24
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 97.22
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 97.22
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 97.21
1ij5_A 323 Plasmodial specific LAV1-2 protein; fourty kDa cal 97.19
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 97.19
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 97.18
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 97.18
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 97.18
1c07_A95 Protein (epidermal growth factor receptor pathway 97.17
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 97.16
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 97.15
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 97.09
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 97.07
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 97.01
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 96.92
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 96.87
2jq6_A139 EH domain-containing protein 1; metal binding prot 96.8
2kld_A123 Polycystin-2; PC2, PKD2, calcium binding domain, E 96.79
1sra_A151 Sparc; extracellular matrix protein, calcium-bindi 96.77
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 96.76
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 96.71
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 96.69
1nub_A229 Basement membrane protein BM-40; extracellular mod 96.68
1nub_A229 Basement membrane protein BM-40; extracellular mod 96.5
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 96.43
1h8b_A75 ACT-EF34, alpha-actinin 2, skeletal muscle isoform 95.68
2zkm_X 799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 95.58
2zkm_X 799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 95.19
1h8b_A75 ACT-EF34, alpha-actinin 2, skeletal muscle isoform 94.97
3ohm_B 885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 94.68
2kld_A123 Polycystin-2; PC2, PKD2, calcium binding domain, E 94.52
1tuz_A118 Diacylglycerol kinase alpha; transferase, HR532, n 93.92
3ohm_B 885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 93.19
3qr0_A 816 Phospholipase C-beta (PLC-beta); PH domain, EF han 90.73
4fl4_A88 Glycoside hydrolase family 9; structural genomics, 88.51
2qpt_A550 EH domain-containing protein-2; protein-nucleotide 87.9
3qr0_A 816 Phospholipase C-beta (PLC-beta); PH domain, EF han 87.53
2y3n_B71 Cellulosomal family-48 processive glycoside hydro; 86.93
2vn6_B64 Endoglucanase A; cell adhesion, carbohydrate metab 83.76
4dh2_B82 Dockerin type 1; cellulosome, cohesin, type I cohe 83.02
3ul4_B65 Cellulosome enzyme, dockerin type I; cohesin, type 82.49
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
Probab=98.77  E-value=5.9e-09  Score=69.64  Aligned_cols=56  Identities=50%  Similarity=0.815  Sum_probs=40.9

Q ss_pred             CCCCcccHHHHHHHHHHhcCCCCCCccCHHHHHhhhhCCHHHHHHhhcccCCCCCCCCCc
Q psy13946          8 QSEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKADPRIVQALSLGDSSNVAPSGSS   67 (90)
Q Consensus         8 ~p~de~tpe~~vdkiF~~mD~N~DG~IS~eEFi~~~~~d~~Il~~L~~~~~~D~d~sG~i   67 (90)
                      ++..+..++..+..+|+.+|+|+||.||++||+..+..++.+..++    .+|.|++|.|
T Consensus       138 ~~~~~~~~~~~~~~~f~~~D~d~dG~I~~~Ef~~~~~~~~~~~~~~----~~D~~~dG~i  193 (193)
T 1bjf_A          138 MPEDESTPEKRTEKIFRQMDTNRDGKLSLEEFIRGAKSDPSIVRLL----QCDPSSAGQF  193 (193)
T ss_dssp             SCGGGSSHHHHHHHHHHHSCTTCSSEECHHHHHHHHHHCTHHHHTT----CC--------
T ss_pred             CCcccccHHHHHHHHHHHhCCCCCCeEeHHHHHHHHhcCHHHHHHh----ccCCCCCCCC
Confidence            4555567788999999999999999999999999999888776654    7899999976



>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A Back     alignment and structure
>1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* Back     alignment and structure
>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A Back     alignment and structure
>1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>4fl4_A Glycoside hydrolase family 9; structural genomics, montreal-kingston bacterial structural initiative, BSGI, dockerin; 2.80A {Clostridium thermocellum} PDB: 3p0d_A Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>2y3n_B Cellulosomal family-48 processive glycoside hydro; structrual protein-hydrolase complex, cellulosome; 1.90A {Bacteroides cellulosolvens} Back     alignment and structure
>2vn6_B Endoglucanase A; cell adhesion, carbohydrate metabolism, polysaccharide degradation, hydrolase, glycosidase, cellulose degradation; 1.49A {Clostridium cellulolyticum} PDB: 2vn5_B Back     alignment and structure
>4dh2_B Dockerin type 1; cellulosome, cohesin, type I cohesin-dockerin, Pro protein interaction, cell adhesion; 1.75A {Clostridium thermocellum} Back     alignment and structure
>3ul4_B Cellulosome enzyme, dockerin type I; cohesin, type I cohesin-dockerin COMP protein-protein interaction, cell adhesion; HET: PEG; 1.95A {Clostridium thermocellum} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 90
d1fpwa_190 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 5e-13
d1g8ia_187 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 3e-12
d1s6ca_178 a.39.1.5 (A:) Kchip1, Kv4 potassium channel-intera 5e-12
d1bjfa_181 a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId 6e-11
d1omra_201 a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 2e-10
d1jbaa_189 a.39.1.5 (A:) Guanylate cyclase activating protein 2e-09
d2zfda1183 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 { 1e-07
d1xo5a_180 a.39.1.5 (A:) Calcium- and integrin-binding protei 3e-07
d1snla_99 a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo 5e-05
d1ij5a_321 a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind 5e-04
d1auib_165 a.39.1.5 (B:) Calcineurin regulatory subunit (B-ch 6e-04
d1jfja_134 a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histoly 8e-04
d1jfja_134 a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histoly 0.002
d1y1xa_182 a.39.1.8 (A:) Programmed cell death 6 protein-like 9e-04
d1dtla_156 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 0.002
d2scpa_174 a.39.1.5 (A:) Sarcoplasmic calcium-binding protein 0.002
d1nyaa_176 a.39.1.5 (A:) Calerythrin {Saccharopolyspora eryth 0.002
d1xk4c183 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sa 0.003
d2obha1141 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapien 0.004
d1j55a_94 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 0.004
d1e8aa_87 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 0.004
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 190 Back     information, alignment and structure

class: All alpha proteins
fold: EF Hand-like
superfamily: EF-hand
family: Calmodulin-like
domain: Frequenin (neuronal calcium sensor 1)
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
 Score = 59.1 bits (142), Expect = 5e-13
 Identities = 32/58 (55%), Positives = 38/58 (65%)

Query: 1   MFKGQQPQSEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKADPRIVQALSLGDS 58
           M       +EDE TP+ RV KIF  MDKN D  +TL+EFREGSK DP I+ AL+L D 
Sbjct: 131 MMGSMVTLNEDEATPEMRVKKIFKLMDKNEDGYITLDEFREGSKVDPSIIGALNLYDG 188


>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 187 Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 178 Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Length = 181 Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Length = 201 Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Length = 189 Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 183 Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Length = 180 Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Length = 165 Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Length = 134 Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Length = 134 Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Length = 182 Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 156 Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Length = 174 Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Length = 176 Back     information, alignment and structure
>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Length = 141 Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Length = 87 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query90
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 99.13
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 99.1
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 99.03
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 99.01
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 98.92
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 98.88
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 98.73
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 98.65
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 98.65
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 98.64
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 98.54
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 98.54
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 98.53
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 98.53
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 98.49
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 98.45
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.44
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 98.39
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 98.38
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 98.38
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 98.36
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 98.35
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.33
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 98.33
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 98.33
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 98.31
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 98.27
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 98.26
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 98.26
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 98.24
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 98.23
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 98.23
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 98.23
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 98.22
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 98.21
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 98.21
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 98.2
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 98.2
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 98.19
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 98.19
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 98.18
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 98.17
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 98.13
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 98.13
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 98.12
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 98.1
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.09
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 98.09
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 98.08
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 98.07
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 98.07
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 98.07
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 98.05
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 98.04
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 98.03
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 98.02
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 98.01
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 97.98
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 97.98
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 97.96
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 97.94
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 97.91
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 97.91
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 97.88
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 97.87
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 97.86
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 97.85
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 97.84
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 97.84
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 97.84
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 97.83
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 97.78
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 97.75
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 97.75
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 97.73
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 97.72
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 97.7
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 97.69
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 97.68
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 97.67
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 97.67
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 97.65
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 97.64
d1ij5a_ 321 Cbp40 (plasmodial specific CaII-binding protein LA 97.63
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 97.63
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 97.63
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 97.62
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 97.62
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 97.62
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 97.62
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 97.61
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 97.61
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 97.61
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 97.6
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 97.6
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 97.6
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 97.58
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 97.57
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 97.57
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 97.56
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 97.55
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 97.54
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 97.52
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 97.52
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 97.51
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 97.5
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 97.48
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 97.48
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 97.47
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 97.45
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 97.45
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 97.43
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 97.42
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 97.41
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 97.41
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 97.37
d3cr5x190 Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 97.37
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 97.37
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 97.37
d1uhka1 187 Calcium-regulated photoprotein {Jellyfish (Aequore 97.35
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 97.35
d1qlsa_95 Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 97.32
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 97.31
d2sasa_ 185 Sarcoplasmic calcium-binding protein {Amphioxus (B 97.28
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 97.28
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 97.28
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 97.27
d1xk4c183 Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr 97.27
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 97.27
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 97.26
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 97.26
d1ij5a_321 Cbp40 (plasmodial specific CaII-binding protein LA 97.23
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 97.22
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 97.22
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 97.21
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 97.19
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 97.18
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 97.15
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 97.14
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 97.14
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 97.13
d1j55a_94 Calcyclin (S100) {Human (Homo sapiens), s100p [Tax 97.12
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 97.07
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 97.03
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 96.99
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 96.99
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 96.98
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 96.95
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 96.88
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 96.74
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 96.72
d1tuza_118 Diacylglycerol kinase alpha, N-terminal domain {Hu 96.3
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 96.21
d3cr5x190 Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 94.69
d1qlsa_95 Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 93.99
d1sraa_151 C-terminal (EC) domain of BM-40/SPARC/osteonectin 93.68
d1sraa_151 C-terminal (EC) domain of BM-40/SPARC/osteonectin 92.88
d1xk4c183 Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr 91.52
d1j55a_94 Calcyclin (S100) {Human (Homo sapiens), s100p [Tax 91.47
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: EF Hand-like
superfamily: EF-hand
family: Calmodulin-like
domain: Frequenin (neuronal calcium sensor 1)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.13  E-value=1.8e-11  Score=82.58  Aligned_cols=52  Identities=69%  Similarity=0.970  Sum_probs=48.5

Q ss_pred             CCCCcccHHHHHHHHHHhcCCCCCCccCHHHHHhhhhCCHHHHHHhhcccCC
Q psy13946          8 QSEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKADPRIVQALSLGDSS   59 (90)
Q Consensus         8 ~p~de~tpe~~vdkiF~~mD~N~DG~IS~eEFi~~~~~d~~Il~~L~~~~~~   59 (90)
                      ++..+..+++.++.+|+.+|.|+||+||++||++.++++|.|+++|++|+++
T Consensus       135 ~~~~~~~~~~~v~~if~~~D~d~dG~Is~~EF~~~~~~~p~~~~~l~~~~~~  186 (187)
T d1g8ia_         135 LPEEENTPEKRVDRIFAMMDKNADGKLTLQEFQEGSKADPSIVQALSLYDGL  186 (187)
T ss_dssp             CCGGGSSHHHHHHHHHHHHCSSCSSEEEHHHHHHHHHHCHHHHHHHCCBTTB
T ss_pred             CchhhccHHHHHHHHHHHhCCCCCCcEeHHHHHHHHHHCHHHHHHHHHhhcc
Confidence            5567788899999999999999999999999999999999999999999875



>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Back     information, alignment and structure
>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Back     information, alignment and structure
>d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Back     information, alignment and structure